F474007

General Info

Members Datasets Scaffolds Average Seq Length
669 312 1338 136

Family's Representative Sequence

Representative Sequence 3300021384|Ga0213876_10142704|Ga0213876_101427042
Length 162
Sequence MIRPGPYTLGVALERTLVIIKPDGVQRGLVGPIISRLEARGLKLVGLKLVQVSSDLAARHYAEHEGKPFYPGLLQYITSGPVIVLCVEGTSAVQMVRNTVGATNPLNAAPGTIRADWALDIGRNLIHASDAPATAERELALWFQPDELLAFGRDIDRWVFEG

Samples

Sample ID Description Type Environment
1 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
2 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
5 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
6 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
7 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
24 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
25 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
26 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
27 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
28 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
29 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
40 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
44 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
45 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
50 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
51 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
52 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
53 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
54 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
55 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
56 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
57 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
58 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
59 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
60 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
61 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
62 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
63 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
64 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
65 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
66 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
67 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
69 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
70 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
71 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
72 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
73 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
75 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
76 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
77 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
79 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
80 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
82 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
83 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
84 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
85 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
86 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
87 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
88 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
89 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
90 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
91 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
92 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
93 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
94 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
95 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
96 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
97 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
98 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
99 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
100 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
101 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
102 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
103 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
104 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
105 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
106 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
154 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
158 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
159 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
160 3300031635 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRA1 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
161 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
162 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
163 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
164 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
165 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
166 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
167 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
168 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
169 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
170 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
171 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
172 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
173 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
174 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
175 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
176 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
177 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
178 3300036458 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
179 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
180 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
181 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
182 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
183 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
184 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
185 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
186 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
187 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
188 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
189 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
190 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
191 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
192 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
193 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
194 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
195 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
196 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
197 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
198 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
199 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
200 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
201 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
202 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
203 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
204 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
205 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
206 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
207 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
208 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
209 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
210 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
211 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
212 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
213 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
214 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
215 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
216 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
217 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
218 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
219 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
220 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
221 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
222 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
223 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
224 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
225 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
226 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
227 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
228 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
229 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
230 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
231 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
232 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
233 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
234 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
235 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
236 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
237 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
238 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
239 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
240 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
241 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
242 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
243 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
244 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
245 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
246 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
247 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
248 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
249 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
250 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
251 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
252 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
253 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
254 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
255 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
256 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
257 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
258 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
259 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
260 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
261 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
262 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
263 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
264 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
265 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
266 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
267 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
268 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
269 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
270 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
271 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
272 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
273 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
274 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
275 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
276 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
277 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
278 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
279 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
280 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
281 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
282 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
283 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
284 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
285 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
286 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
287 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
288 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
289 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
290 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
291 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
292 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
293 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
294 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
295 2524023129 Paenibacillus pinihumi DSM 23905 Isolate Rhizosphere
296 2547132424 Nocardia nova SH22a Isolate Unclassified
297 2551306166 Nocardia tenerifensis NBRC 101015 Isolate Rhizosphere
298 2574179768 Azoarcus communis DSM 12120 Isolate Unclassified
299 2643221715 Mycobacterium sp. Root265 Isolate Unclassified
300 2738541264 Mycobacterium sp. OK889 Isolate Unclassified
301 2738541356 Mycobacterium sp. OK887 Isolate Unclassified
302 2738543034 Rhodococcus sp. OK269 Isolate Unclassified
303 2751185725 Microbispora sp. NRRL B-24597 Isolate Unclassified
304 2751185792 Kitasatospora arboriphila NRRL B-24581 Isolate Unclassified
305 2791354903 Mangrovibacter phragmitis MP23 Isolate Unclassified
306 2842134933 Mycolicibacterium obuense SEMIA 442 Isolate Nodule
307 2902792274 Mycolicibacterium sp. P9-64 Isolate Unclassified
308 2902810491 Mycolicibacterium sp. P9-22 Isolate Unclassified
309 2902837492 Mycolicibacterium sp. P1-18 Isolate Unclassified
310 2939582691 Mycolicibacterium sp. 624 Isolate Rhizosphere
311 2956939328 Lolliginicoccus suaedae LNNU 331112 Isolate Rhizosphere
312 3001119090 Lolliginicoccus lacisalsi G463 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.01
Metatranscriptomes 0.3
Isolates 2.69

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.96
Nodule 0.15
Rhizoplane 12.41
Rhizosphere 65.92
Stem 0
Stem Tuber 0
Unclassified 0.15

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0213876_10142704 3300021384 Bacteria 1273
2 JGI24746J21847_1009446 3300001977 Bacteria 1456
3 JGI24737J22298_10090664 3300001990 Bacteria 907
4 JGI24745J21846_1009630 3300002073 Bacteria 1097
5 JGI24744J21845_10000753 3300002077 Bacteria 6034
6 JGI24742J22300_10002239 3300002244 Bacteria 3088
7 Ga0055540_1000167 3300003792 Bacteria 65548
8 Ga0055540_1022205 3300003792 Bacteria 1629
9 Ga0055540_1024793 3300003792 Bacteria 1482
10 Ga0070658_10252233 3300005327 Bacteria 1497
11 Ga0070690_100649164 3300005330 Bacteria 806
12 Ga0068869_100086508 3300005334 Bacteria 2349
13 Ga0070682_100033285 3300005337 Bacteria 3131
14 Ga0068868_100351735 3300005338 Bacteria 1262
15 Ga0068868_100877193 3300005338 Bacteria 814
16 Ga0070691_10223585 3300005341 Bacteria 999
17 Ga0070687_100093670 3300005343 Bacteria 1667
18 Ga0070668_100005599 3300005347 Bacteria 9314
19 Ga0070668_100067753 3300005347 Bacteria 2774
20 Ga0070668_100209749 3300005347 Bacteria 1602
21 Ga0070669_100119592 3300005353 Bacteria 2008
22 Ga0070669_100277553 3300005353 Bacteria 1342
23 Ga0070675_100590181 3300005354 Bacteria 1007
24 Ga0070671_100007371 3300005355 Bacteria 8788
25 Ga0070671_100332714 3300005355 Bacteria 1295
26 Ga0070671_100493562 3300005355 Bacteria 1053
27 Ga0070674_100234280 3300005356 Bacteria 1434
28 Ga0070673_101445121 3300005364 Bacteria 648
29 Ga0070659_100138022 3300005366 Bacteria 1984
30 Ga0070659_100249479 3300005366 Bacteria 1471
31 Ga0070667_100001459 3300005367 Bacteria 21207
32 Ga0070667_100002497 3300005367 Bacteria 16058
33 Ga0070667_100236693 3300005367 Bacteria 1629
34 Ga0070667_100512074 3300005367 Bacteria 1101
35 Ga0070667_101021837 3300005367 Bacteria 772
36 Ga0070709_10424957 3300005434 Bacteria 996
37 Ga0070714_100233645 3300005435 Bacteria 1695
38 Ga0070714_101321333 3300005435 Bacteria 704
39 Ga0070713_100332838 3300005436 Bacteria 1405
40 Ga0070710_10018865 3300005437 Bacteria 3555
41 Ga0070711_100151197 3300005439 Bacteria 1750
42 Ga0070705_100123734 3300005440 Bacteria 1674
43 Ga0070700_100171285 3300005441 Bacteria 1503
44 Ga0070700_100396740 3300005441 Bacteria 1036
45 Ga0070663_100022591 3300005455 Bacteria 4208
46 Ga0070678_101023041 3300005456 Bacteria 760
47 Ga0070662_100379329 3300005457 Bacteria 1163
48 Ga0070662_100708234 3300005457 Bacteria 852
49 Ga0068867_100164428 3300005459 Bacteria 1752
50 Ga0070685_10062992 3300005466 Bacteria 2176
51 Ga0070685_10092595 3300005466 Bacteria 1832
52 Ga0070679_101119438 3300005530 Bacteria 732
53 Ga0070684_101033597 3300005535 Bacteria 771
54 Ga0068853_100026809 3300005539 Bacteria 4841
55 Ga0070672_100176276 3300005543 Bacteria 1780
56 Ga0070672_100180783 3300005543 Bacteria 1757
57 Ga0070672_100877331 3300005543 Bacteria 792
58 Ga0070686_100226382 3300005544 Bacteria 1354
59 Ga0070686_100246230 3300005544 Bacteria 1304
60 Ga0070695_100015543 3300005545 Bacteria 4597
61 Ga0070665_100006900 3300005548 Bacteria 11544
62 Ga0070665_100009212 3300005548 Bacteria 10000
63 Ga0070665_100018784 3300005548 Bacteria 6931
64 Ga0070665_100162683 3300005548 Bacteria 2234
65 Ga0070665_100663812 3300005548 Bacteria 1056
66 Ga0070665_101748449 3300005548 Bacteria 629
67 Ga0068855_102551633 3300005563 Bacteria 508
68 Ga0070664_100791794 3300005564 Bacteria 886
69 Ga0068854_100001999 3300005578 Bacteria 12486
70 Ga0068854_100161231 3300005578 Bacteria 1737
71 Ga0070702_100479615 3300005615 Bacteria 909
72 Ga0068852_100031842 3300005616 Bacteria 4359
73 Ga0068852_100094796 3300005616 Bacteria 2679
74 Ga0068859_100000438 3300005617 Bacteria 41832
75 Ga0068859_100036243 3300005617 Bacteria 4952
76 Ga0068859_100514556 3300005617 Bacteria 1292
77 Ga0068859_100894869 3300005617 Bacteria 972
78 Ga0068859_101078902 3300005617 Bacteria 883
79 Ga0068859_101492793 3300005617 Bacteria 746
80 Ga0068864_100247085 3300005618 Bacteria 1655
81 Ga0068866_10000393 3300005718 Bacteria 20456
82 Ga0068866_10027918 3300005718 Bacteria 2684
83 Ga0068866_10818319 3300005718 Bacteria 649
84 Ga0068866_10969865 3300005718 Bacteria 602
85 Ga0068861_100001205 3300005719 Bacteria 16102
86 Ga0068861_100040542 3300005719 Bacteria 3483
87 Ga0068851_10022380 3300005834 Bacteria 3078
88 Ga0068863_100000983 3300005841 Bacteria 28633
89 Ga0068863_100035131 3300005841 Bacteria 4775
90 Ga0068863_100078490 3300005841 Bacteria 3126
91 Ga0068863_101548685 3300005841 Bacteria 672
92 Ga0068858_100002189 3300005842 Bacteria 19795
93 Ga0068858_100062066 3300005842 Bacteria 3455
94 Ga0068858_100067484 3300005842 Bacteria 3313
95 Ga0068858_100739406 3300005842 Bacteria 958
96 Ga0068860_100000010 3300005843 Bacteria 359114
97 Ga0068860_100011256 3300005843 Bacteria 8817
98 Ga0068860_100183172 3300005843 Bacteria 2024
99 Ga0068862_100000008 3300005844 Bacteria 305510
100 Ga0068862_100024355 3300005844 Bacteria 5078
101 Ga0068862_100217793 3300005844 Bacteria 1727
102 Ga0081455_10062486 3300005937 Bacteria 3130
103 Ga0081538_10090598 3300005981 Bacteria 1582
104 Ga0081538_10114299 3300005981 Bacteria 1315
105 Ga0075365_10043697 3300006038 Bacteria 2934
106 Ga0075365_10224494 3300006038 Bacteria 1318
107 Ga0075365_10353342 3300006038 Bacteria 1036
108 Ga0075363_100001672 3300006048 Bacteria 8579
109 Ga0075363_100004666 3300006048 Bacteria 6027
110 Ga0075363_100257640 3300006048 Bacteria 1006
111 Ga0075364_10018513 3300006051 Bacteria 4360
112 Ga0075364_10075429 3300006051 Bacteria 2225
113 Ga0075364_10128210 3300006051 Bacteria 1702
114 Ga0075364_10347462 3300006051 Bacteria 1011
115 Ga0070716_100003705 3300006173 Bacteria 7235
116 Ga0070716_100079402 3300006173 Bacteria 1954
117 Ga0070712_100003530 3300006175 Bacteria 9625
118 Ga0070712_100007739 3300006175 Bacteria 6724
119 Ga0075362_10009070 3300006177 Bacteria 3830
120 Ga0075367_10098665 3300006178 Bacteria 1784
121 Ga0075367_10214635 3300006178 Bacteria 1203
122 Ga0075369_10004111 3300006186 Bacteria 5356
123 Ga0075369_10020242 3300006186 Bacteria 2723
124 Ga0075369_10020319 3300006186 Bacteria 2719
125 Ga0075369_10049916 3300006186 Bacteria 1808
126 Ga0075369_10194679 3300006186 Bacteria 935
127 Ga0075366_10358070 3300006195 Bacteria 896
128 Ga0097621_100323433 3300006237 Bacteria 1366
129 Ga0075370_10068521 3300006353 Bacteria 2027
130 Ga0075370_10163484 3300006353 Bacteria 1307
131 Ga0075370_10168757 3300006353 Bacteria 1286
132 Ga0075370_10530460 3300006353 Bacteria 711
133 Ga0068871_100225268 3300006358 Bacteria 1626
134 Ga0068871_100420213 3300006358 Bacteria 1194
135 Ga0075434_100002729 3300006871 Bacteria 15593
136 Ga0075434_101476081 3300006871 Bacteria 689
137 Ga0068865_100001012 3300006881 Bacteria 16167
138 Ga0068865_100307738 3300006881 Bacteria 1270
139 Ga0068865_100704200 3300006881 Bacteria 863
140 Ga0075436_100770991 3300006914 Bacteria 715
141 Ga0075436_101071692 3300006914 Bacteria 606
142 Ga0097620_100000438 3300006931 Bacteria 41832
143 Ga0097620_100036243 3300006931 Bacteria 4952
144 Ga0097620_100514542 3300006931 Bacteria 1292
145 Ga0097620_100894881 3300006931 Bacteria 972
146 Ga0097620_101078785 3300006931 Bacteria 883
147 Ga0097620_101492703 3300006931 Bacteria 746
148 Ga0075435_100003169 3300007076 Bacteria 11122
149 Ga0105244_10150524 3300009036 Bacteria 1115
150 Ga0105240_10261301 3300009093 Bacteria 1997
151 Ga0111539_10100351 3300009094 Bacteria 3399
152 Ga0105245_10001613 3300009098 Bacteria 20521
153 Ga0105245_10134314 3300009098 Bacteria 2324
154 Ga0105245_10411505 3300009098 Bacteria 1354
155 Ga0105247_10000019 3300009101 Bacteria 245170
156 Ga0105247_10014820 3300009101 Bacteria 4672
157 Ga0105247_10033952 3300009101 Bacteria 3106
158 Ga0105247_10343942 3300009101 Bacteria 1047
159 Ga0114129_10198517 3300009147 Bacteria 2719
160 Ga0105243_10000890 3300009148 Bacteria 28112
161 Ga0105241_10009845 3300009174 Bacteria 7025
162 Ga0105242_10012392 3300009176 Bacteria 6562
163 Ga0105242_10105622 3300009176 Bacteria 2392
164 Ga0105242_10758701 3300009176 Bacteria 956
165 Ga0105248_10000093 3300009177 Bacteria 98669
166 Ga0105248_10004508 3300009177 Bacteria 15409
167 Ga0105248_10161187 3300009177 Bacteria 2530
168 Ga0105248_11377237 3300009177 Bacteria 798
169 Ga0105237_10003700 3300009545 Bacteria 18026
170 Ga0105237_10007819 3300009545 Bacteria 11655
171 Ga0105237_10066920 3300009545 Bacteria 3587
172 Ga0105237_12381051 3300009545 Bacteria 540
173 Ga0105238_10172335 3300009551 Bacteria 2140
174 Ga0105238_11697071 3300009551 Bacteria 663
175 Ga0105249_10000019 3300009553 Bacteria 273807
176 Ga0105249_10002099 3300009553 Bacteria 17291
177 Ga0105249_10189597 3300009553 Bacteria 2006
178 Ga0105239_10009784 3300010375 Bacteria 10776
179 Ga0105239_10027384 3300010375 Bacteria 6275
180 Ga0105239_10133157 3300010375 Bacteria 2766
181 Ga0105239_10284794 3300010375 Bacteria 1861
182 Ga0105246_11838223 3300011119 Bacteria 580
183 Ga0157371_10541745 3300013102 Bacteria 862
184 Ga0157369_10256235 3300013105 Bacteria 1825
185 Ga0157374_10334502 3300013296 Bacteria 1502
186 Ga0157374_10348997 3300013296 Bacteria 1470
187 Ga0157374_10439824 3300013296 Bacteria 1304
188 Ga0157374_10687881 3300013296 Bacteria 1035
189 Ga0157378_10001194 3300013297 Bacteria 23585
190 Ga0157378_10400805 3300013297 Bacteria 1352
191 Ga0157378_10414567 3300013297 Bacteria 1330
192 Ga0163162_10001044 3300013306 Bacteria 25758
193 Ga0163162_10107050 3300013306 Bacteria 2891
194 Ga0163162_10211401 3300013306 Bacteria 2070
195 Ga0163162_10416471 3300013306 Bacteria 1476
196 Ga0163162_10503537 3300013306 Bacteria 1341
197 Ga0157372_10003021 3300013307 Bacteria 18138
198 Ga0157372_10925059 3300013307 Bacteria 1011
199 Ga0157375_10015925 3300013308 Bacteria 6742
200 Ga0157375_10133007 3300013308 Bacteria 2608
201 Ga0157375_10384729 3300013308 Bacteria 1570
202 Ga0157375_11526571 3300013308 Bacteria 789
203 Ga0163163_10183282 3300014325 Bacteria 2141
204 Ga0163163_12000683 3300014325 Bacteria 639
205 Ga0163163_12127684 3300014325 Bacteria 621
206 Ga0157380_10045758 3300014326 Bacteria 3436
207 Ga0157380_10235501 3300014326 Bacteria 1647
208 Ga0157380_11024235 3300014326 Bacteria 860
209 Ga0157380_11434464 3300014326 Bacteria 742
210 Ga0157377_10009698 3300014745 Bacteria 4737
211 Ga0157377_10052953 3300014745 Bacteria 2293
212 Ga0157379_10016977 3300014968 Bacteria 6407
213 Ga0157379_10109822 3300014968 Bacteria 2477
214 Ga0157379_10593300 3300014968 Bacteria 1034
215 Ga0157379_10715366 3300014968 Bacteria 941
216 Ga0157379_10946904 3300014968 Bacteria 819
217 Ga0157376_10053948 3300014969 Bacteria 3349
218 Ga0163161_10046214 3300017792 Bacteria 3141
219 Ga0163161_10480413 3300017792 Bacteria 1009
220 Ga0213876_10007506 3300021384 Bacteria 5930
221 Ga0213875_10052934 3300021388 Bacteria 1901
222 Ga0209673_1038469 3300025273 Bacteria 1392
223 Ga0209051_1000048 3300025303 Bacteria 292755
224 Ga0209051_1000576 3300025303 Bacteria 44167
225 Ga0207692_10001354 3300025898 Bacteria 9143
226 Ga0207642_10010575 3300025899 Bacteria 3260
227 Ga0207642_10600920 3300025899 Bacteria 685
228 Ga0207710_10000036 3300025900 Bacteria 245176
229 Ga0207710_10041383 3300025900 Bacteria 2044
230 Ga0207710_10613610 3300025900 Bacteria 569
231 Ga0207688_10006189 3300025901 Bacteria 6511
232 Ga0207688_10011172 3300025901 Bacteria 4889
233 Ga0207647_10029662 3300025904 Bacteria 3536
234 Ga0207647_10053541 3300025904 Bacteria 2486
235 Ga0207647_10116481 3300025904 Bacteria 1577
236 Ga0207645_10010111 3300025907 Bacteria 6493
237 Ga0207705_10245477 3300025909 Bacteria 1365
238 Ga0207671_10002168 3300025914 Bacteria 21336
239 Ga0207671_10044586 3300025914 Bacteria 3280
240 Ga0207693_10012671 3300025915 Bacteria 6809
241 Ga0207693_10019708 3300025915 Bacteria 5364
242 Ga0207663_10040535 3300025916 Bacteria 2831
243 Ga0207681_10002486 3300025923 Bacteria 11700
244 Ga0207681_10020446 3300025923 Bacteria 4195
245 Ga0207681_10609911 3300025923 Bacteria 902
246 Ga0207694_10003944 3300025924 Bacteria 11707
247 Ga0207694_10485740 3300025924 Bacteria 1033
248 Ga0207650_10260040 3300025925 Bacteria 1408
249 Ga0207659_10503541 3300025926 Bacteria 1025
250 Ga0207659_10985243 3300025926 Bacteria 725
251 Ga0207687_10002356 3300025927 Bacteria 12839
252 Ga0207687_10078313 3300025927 Bacteria 2380
253 Ga0207687_10096443 3300025927 Bacteria 2167
254 Ga0207700_10588613 3300025928 Bacteria 990
255 Ga0207664_10382385 3300025929 Bacteria 1250
256 Ga0207644_10039495 3300025931 Bacteria 3331
257 Ga0207644_10194124 3300025931 Bacteria 1598
258 Ga0207644_10421726 3300025931 Bacteria 1093
259 Ga0207644_10967301 3300025931 Bacteria 714
260 Ga0207644_11087311 3300025931 Bacteria 672
261 Ga0207690_10293799 3300025932 Bacteria 1269
262 Ga0207690_11536468 3300025932 Bacteria 556
263 Ga0207706_10002740 3300025933 Bacteria 17123
264 Ga0207706_10029697 3300025933 Bacteria 4879
265 Ga0207706_10971722 3300025933 Bacteria 715
266 Ga0207686_10068946 3300025934 Bacteria 2267
267 Ga0207709_10019053 3300025935 Bacteria 3851
268 Ga0207709_10068693 3300025935 Bacteria 2241
269 Ga0207670_10003409 3300025936 Bacteria 8438
270 Ga0207669_10001808 3300025937 Bacteria 9057
271 Ga0207669_10406062 3300025937 Bacteria 1068
272 Ga0207704_10000524 3300025938 Bacteria 17047
273 Ga0207704_10147768 3300025938 Bacteria 1654
274 Ga0207704_10375295 3300025938 Bacteria 1115
275 Ga0207665_10001424 3300025939 Bacteria 16087
276 Ga0207665_10017514 3300025939 Bacteria 4708
277 Ga0207665_10054133 3300025939 Bacteria 2705
278 Ga0207691_10194931 3300025940 Bacteria 1766
279 Ga0207691_10683089 3300025940 Bacteria 866
280 Ga0207711_10000102 3300025941 Bacteria 90198
281 Ga0207711_10170160 3300025941 Bacteria 1976
282 Ga0207689_10007884 3300025942 Bacteria 9300
283 Ga0207689_10074239 3300025942 Bacteria 2795
284 Ga0207661_11042980 3300025944 Bacteria 753
285 Ga0207667_10625737 3300025949 Bacteria 1084
286 Ga0207712_10000025 3300025961 Bacteria 274015
287 Ga0207712_10009129 3300025961 Bacteria 6275
288 Ga0207668_10003382 3300025972 Bacteria 9354
289 Ga0207668_10007660 3300025972 Bacteria 6425
290 Ga0207668_10241226 3300025972 Bacteria 1462
291 Ga0207668_10448600 3300025972 Bacteria 1100
292 Ga0207668_11403660 3300025972 Bacteria 629
293 Ga0207668_12155099 3300025972 Bacteria 502
294 Ga0207640_10024039 3300025981 Bacteria 3671
295 Ga0207658_10000432 3300025986 Bacteria 39565
296 Ga0207658_10002055 3300025986 Bacteria 14995
297 Ga0207658_10013904 3300025986 Bacteria 5508
298 Ga0207658_10023098 3300025986 Bacteria 4337
299 Ga0207658_10072150 3300025986 Bacteria 2616
300 Ga0207658_10926946 3300025986 Bacteria 793
301 Ga0207677_10001266 3300026023 Bacteria 13606
302 Ga0207677_10274978 3300026023 Bacteria 1380
303 Ga0207677_10352128 3300026023 Bacteria 1234
304 Ga0207677_10727517 3300026023 Bacteria 883
305 Ga0207677_10863218 3300026023 Bacteria 814
306 Ga0207703_10016378 3300026035 Bacteria 5779
307 Ga0207703_10114649 3300026035 Bacteria 2305
308 Ga0207703_10685373 3300026035 Bacteria 974
309 Ga0207639_10025185 3300026041 Bacteria 4314
310 Ga0207639_10032291 3300026041 Bacteria 3853
311 Ga0207639_10253928 3300026041 Bacteria 1534
312 Ga0207678_10015591 3300026067 Bacteria 6682
313 Ga0207678_10027140 3300026067 Bacteria 4993
314 Ga0207678_11152067 3300026067 Bacteria 687
315 Ga0207708_10006833 3300026075 Bacteria 8439
316 Ga0207708_10503625 3300026075 Bacteria 1015
317 Ga0207702_10377567 3300026078 Bacteria 1362
318 Ga0207641_10002536 3300026088 Bacteria 16802
319 Ga0207641_10609608 3300026088 Bacteria 1069
320 Ga0207648_10024169 3300026089 Bacteria 5429
321 Ga0207648_10032271 3300026089 Bacteria 4624
322 Ga0207675_100013710 3300026118 Bacteria 7566
323 Ga0207675_100045868 3300026118 Bacteria 4082
324 Ga0207675_100433255 3300026118 Bacteria 1300
325 Ga0207683_10000147 3300026121 Bacteria 58383
326 Ga0207698_10109711 3300026142 Bacteria 2310
327 Ga0209179_1096061 3300027512 Bacteria 658
328 Ga0207428_10482027 3300027907 Bacteria 902
329 Ga0268266_10008558 3300028379 Bacteria 9093
330 Ga0268266_10012412 3300028379 Bacteria 7364
331 Ga0268266_10117008 3300028379 Bacteria 2368
332 Ga0268266_11107076 3300028379 Bacteria 766
333 Ga0268266_11769260 3300028379 Bacteria 593
334 Ga0268265_10000007 3300028380 Bacteria 431817
335 Ga0268265_10015011 3300028380 Bacteria 5289
336 Ga0268265_10548247 3300028380 Bacteria 1097
337 Ga0268264_10000007 3300028381 Bacteria 815790
338 Ga0268264_10002948 3300028381 Bacteria 14783
339 Ga0268264_10343344 3300028381 Bacteria 1419
340 Ga0268264_10739523 3300028381 Bacteria 979
341 Ga0265338_10016608 3300028800 Bacteria 7988
342 Ga0265327_10000067 3300031251 Bacteria 221289
343 Ga0265327_10002114 3300031251 Bacteria 21995
344 Ga0307408_100644243 3300031548 Bacteria 947
345 Ga0310115_118784 3300031635 Eukaryota 707
346 Ga0307405_10281873 3300031731 Bacteria 1251
347 Ga0307405_10858463 3300031731 Bacteria 765
348 Ga0307413_10373924 3300031824 Bacteria 1108
349 Ga0307413_11137085 3300031824 Bacteria 676
350 Ga0307410_10441812 3300031852 Bacteria 1059
351 Ga0307410_10662569 3300031852 Bacteria 876
352 Ga0307410_10730438 3300031852 Bacteria 837
353 Ga0307406_10059052 3300031901 Bacteria 2467
354 Ga0307407_10723412 3300031903 Bacteria 752
355 Ga0307409_100108033 3300031995 Bacteria 2326
356 Ga0307416_100166433 3300032002 Bacteria 2046
357 Ga0307416_100436909 3300032002 Bacteria 1358
358 Ga0307411_10313993 3300032005 Bacteria 1263
359 Ga0307415_101035606 3300032126 Bacteria 765
360 Ga0307415_101541564 3300032126 Bacteria 637
361 Ga0373958_0176234 3300034819 Bacteria 548
362 Ga0373928_0017893 3300035084 Bacteria 1463
363 Ga0373932_0036264 3300035112 Bacteria 1399
364 Ga0373939_0018058 3300035114 Bacteria 1883
365 Ga0373939_0448774 3300035114 Bacteria 542
366 Ga0373960_0071686 3300035121 Bacteria 1073
367 Ga0373960_0273536 3300035121 Bacteria 620
368 Ga0373943_0145885 3300035170 Bacteria 1279
369 Ga0373962_0125981 3300035242 Bacteria 821
370 Ga0373931_0003176 3300035691 Bacteria 7330
371 Ga0373931_0655556 3300035691 Bacteria 690
372 Ga0310112_034929 3300036458 Eukaryota 686
373 Ga0373925_0513338 3300037068 Bacteria 984
374 Ga0436364_0300710 3300037853 Bacteria 9018
375 Ga0400483_130844 3300039062 Bacteria 10521
376 Ga0400483_220571 3300039062 Bacteria 6251
377 Ga0436365_0097318 3300039437 Bacteria 3308
378 Ga0436365_0195178 3300039437 Bacteria 4814
379 Ga0436365_0317297 3300039437 Unclassified 1721
380 Ga0436365_1815090 3300039437 Bacteria 543
381 Ga0436363_0088303 3300039450 Bacteria 1192
382 Ga0436363_0295070 3300039450 Bacteria 927
383 Ga0439438_066447 3300041405 Bacteria 897
384 Ga0439461_0000512 3300041410 Bacteria 5602
385 Ga0439466_0022363 3300041411 Bacteria 2232
386 Ga0439465_0004225 3300041413 Bacteria 4674
387 Ga0439465_0033122 3300041413 Bacteria 1651
388 Ga0451798_0754075 3300041458 Bacteria 612
389 Ga0451802_1430968 3300041460 Bacteria 537
390 Ga0451841_0022073 3300041498 Bacteria 530
391 Ga0451849_1009573 3300041505 Bacteria 588
392 Ga0451853_0882115 3300041512 Bacteria 788
393 Ga0439431_0002157 3300041997 Bacteria 4337
394 Ga0439445_0004532 3300042004 Bacteria 3146
395 Ga0439445_0019858 3300042004 Bacteria 1678
396 Ga0439448_0099712 3300042005 Bacteria 986
397 Ga0439434_0031209 3300042435 Bacteria 1619
398 Ga0439434_0093908 3300042435 Bacteria 961
399 Ga0439435_0014675 3300042436 Bacteria 1939
400 Ga0466969_0056265 3300044656 Bacteria 1921
401 Ga0466972_0058014 3300044658 Bacteria 1858
402 Ga0466972_0065010 3300044658 Bacteria 1745
403 Ga0466972_0072261 3300044658 Bacteria 1645
404 Ga0466972_0159229 3300044658 Bacteria 1061
405 Ga0466965_0005346 3300044683 Bacteria 5781
406 Ga0466965_0014816 3300044683 Bacteria 3694
407 Ga0466965_0154276 3300044683 Bacteria 1201
408 Ga0466966_0003729 3300044684 Bacteria 10045
409 Ga0466966_0035601 3300044684 Bacteria 3215
410 Ga0466961_0041880 3300044693 Bacteria 2936
411 Ga0466961_0043069 3300044693 Bacteria 2892
412 Ga0466963_0315024 3300044694 Bacteria 1101
413 Ga0466964_0038832 3300044706 Bacteria 1916
414 Ga0466964_0047912 3300044706 Bacteria 1746
415 Ga0466964_0114916 3300044706 Bacteria 1205
416 Ga0466964_0117010 3300044706 Bacteria 1196
417 Ga0466964_0154303 3300044706 Bacteria 1067
418 Ga0466971_0060674 3300044719 Bacteria 1709
419 Ga0466968_0002558 3300044735 Bacteria 6685
420 Ga0466968_0021652 3300044735 Bacteria 2605
421 Ga0466968_0042161 3300044735 Bacteria 1929
422 Ga0466970_0040956 3300044765 Bacteria 2460
423 Ga0466970_0316727 3300044765 Bacteria 881
424 Ga0466957_0052801 3300044842 Bacteria 2476
425 Ga0466957_0394954 3300044842 Bacteria 945
426 Ga0466957_0458135 3300044842 Bacteria 879
427 Ga0466960_0013978 3300044901 Bacteria 3422
428 Ga0466960_0186418 3300044901 Bacteria 1127
429 Ga0466959_0015717 3300045049 Bacteria 5520
430 Ga0466959_0173186 3300045049 Bacteria 1513
431 Ga0466959_0176842 3300045049 Bacteria 1494
432 Ga0466959_0276788 3300045049 Bacteria 1152
433 Ga0466959_0503004 3300045049 Bacteria 819
434 Ga0466959_0505425 3300045049 Bacteria 817
435 Ga0466958_0002707 3300045836 Bacteria 8987
436 Ga0466958_0034597 3300045836 Bacteria 3014
437 Ga0466958_0243734 3300045836 Bacteria 1149
438 Ga0466967_0016223 3300045976 Bacteria 5865
439 Ga0466967_0041392 3300045976 Bacteria 3972
440 Ga0466967_0130520 3300045976 Bacteria 2332
441 Ga0466967_0424393 3300045976 Bacteria 1296
442 Ga0466967_0503282 3300045976 Bacteria 1189
443 Ga0466967_0722678 3300045976 Bacteria 987
444 Ga0466967_0750555 3300045976 Bacteria 968
445 Ga0495603_0386226 3300046455 Bacteria 803
446 Ga0495638_0001938 3300046460 Bacteria 17747
447 Ga0495653_0257559 3300046463 Bacteria 1155
448 Ga0495582_0174199 3300046473 Bacteria 1225
449 Ga0495583_0399710 3300046506 Bacteria 540
450 Ga0495606_0041526 3300046507 Bacteria 3084
451 Ga0495648_0008552 3300046524 Bacteria 8039
452 Ga0495668_0280199 3300046616 Bacteria 913
453 Ga0495611_0016436 3300046648 Bacteria 3164
454 Ga0495658_0064082 3300046683 Bacteria 2116
455 Ga0495669_0174695 3300046684 Bacteria 1023
456 Ga0495613_0106149 3300046689 Bacteria 2027
457 Ga0495671_0030940 3300046692 Bacteria 2739
458 Ga0495671_0095952 3300046692 Bacteria 1451
459 Ga0495649_0196164 3300046694 Bacteria 1050
460 Ga0495672_0001606 3300047320 Bacteria 22047
461 Ga0495672_0119093 3300047320 Bacteria 1406
462 Ga0495676_0043059 3300047321 Bacteria 3699
463 Ga0495673_0000594 3300047469 Bacteria 36257
464 Ga0495686_0001875 3300047472 Bacteria 21023
465 Ga0495686_0011916 3300047472 Bacteria 6111
466 Ga0495602_0457393 3300048088 Bacteria 900
467 Ga0495614_0224227 3300048089 Bacteria 855
468 Ga0495626_0112549 3300048091 Bacteria 1177
469 Ga0496100_0000036 3300048903 Bacteria 97367
470 Ga0496100_0001522 3300048903 Bacteria 11363
471 Ga0496100_0020384 3300048903 Bacteria 3974
472 Ga0496100_0041961 3300048903 Bacteria 2919
473 Ga0496100_0086981 3300048903 Bacteria 2124
474 Ga0496100_0241091 3300048903 Bacteria 1334
475 Ga0496101_0000030 3300048904 Bacteria 198447
476 Ga0496101_0000199 3300048904 Bacteria 46269
477 Ga0496101_0004580 3300048904 Bacteria 8730
478 Ga0496101_0021050 3300048904 Bacteria 4476
479 Ga0496101_0026812 3300048904 Bacteria 4007
480 Ga0496101_0026989 3300048904 Bacteria 3994
481 Ga0496101_0030457 3300048904 Bacteria 3783
482 Ga0496101_0036723 3300048904 Bacteria 3471
483 Ga0496101_0511662 3300048904 Bacteria 949
484 Ga0496102_0000001 3300048905 Bacteria 873433
485 Ga0496102_0001472 3300048905 Bacteria 20778
486 Ga0496102_0038895 3300048905 Bacteria 4296
487 Ga0496102_0103350 3300048905 Bacteria 2650
488 Ga0496102_0169245 3300048905 Bacteria 2057
489 Ga0496102_0481410 3300048905 Bacteria 1162
490 Ga0496102_0532403 3300048905 Bacteria 1097
491 Ga0496102_0539966 3300048905 Bacteria 1088
492 Ga0496102_1051853 3300048905 Eukaryota 734
493 Ga0496102_1081086 3300048905 Bacteria 722
494 Ga0496103_0000003 3300048906 Bacteria 603967
495 Ga0496103_0000580 3300048906 Bacteria 28931
496 Ga0496103_0001100 3300048906 Bacteria 18821
497 Ga0496103_0016250 3300048906 Bacteria 4441
498 Ga0496103_0740951 3300048906 Bacteria 622
499 Ga0496104_0018924 3300048907 Bacteria 6291
500 Ga0496104_0247330 3300048907 Bacteria 1696
501 Ga0496104_0282956 3300048907 Bacteria 1571
502 Ga0496104_0378396 3300048907 Bacteria 1328
503 Ga0496104_0721869 3300048907 Bacteria 904
504 Ga0496105_0028392 3300048908 Bacteria 4575
505 Ga0496105_0155132 3300048908 Bacteria 1881
506 Ga0496105_0401930 3300048908 Bacteria 1087
507 Ga0496106_0001157 3300048909 Bacteria 19566
508 Ga0496106_0001305 3300048909 Bacteria 18713
509 Ga0496106_0006765 3300048909 Bacteria 8490
510 Ga0496106_0009111 3300048909 Bacteria 7333
511 Ga0496107_0000275 3300048910 Bacteria 27199
512 Ga0496107_0002558 3300048910 Bacteria 11861
513 Ga0496107_0023191 3300048910 Bacteria 4387
514 Ga0496107_0032325 3300048910 Bacteria 3740
515 Ga0496107_0098474 3300048910 Bacteria 2142
516 Ga0496107_0332512 3300048910 Bacteria 1130
517 Ga0496107_0400596 3300048910 Bacteria 1020
518 Ga0496108_0005232 3300048911 Bacteria 10477
519 Ga0496108_0314606 3300048911 Bacteria 1364
520 Ga0496109_0003821 3300048912 Bacteria 12579
521 Ga0496109_0017877 3300048912 Bacteria 6221
522 Ga0496109_0027294 3300048912 Bacteria 5096
523 Ga0496109_0185995 3300048912 Bacteria 1952
524 Ga0496110_0054768 3300048913 Bacteria 3508
525 Ga0496110_0058006 3300048913 Bacteria 3410
526 Ga0496110_0175113 3300048913 Bacteria 1947
527 Ga0496110_0773920 3300048913 Bacteria 864
528 Ga0496111_0010888 3300048914 Bacteria 6118
529 Ga0496111_0234146 3300048914 Bacteria 1364
530 Ga0496111_0254883 3300048914 Bacteria 1302
531 Ga0496112_0141177 3300048915 Bacteria 2378
532 Ga0496112_0390324 3300048915 Bacteria 1332
533 Ga0496112_0424318 3300048915 Bacteria 1268
534 Ga0496112_1184362 3300048915 Bacteria 681
535 Ga0496113_0037780 3300048916 Bacteria 3546
536 Ga0496113_0174709 3300048916 Bacteria 1702
537 Ga0496114_0000378 3300048917 Bacteria 32923
538 Ga0496114_0001156 3300048917 Bacteria 19911
539 Ga0496114_0002869 3300048917 Bacteria 13211
540 Ga0496114_0113985 3300048917 Bacteria 2318
541 Ga0496114_0134746 3300048917 Bacteria 2135
542 Ga0496114_0186168 3300048917 Bacteria 1815
543 Ga0496114_0435748 3300048917 Bacteria 1161
544 Ga0496114_0454818 3300048917 Bacteria 1134
545 Ga0496115_0001734 3300048918 Bacteria 15630
546 Ga0496115_0007366 3300048918 Bacteria 8097
547 Ga0496115_0008910 3300048918 Bacteria 7439
548 Ga0496115_0921488 3300048918 Bacteria 673
549 Ga0496115_0952684 3300048918 Bacteria 659
550 Ga0496116_0000013 3300048919 Bacteria 603993
551 Ga0496116_0012051 3300048919 Bacteria 7088
552 Ga0496116_0170555 3300048919 Eukaryota 1179
553 Ga0496117_0000013 3300048920 Bacteria 603995
554 Ga0496117_0004302 3300048920 Bacteria 15853
555 Ga0496117_0062384 3300048920 Bacteria 2554
556 Ga0496118_0000011 3300048921 Bacteria 603995
557 Ga0496118_0006569 3300048921 Bacteria 12709
558 Ga0496118_0241211 3300048921 Bacteria 1034
559 Ga0496119_0000076 3300048922 Bacteria 143663
560 Ga0496119_0011567 3300048922 Bacteria 7284
561 Ga0496119_0032628 3300048922 Bacteria 3467
562 Ga0496120_0000633 3300048923 Bacteria 52382
563 Ga0496120_0012711 3300048923 Bacteria 5710
564 Ga0496120_0214980 3300048923 Bacteria 922
565 Ga0496121_0000027 3300048924 Bacteria 444747
566 Ga0496121_0000236 3300048924 Bacteria 118932
567 Ga0496121_0030533 3300048924 Bacteria 4947
568 Ga0496121_0629442 3300048924 Eukaryota 657
569 Ga0496122_0000833 3300048925 Bacteria 58438
570 Ga0496122_0041508 3300048925 Bacteria 3636
571 Ga0496123_0010740 3300048926 Bacteria 8042
572 Ga0496123_0031757 3300048926 Bacteria 3835
573 Ga0496124_0000016 3300048927 Bacteria 444747
574 Ga0496124_0170138 3300048927 Bacteria 1688
575 Ga0496124_0732045 3300048927 Eukaryota 622
576 Ga0496125_0000008 3300048928 Bacteria 704677
577 Ga0496125_0072721 3300048928 Bacteria 2677
578 Ga0496125_0227589 3300048928 Bacteria 1196
579 Ga0496125_0236395 3300048928 Eukaryota 1164
580 Ga0496126_0000025 3300048929 Bacteria 444747
581 Ga0496126_0000120 3300048929 Bacteria 183747
582 Ga0496126_0016264 3300048929 Bacteria 7446
583 Ga0496126_1122487 3300048929 Eukaryota 583
584 Ga0496126_1157479 3300048929 Bacteria 571
585 Ga0501034_0966171 3300049571 Bacteria 737
586 Ga0501040_0999559 3300049576 Bacteria 606
587 Ga0501047_0276114 3300049581 Bacteria 1526
588 Ga0501070_0037305 3300049586 Bacteria 4058
589 Ga0501072_0658794 3300049588 Bacteria 824
590 Ga0501080_0414822 3300049742 Bacteria 1210
591 nmdc:mga03683_29833_c1 3300050489 Bacteria 2178
592 nmdc:mga03n38_15189_c1 3300050490 Bacteria 2968
593 nmdc:mga03n38_156618_c1 3300050490 Bacteria 1150
594 nmdc:mga03n38_257_c1 3300050490 Bacteria 12554
595 nmdc:mga03n38_3179_c1 3300050490 Bacteria 5234
596 nmdc:mga03n38_374308_c1 3300050490 Bacteria 779
597 nmdc:mga03n38_6275_c1 3300050490 Bacteria 4118
598 nmdc:mga03n38_68150_c1 3300050490 Bacteria 1640
599 nmdc:mga03n38_690061_c1 3300050490 Bacteria 588
600 nmdc:mga03n38_754830_c1 3300050490 Bacteria 564
601 nmdc:mga00v17_1014_c1 3300050491 Bacteria 15023
602 nmdc:mga00v17_114896_c1 3300050491 Bacteria 1710
603 nmdc:mga00v17_16989_c1 3300050491 Bacteria 4110
604 nmdc:mga00v17_240340_c1 3300050491 Bacteria 1174
605 nmdc:mga00v17_42030_c1 3300050491 Bacteria 2747
606 nmdc:mga00v17_44143_c1 3300050491 Bacteria 2687
607 nmdc:mga00v17_56692_c1 3300050491 Bacteria 2396
608 nmdc:mga0yw44_153542_c1 3300050492 Bacteria 1503
609 nmdc:mga0yw44_20499_c1 3300050492 Bacteria 3670
610 nmdc:mga0yw44_369480_c1 3300050492 Bacteria 967
611 nmdc:mga0yw44_425643_c1 3300050492 Bacteria 899
612 nmdc:mga0yw44_48696_c1 3300050492 Bacteria 2555
613 nmdc:mga0k408_330537_c1 3300050493 Bacteria 909
614 nmdc:mga06z11_106359_c1 3300050494 Bacteria 1547
615 nmdc:mga06z11_5070_c1 3300050494 Bacteria 5245
616 nmdc:mga04h51_23917_c1 3300050495 Bacteria 1865
617 nmdc:mga07m45_134630_c1 3300050496 Bacteria 1430
618 nmdc:mga07m45_20594_c1 3300050496 Bacteria 2455
619 nmdc:mga07m45_254647_c1 3300050496 Bacteria 1021
620 nmdc:mga07m45_260554_c1 3300050496 Bacteria 1009
621 nmdc:mga07m45_334640_c1 3300050496 Bacteria 880
622 nmdc:mga07m45_428756_c1 3300050496 Bacteria 767
623 nmdc:mga07m45_9206_c1 3300050496 Bacteria 5110
624 nmdc:mga0qj67_50966_c1 3300050509 Bacteria 3272
625 nmdc:mga06r32_622020_c1 3300050510 Bacteria 1050
626 nmdc:mga08y16_1471337_c1 3300050511 Bacteria 642
627 nmdc:mga0n895_2050_c1 3300050512 Bacteria 15502
628 nmdc:mga0rr50_1603_c1 3300050513 Bacteria 12461
629 nmdc:mga08x19_134325_c1 3300050514 Bacteria 1667
630 nmdc:mga0sz30_155384_c1 3300050516 Bacteria 1013
631 nmdc:mga0sz30_157680_c1 3300050516 Bacteria 1005
632 nmdc:mga0sz30_1971_c1 3300050516 Bacteria 7338
633 nmdc:mga0sz30_2151_c1 3300050516 Bacteria 7038
634 nmdc:mga0sz30_34617_c2 3300050516 Bacteria 1686
635 nmdc:mga0sz30_446976_c1 3300050516 Bacteria 580
636 nmdc:mga0sz30_6632_c1 3300050516 Bacteria 4311
637 Ga0500610_0033616 3300053079 Bacteria 2618
638 Ga0495655_0016143 3300053083 Bacteria 1603
639 Ga0495595_0520459 3300053084 Bacteria 607
640 Ga0500643_003164 3300053087 Bacteria 8048
641 Ga0500646_0163529 3300053090 Bacteria 744
642 Ga0500556_0008484 3300053104 Bacteria 2967
643 Ga0500556_0043087 3300053104 Bacteria 1600
644 Ga0500562_069299 3300053108 Bacteria 951
645 Ga0500652_000961 3300053131 Bacteria 9524
646 Ga0500577_0070853 3300053142 Bacteria 1367
647 Ga0500616_0044273 3300053153 Bacteria 2375
648 Ga0500627_0368769 3300053158 Bacteria 617
649 Ga0500633_0211170 3300053160 Bacteria 726
650 Ga0466962_0063903 3300061719 Bacteria 1757
651 Ga0466962_0433874 3300061719 Bacteria 660
652 2524186206 2524023129 Bacteria 6762600
653 2548698190 2547132424 Bacteria 8348532
654 2552106612 2551306166 Bacteria 9731570
655 2574430043 2574179768 Bacteria 4907129
656 2644638374 2643221715 Bacteria 6671032
657 2738666147 2738541264 Bacteria 5935393
658 2739145281 2738541356 Bacteria 5935017
659 2739363779 2738543034 Bacteria 6084756
660 2753035290 2751185725 Bacteria 5740550
661 2753323807 2751185792 Bacteria 5739090
662 2791922648 2791354903 Bacteria 4937680
663 2842137223 2842134933 Bacteria 5847019
664 2902796748 2902792274 Bacteria 7270173
665 2902812290 2902810491 Bacteria 6794147
666 2902837760 2902837492 Bacteria 6697721
667 2939588626 2939582691 Bacteria 7088898
668 2956941866 2956939328 Bacteria 3474458
669 3001119223 3001119090 Bacteria 3449530
670 Ga0213876_10142704
671 JGI24746J21847_1009446
672 JGI24737J22298_10090664
673 JGI24745J21846_1009630
674 JGI24744J21845_10000753
675 JGI24742J22300_10002239
676 Ga0055540_1000167
677 Ga0055540_1022205
678 Ga0055540_1024793
679 Ga0070658_10252233
680 Ga0070690_100649164
681 Ga0068869_100086508
682 Ga0070682_100033285
683 Ga0068868_100351735
684 Ga0068868_100877193
685 Ga0070691_10223585
686 Ga0070687_100093670
687 Ga0070668_100005599
688 Ga0070668_100067753
689 Ga0070668_100209749
690 Ga0070669_100119592
691 Ga0070669_100277553
692 Ga0070675_100590181
693 Ga0070671_100007371
694 Ga0070671_100332714
695 Ga0070671_100493562
696 Ga0070674_100234280
697 Ga0070673_101445121
698 Ga0070659_100138022
699 Ga0070659_100249479
700 Ga0070667_100001459
701 Ga0070667_100002497
702 Ga0070667_100236693
703 Ga0070667_100512074
704 Ga0070667_101021837
705 Ga0070709_10424957
706 Ga0070714_100233645
707 Ga0070714_101321333
708 Ga0070713_100332838
709 Ga0070710_10018865
710 Ga0070711_100151197
711 Ga0070705_100123734
712 Ga0070700_100171285
713 Ga0070700_100396740
714 Ga0070663_100022591
715 Ga0070678_101023041
716 Ga0070662_100379329
717 Ga0070662_100708234
718 Ga0068867_100164428
719 Ga0070685_10062992
720 Ga0070685_10092595
721 Ga0070679_101119438
722 Ga0070684_101033597
723 Ga0068853_100026809
724 Ga0070672_100176276
725 Ga0070672_100180783
726 Ga0070672_100877331
727 Ga0070686_100226382
728 Ga0070686_100246230
729 Ga0070695_100015543
730 Ga0070665_100006900
731 Ga0070665_100009212
732 Ga0070665_100018784
733 Ga0070665_100162683
734 Ga0070665_100663812
735 Ga0070665_101748449
736 Ga0068855_102551633
737 Ga0070664_100791794
738 Ga0068854_100001999
739 Ga0068854_100161231
740 Ga0070702_100479615
741 Ga0068852_100031842
742 Ga0068852_100094796
743 Ga0068859_100000438
744 Ga0068859_100036243
745 Ga0068859_100514556
746 Ga0068859_100894869
747 Ga0068859_101078902
748 Ga0068859_101492793
749 Ga0068864_100247085
750 Ga0068866_10000393
751 Ga0068866_10027918
752 Ga0068866_10818319
753 Ga0068866_10969865
754 Ga0068861_100001205
755 Ga0068861_100040542
756 Ga0068851_10022380
757 Ga0068863_100000983
758 Ga0068863_100035131
759 Ga0068863_100078490
760 Ga0068863_101548685
761 Ga0068858_100002189
762 Ga0068858_100062066
763 Ga0068858_100067484
764 Ga0068858_100739406
765 Ga0068860_100000010
766 Ga0068860_100011256
767 Ga0068860_100183172
768 Ga0068862_100000008
769 Ga0068862_100024355
770 Ga0068862_100217793
771 Ga0081455_10062486
772 Ga0081538_10090598
773 Ga0081538_10114299
774 Ga0075365_10043697
775 Ga0075365_10224494
776 Ga0075365_10353342
777 Ga0075363_100001672
778 Ga0075363_100004666
779 Ga0075363_100257640
780 Ga0075364_10018513
781 Ga0075364_10075429
782 Ga0075364_10128210
783 Ga0075364_10347462
784 Ga0070716_100003705
785 Ga0070716_100079402
786 Ga0070712_100003530
787 Ga0070712_100007739
788 Ga0075362_10009070
789 Ga0075367_10098665
790 Ga0075367_10214635
791 Ga0075369_10004111
792 Ga0075369_10020242
793 Ga0075369_10020319
794 Ga0075369_10049916
795 Ga0075369_10194679
796 Ga0075366_10358070
797 Ga0097621_100323433
798 Ga0075370_10068521
799 Ga0075370_10163484
800 Ga0075370_10168757
801 Ga0075370_10530460
802 Ga0068871_100225268
803 Ga0068871_100420213
804 Ga0075434_100002729
805 Ga0075434_101476081
806 Ga0068865_100001012
807 Ga0068865_100307738
808 Ga0068865_100704200
809 Ga0075436_100770991
810 Ga0075436_101071692
811 Ga0097620_100000438
812 Ga0097620_100036243
813 Ga0097620_100514542
814 Ga0097620_100894881
815 Ga0097620_101078785
816 Ga0097620_101492703
817 Ga0075435_100003169
818 Ga0105244_10150524
819 Ga0105240_10261301
820 Ga0111539_10100351
821 Ga0105245_10001613
822 Ga0105245_10134314
823 Ga0105245_10411505
824 Ga0105247_10000019
825 Ga0105247_10014820
826 Ga0105247_10033952
827 Ga0105247_10343942
828 Ga0114129_10198517
829 Ga0105243_10000890
830 Ga0105241_10009845
831 Ga0105242_10012392
832 Ga0105242_10105622
833 Ga0105242_10758701
834 Ga0105248_10000093
835 Ga0105248_10004508
836 Ga0105248_10161187
837 Ga0105248_11377237
838 Ga0105237_10003700
839 Ga0105237_10007819
840 Ga0105237_10066920
841 Ga0105237_12381051
842 Ga0105238_10172335
843 Ga0105238_11697071
844 Ga0105249_10000019
845 Ga0105249_10002099
846 Ga0105249_10189597
847 Ga0105239_10009784
848 Ga0105239_10027384
849 Ga0105239_10133157
850 Ga0105239_10284794
851 Ga0105246_11838223
852 Ga0157371_10541745
853 Ga0157369_10256235
854 Ga0157374_10334502
855 Ga0157374_10348997
856 Ga0157374_10439824
857 Ga0157374_10687881
858 Ga0157378_10001194
859 Ga0157378_10400805
860 Ga0157378_10414567
861 Ga0163162_10001044
862 Ga0163162_10107050
863 Ga0163162_10211401
864 Ga0163162_10416471
865 Ga0163162_10503537
866 Ga0157372_10003021
867 Ga0157372_10925059
868 Ga0157375_10015925
869 Ga0157375_10133007
870 Ga0157375_10384729
871 Ga0157375_11526571
872 Ga0163163_10183282
873 Ga0163163_12000683
874 Ga0163163_12127684
875 Ga0157380_10045758
876 Ga0157380_10235501
877 Ga0157380_11024235
878 Ga0157380_11434464
879 Ga0157377_10009698
880 Ga0157377_10052953
881 Ga0157379_10016977
882 Ga0157379_10109822
883 Ga0157379_10593300
884 Ga0157379_10715366
885 Ga0157379_10946904
886 Ga0157376_10053948
887 Ga0163161_10046214
888 Ga0163161_10480413
889 Ga0213876_10007506
890 Ga0213875_10052934
891 Ga0209673_1038469
892 Ga0209051_1000048
893 Ga0209051_1000576
894 Ga0207692_10001354
895 Ga0207642_10010575
896 Ga0207642_10600920
897 Ga0207710_10000036
898 Ga0207710_10041383
899 Ga0207710_10613610
900 Ga0207688_10006189
901 Ga0207688_10011172
902 Ga0207647_10029662
903 Ga0207647_10053541
904 Ga0207647_10116481
905 Ga0207645_10010111
906 Ga0207705_10245477
907 Ga0207671_10002168
908 Ga0207671_10044586
909 Ga0207693_10012671
910 Ga0207693_10019708
911 Ga0207663_10040535
912 Ga0207681_10002486
913 Ga0207681_10020446
914 Ga0207681_10609911
915 Ga0207694_10003944
916 Ga0207694_10485740
917 Ga0207650_10260040
918 Ga0207659_10503541
919 Ga0207659_10985243
920 Ga0207687_10002356
921 Ga0207687_10078313
922 Ga0207687_10096443
923 Ga0207700_10588613
924 Ga0207664_10382385
925 Ga0207644_10039495
926 Ga0207644_10194124
927 Ga0207644_10421726
928 Ga0207644_10967301
929 Ga0207644_11087311
930 Ga0207690_10293799
931 Ga0207690_11536468
932 Ga0207706_10002740
933 Ga0207706_10029697
934 Ga0207706_10971722
935 Ga0207686_10068946
936 Ga0207709_10019053
937 Ga0207709_10068693
938 Ga0207670_10003409
939 Ga0207669_10001808
940 Ga0207669_10406062
941 Ga0207704_10000524
942 Ga0207704_10147768
943 Ga0207704_10375295
944 Ga0207665_10001424
945 Ga0207665_10017514
946 Ga0207665_10054133
947 Ga0207691_10194931
948 Ga0207691_10683089
949 Ga0207711_10000102
950 Ga0207711_10170160
951 Ga0207689_10007884
952 Ga0207689_10074239
953 Ga0207661_11042980
954 Ga0207667_10625737
955 Ga0207712_10000025
956 Ga0207712_10009129
957 Ga0207668_10003382
958 Ga0207668_10007660
959 Ga0207668_10241226
960 Ga0207668_10448600
961 Ga0207668_11403660
962 Ga0207668_12155099
963 Ga0207640_10024039
964 Ga0207658_10000432
965 Ga0207658_10002055
966 Ga0207658_10013904
967 Ga0207658_10023098
968 Ga0207658_10072150
969 Ga0207658_10926946
970 Ga0207677_10001266
971 Ga0207677_10274978
972 Ga0207677_10352128
973 Ga0207677_10727517
974 Ga0207677_10863218
975 Ga0207703_10016378
976 Ga0207703_10114649
977 Ga0207703_10685373
978 Ga0207639_10025185
979 Ga0207639_10032291
980 Ga0207639_10253928
981 Ga0207678_10015591
982 Ga0207678_10027140
983 Ga0207678_11152067
984 Ga0207708_10006833
985 Ga0207708_10503625
986 Ga0207702_10377567
987 Ga0207641_10002536
988 Ga0207641_10609608
989 Ga0207648_10024169
990 Ga0207648_10032271
991 Ga0207675_100013710
992 Ga0207675_100045868
993 Ga0207675_100433255
994 Ga0207683_10000147
995 Ga0207698_10109711
996 Ga0209179_1096061
997 Ga0207428_10482027
998 Ga0268266_10008558
999 Ga0268266_10012412
1000 Ga0268266_10117008
1001 Ga0268266_11107076
1002 Ga0268266_11769260
1003 Ga0268265_10000007
1004 Ga0268265_10015011
1005 Ga0268265_10548247
1006 Ga0268264_10000007
1007 Ga0268264_10002948
1008 Ga0268264_10343344
1009 Ga0268264_10739523
1010 Ga0265338_10016608
1011 Ga0265327_10000067
1012 Ga0265327_10002114
1013 Ga0307408_100644243
1014 Ga0310115_118784
1015 Ga0307405_10281873
1016 Ga0307405_10858463
1017 Ga0307413_10373924
1018 Ga0307413_11137085
1019 Ga0307410_10441812
1020 Ga0307410_10662569
1021 Ga0307410_10730438
1022 Ga0307406_10059052
1023 Ga0307407_10723412
1024 Ga0307409_100108033
1025 Ga0307416_100166433
1026 Ga0307416_100436909
1027 Ga0307411_10313993
1028 Ga0307415_101035606
1029 Ga0307415_101541564
1030 Ga0373958_0176234
1031 Ga0373928_0017893
1032 Ga0373932_0036264
1033 Ga0373939_0018058
1034 Ga0373939_0448774
1035 Ga0373960_0071686
1036 Ga0373960_0273536
1037 Ga0373943_0145885
1038 Ga0373962_0125981
1039 Ga0373931_0003176
1040 Ga0373931_0655556
1041 Ga0310112_034929
1042 Ga0373925_0513338
1043 Ga0436364_0300710
1044 Ga0400483_130844
1045 Ga0400483_220571
1046 Ga0436365_0097318
1047 Ga0436365_0195178
1048 Ga0436365_0317297
1049 Ga0436365_1815090
1050 Ga0436363_0088303
1051 Ga0436363_0295070
1052 Ga0439438_066447
1053 Ga0439461_0000512
1054 Ga0439466_0022363
1055 Ga0439465_0004225
1056 Ga0439465_0033122
1057 Ga0451798_0754075
1058 Ga0451802_1430968
1059 Ga0451841_0022073
1060 Ga0451849_1009573
1061 Ga0451853_0882115
1062 Ga0439431_0002157
1063 Ga0439445_0004532
1064 Ga0439445_0019858
1065 Ga0439448_0099712
1066 Ga0439434_0031209
1067 Ga0439434_0093908
1068 Ga0439435_0014675
1069 Ga0466969_0056265
1070 Ga0466972_0058014
1071 Ga0466972_0065010
1072 Ga0466972_0072261
1073 Ga0466972_0159229
1074 Ga0466965_0005346
1075 Ga0466965_0014816
1076 Ga0466965_0154276
1077 Ga0466966_0003729
1078 Ga0466966_0035601
1079 Ga0466961_0041880
1080 Ga0466961_0043069
1081 Ga0466963_0315024
1082 Ga0466964_0038832
1083 Ga0466964_0047912
1084 Ga0466964_0114916
1085 Ga0466964_0117010
1086 Ga0466964_0154303
1087 Ga0466971_0060674
1088 Ga0466968_0002558
1089 Ga0466968_0021652
1090 Ga0466968_0042161
1091 Ga0466970_0040956
1092 Ga0466970_0316727
1093 Ga0466957_0052801
1094 Ga0466957_0394954
1095 Ga0466957_0458135
1096 Ga0466960_0013978
1097 Ga0466960_0186418
1098 Ga0466959_0015717
1099 Ga0466959_0173186
1100 Ga0466959_0176842
1101 Ga0466959_0276788
1102 Ga0466959_0503004
1103 Ga0466959_0505425
1104 Ga0466958_0002707
1105 Ga0466958_0034597
1106 Ga0466958_0243734
1107 Ga0466967_0016223
1108 Ga0466967_0041392
1109 Ga0466967_0130520
1110 Ga0466967_0424393
1111 Ga0466967_0503282
1112 Ga0466967_0722678
1113 Ga0466967_0750555
1114 Ga0495603_0386226
1115 Ga0495638_0001938
1116 Ga0495653_0257559
1117 Ga0495582_0174199
1118 Ga0495583_0399710
1119 Ga0495606_0041526
1120 Ga0495648_0008552
1121 Ga0495668_0280199
1122 Ga0495611_0016436
1123 Ga0495658_0064082
1124 Ga0495669_0174695
1125 Ga0495613_0106149
1126 Ga0495671_0030940
1127 Ga0495671_0095952
1128 Ga0495649_0196164
1129 Ga0495672_0001606
1130 Ga0495672_0119093
1131 Ga0495676_0043059
1132 Ga0495673_0000594
1133 Ga0495686_0001875
1134 Ga0495686_0011916
1135 Ga0495602_0457393
1136 Ga0495614_0224227
1137 Ga0495626_0112549
1138 Ga0496100_0000036
1139 Ga0496100_0001522
1140 Ga0496100_0020384
1141 Ga0496100_0041961
1142 Ga0496100_0086981
1143 Ga0496100_0241091
1144 Ga0496101_0000030
1145 Ga0496101_0000199
1146 Ga0496101_0004580
1147 Ga0496101_0021050
1148 Ga0496101_0026812
1149 Ga0496101_0026989
1150 Ga0496101_0030457
1151 Ga0496101_0036723
1152 Ga0496101_0511662
1153 Ga0496102_0000001
1154 Ga0496102_0001472
1155 Ga0496102_0038895
1156 Ga0496102_0103350
1157 Ga0496102_0169245
1158 Ga0496102_0481410
1159 Ga0496102_0532403
1160 Ga0496102_0539966
1161 Ga0496102_1051853
1162 Ga0496102_1081086
1163 Ga0496103_0000003
1164 Ga0496103_0000580
1165 Ga0496103_0001100
1166 Ga0496103_0016250
1167 Ga0496103_0740951
1168 Ga0496104_0018924
1169 Ga0496104_0247330
1170 Ga0496104_0282956
1171 Ga0496104_0378396
1172 Ga0496104_0721869
1173 Ga0496105_0028392
1174 Ga0496105_0155132
1175 Ga0496105_0401930
1176 Ga0496106_0001157
1177 Ga0496106_0001305
1178 Ga0496106_0006765
1179 Ga0496106_0009111
1180 Ga0496107_0000275
1181 Ga0496107_0002558
1182 Ga0496107_0023191
1183 Ga0496107_0032325
1184 Ga0496107_0098474
1185 Ga0496107_0332512
1186 Ga0496107_0400596
1187 Ga0496108_0005232
1188 Ga0496108_0314606
1189 Ga0496109_0003821
1190 Ga0496109_0017877
1191 Ga0496109_0027294
1192 Ga0496109_0185995
1193 Ga0496110_0054768
1194 Ga0496110_0058006
1195 Ga0496110_0175113
1196 Ga0496110_0773920
1197 Ga0496111_0010888
1198 Ga0496111_0234146
1199 Ga0496111_0254883
1200 Ga0496112_0141177
1201 Ga0496112_0390324
1202 Ga0496112_0424318
1203 Ga0496112_1184362
1204 Ga0496113_0037780
1205 Ga0496113_0174709
1206 Ga0496114_0000378
1207 Ga0496114_0001156
1208 Ga0496114_0002869
1209 Ga0496114_0113985
1210 Ga0496114_0134746
1211 Ga0496114_0186168
1212 Ga0496114_0435748
1213 Ga0496114_0454818
1214 Ga0496115_0001734
1215 Ga0496115_0007366
1216 Ga0496115_0008910
1217 Ga0496115_0921488
1218 Ga0496115_0952684
1219 Ga0496116_0000013
1220 Ga0496116_0012051
1221 Ga0496116_0170555
1222 Ga0496117_0000013
1223 Ga0496117_0004302
1224 Ga0496117_0062384
1225 Ga0496118_0000011
1226 Ga0496118_0006569
1227 Ga0496118_0241211
1228 Ga0496119_0000076
1229 Ga0496119_0011567
1230 Ga0496119_0032628
1231 Ga0496120_0000633
1232 Ga0496120_0012711
1233 Ga0496120_0214980
1234 Ga0496121_0000027
1235 Ga0496121_0000236
1236 Ga0496121_0030533
1237 Ga0496121_0629442
1238 Ga0496122_0000833
1239 Ga0496122_0041508
1240 Ga0496123_0010740
1241 Ga0496123_0031757
1242 Ga0496124_0000016
1243 Ga0496124_0170138
1244 Ga0496124_0732045
1245 Ga0496125_0000008
1246 Ga0496125_0072721
1247 Ga0496125_0227589
1248 Ga0496125_0236395
1249 Ga0496126_0000025
1250 Ga0496126_0000120
1251 Ga0496126_0016264
1252 Ga0496126_1122487
1253 Ga0496126_1157479
1254 Ga0501034_0966171
1255 Ga0501040_0999559
1256 Ga0501047_0276114
1257 Ga0501070_0037305
1258 Ga0501072_0658794
1259 Ga0501080_0414822
1260 nmdc:mga03683_29833_c1
1261 nmdc:mga03n38_15189_c1
1262 nmdc:mga03n38_156618_c1
1263 nmdc:mga03n38_257_c1
1264 nmdc:mga03n38_3179_c1
1265 nmdc:mga03n38_374308_c1
1266 nmdc:mga03n38_6275_c1
1267 nmdc:mga03n38_68150_c1
1268 nmdc:mga03n38_690061_c1
1269 nmdc:mga03n38_754830_c1
1270 nmdc:mga00v17_1014_c1
1271 nmdc:mga00v17_114896_c1
1272 nmdc:mga00v17_16989_c1
1273 nmdc:mga00v17_240340_c1
1274 nmdc:mga00v17_42030_c1
1275 nmdc:mga00v17_44143_c1
1276 nmdc:mga00v17_56692_c1
1277 nmdc:mga0yw44_153542_c1
1278 nmdc:mga0yw44_20499_c1
1279 nmdc:mga0yw44_369480_c1
1280 nmdc:mga0yw44_425643_c1
1281 nmdc:mga0yw44_48696_c1
1282 nmdc:mga0k408_330537_c1
1283 nmdc:mga06z11_106359_c1
1284 nmdc:mga06z11_5070_c1
1285 nmdc:mga04h51_23917_c1
1286 nmdc:mga07m45_134630_c1
1287 nmdc:mga07m45_20594_c1
1288 nmdc:mga07m45_254647_c1
1289 nmdc:mga07m45_260554_c1
1290 nmdc:mga07m45_334640_c1
1291 nmdc:mga07m45_428756_c1
1292 nmdc:mga07m45_9206_c1
1293 nmdc:mga0qj67_50966_c1
1294 nmdc:mga06r32_622020_c1
1295 nmdc:mga08y16_1471337_c1
1296 nmdc:mga0n895_2050_c1
1297 nmdc:mga0rr50_1603_c1
1298 nmdc:mga08x19_134325_c1
1299 nmdc:mga0sz30_155384_c1
1300 nmdc:mga0sz30_157680_c1
1301 nmdc:mga0sz30_1971_c1
1302 nmdc:mga0sz30_2151_c1
1303 nmdc:mga0sz30_34617_c2
1304 nmdc:mga0sz30_446976_c1
1305 nmdc:mga0sz30_6632_c1
1306 Ga0500610_0033616
1307 Ga0495655_0016143
1308 Ga0495595_0520459
1309 Ga0500643_003164
1310 Ga0500646_0163529
1311 Ga0500556_0008484
1312 Ga0500556_0043087
1313 Ga0500562_069299
1314 Ga0500652_000961
1315 Ga0500577_0070853
1316 Ga0500616_0044273
1317 Ga0500627_0368769
1318 Ga0500633_0211170
1319 Ga0466962_0063903
1320 Ga0466962_0433874
1321 2524186206
1322 2548698190
1323 2552106612
1324 2574430043
1325 2644638374
1326 2738666147
1327 2739145281
1328 2739363779
1329 2753035290
1330 2753323807
1331 2791922648
1332 2842137223
1333 2902796748
1334 2902812290
1335 2902837760
1336 2939588626
1337 2956941866
1338 3001119223

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00334

NDK

Nucleoside diphosphate kinase

14

148

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
1k44-assembly1.cif.gz_A mycobacterium tuberculosis nucleoside diphosphate kinase 0.9627 2 136
5c7p-assembly1.cif.gz_C-2 structure of leishmania nucleoside diphostate kinase mutant p95s 0.9621 2 135
5c7p-assembly1.cif.gz_A-2 structure of leishmania nucleoside diphostate kinase mutant p95s 0.9604 1 135
6qa2-assembly1.cif.gz_C r80a mutant of nucleoside diphosphate kinase from mycobacterium tuberculosis 0.9594 2 136
1w7w-assembly1.cif.gz_A structure and mutational analysis of a plant mitochondrial nucleoside diphosphate kinase: identification of residues involved in serine phosphorylation and oligomerization. 0.9591 2 133
ID Description Score Start End Superfamily
af_A0A0G2L2L7_25_106_3.30.70.141 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Nucleoside diphosphate kinase-like domain 0.9905 2 78 3.30.70.141
1k44A00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Nucleoside diphosphate kinase-like domain 0.9627 2 136 3.30.70.141
af_C6T4F9_81_235_3.30.70.141 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Nucleoside diphosphate kinase-like domain 0.9583 2 135 3.30.70.141
1k44A00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Nucleoside diphosphate kinase-like domain 0.9558 2 136 3.30.70.141
6ay1G00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Nucleoside diphosphate kinase-like domain 0.9555 3 135 3.30.70.141
ID Description Score Start End GO Terms
AF-A0A3Q7PG60-F1-model_v4 nucleoside-diphosphate kinase (EC 2.7.4.6) 0.9706 1 107 GO:0004550
GO:0005741
GO:0005856
GO:0006183
GO:0006228
GO:0006241
GO:0042995
AF-A0A2Y9HWM5-F1-model_v4 nucleoside-diphosphate kinase (EC 2.7.4.6) 0.9702 1 106 GO:0004550
GO:0005741
GO:0005856
GO:0006183
GO:0006228
GO:0006241
GO:0042995
AF-A0A5S5AG37-F1-model_v4 Nucleoside diphosphate kinase (NDK) (NDP kinase) (EC 2.7.4.6) (Nucleoside-2-P kinase) 0.9698 3 136 GO:0004550
GO:0005524
GO:0005737
GO:0006183
GO:0006228
GO:0006241
GO:0046872
AF-A0A7Z7NBS2-F1-model_v4 Nucleoside diphosphate kinase (NDK) (NDP kinase) (EC 2.7.4.6) (Nucleoside-2-P kinase) 0.9693 2 136 GO:0004550
GO:0005524
GO:0005737
GO:0006183
GO:0006228
GO:0006241
GO:0046872
AF-A0A4R8IRV9-F1-model_v4 deleted 0.9688 2 136

Map