F473900
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 668 | 297 | 1336 | 158 |
Family's Representative Sequence
| Representative Sequence | 3300005439|Ga0070711_100182265|Ga0070711_1001822651 |
| Length | 194 |
| Sequence | MRGIRFFVTMALLGSVPLTAAYAAAKGGHSNMEKTTTVEKATFAAGCFWGVEAAFRQVPGVVSTQVGYTGGRTVNPSYEDVCTDRTGHAEAVEVTYDPSRVRYEDLLEVFWKNHDPTTSNRQGPDVGEQYRSAIFFHSPAQETAAKASKARLLAEHRYRRPIVTEIVAAGPFYRAEEYHQQYLEKRGLSVCHIK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 2 | 2162886012 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 | Metagenome | Rhizosphere |
| 3 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 4 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 5 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 6 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 9 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 11 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 13 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 15 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 16 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 18 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 36 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 37 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 43 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 46 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 48 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 53 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 55 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 56 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 57 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 59 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 60 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 61 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 62 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 63 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 64 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 65 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 66 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 67 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 69 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 70 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 72 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 73 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 74 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 75 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 76 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009828 | Sorghum rhizosphere soil microbial communities in Albany, CA(condition:control)- sample E | Metatranscriptome | Rhizosphere |
| 89 | 3300009835 | Sorghum rhizosphere soil microbial communities under drought stress in Albany, CA - sample B | Metatranscriptome | Rhizosphere |
| 90 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 104 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 107 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 108 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 109 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 110 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 111 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 112 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 113 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 114 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 115 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 170 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 171 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 172 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 173 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 174 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 175 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 176 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 177 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 178 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 179 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 180 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 181 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 182 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 183 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 184 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 185 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 186 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 187 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 188 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 189 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 190 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 191 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 192 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 193 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 194 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 195 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 196 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 197 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 198 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 199 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 200 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 201 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 202 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 203 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 204 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 205 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 206 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 207 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 208 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 209 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 210 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 211 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 212 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 213 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 214 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 250 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 251 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 252 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 253 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 254 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 255 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 256 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 257 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 258 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 259 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 260 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 261 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 262 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 263 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 264 | 3300049651 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought | Metagenome | Rhizosphere |
| 265 | 3300049660 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control | Metagenome | Rhizosphere |
| 266 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 267 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 268 | 3300049673 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought | Metagenome | Rhizosphere |
| 269 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 270 | 3300049680 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought | Metagenome | Rhizosphere |
| 271 | 3300049685 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_B_3_control | Metagenome | Rhizosphere |
| 272 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 273 | 3300049687 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought | Metagenome | Rhizosphere |
| 274 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 275 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 276 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 277 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 278 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 279 | 3300049759 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought | Metagenome | Rhizosphere |
| 280 | 3300049760 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control | Metagenome | Rhizosphere |
| 281 | 3300049763 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control | Metagenome | Rhizosphere |
| 282 | 3300049764 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control | Metagenome | Rhizosphere |
| 283 | 3300049768 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought | Metagenome | Rhizosphere |
| 284 | 3300049773 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_B_4_control | Metagenome | Rhizosphere |
| 285 | 3300049778 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control | Metagenome | Rhizosphere |
| 286 | 3300049851 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought | Metagenome | Rhizosphere |
| 287 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 288 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 289 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 290 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 291 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 292 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 293 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300060344 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.56 |
| Metatranscriptomes | 3.44 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 3.14 |
| Rhizosphere | 95.96 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 14.52 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070711_100182265 | 3300005439 | Bacteria | 1608 |
| 2 | MBSR1b_contig_12244917 | 2162886012 | Bacteria | 1191 |
| 3 | Ga0058863_10079809 | 3300004799 | Bacteria | 1174 |
| 4 | Ga0058863_11344591 | 3300004799 | Unclassified | 639 |
| 5 | Ga0058862_12874744 | 3300004803 | Bacteria | 1266 |
| 6 | Ga0065715_10090051 | 3300005293 | Bacteria | 7803 |
| 7 | Ga0070676_10308146 | 3300005328 | Bacteria | 1076 |
| 8 | Ga0070683_100006580 | 3300005329 | Bacteria | 9758 |
| 9 | Ga0070683_100016852 | 3300005329 | Bacteria | 6446 |
| 10 | Ga0070683_100055751 | 3300005329 | Bacteria | 3668 |
| 11 | Ga0070683_100590040 | 3300005329 | Bacteria | 1063 |
| 12 | Ga0070683_100625922 | 3300005329 | Bacteria | 1030 |
| 13 | Ga0070690_100014274 | 3300005330 | Unclassified | 4711 |
| 14 | Ga0070690_100346333 | 3300005330 | Unclassified | 1077 |
| 15 | Ga0070690_100862054 | 3300005330 | Unclassified | 706 |
| 16 | Ga0070666_10169736 | 3300005335 | Bacteria | 1527 |
| 17 | Ga0070680_100008281 | 3300005336 | Bacteria | 7955 |
| 18 | Ga0070680_100190523 | 3300005336 | Bacteria | 1728 |
| 19 | Ga0070682_100018518 | 3300005337 | Unclassified | 4073 |
| 20 | Ga0070682_100425124 | 3300005337 | Bacteria | 1011 |
| 21 | Ga0070682_101215549 | 3300005337 | Bacteria | 637 |
| 22 | Ga0068868_100004658 | 3300005338 | Bacteria | 9626 |
| 23 | Ga0068868_100310710 | 3300005338 | Bacteria | 1341 |
| 24 | Ga0070660_100082716 | 3300005339 | Unclassified | 2521 |
| 25 | Ga0070660_100098519 | 3300005339 | Bacteria | 2314 |
| 26 | Ga0070689_100381588 | 3300005340 | Unclassified | 1188 |
| 27 | Ga0070691_10062436 | 3300005341 | Bacteria | 1794 |
| 28 | Ga0070691_10106478 | 3300005341 | Unclassified | 1398 |
| 29 | Ga0070687_100229211 | 3300005343 | Bacteria | 1142 |
| 30 | Ga0070692_10405223 | 3300005345 | Bacteria | 862 |
| 31 | Ga0070668_100006783 | 3300005347 | Bacteria | 8489 |
| 32 | Ga0070669_100246303 | 3300005353 | Bacteria | 1421 |
| 33 | Ga0070675_100833542 | 3300005354 | Unclassified | 844 |
| 34 | Ga0070671_100164282 | 3300005355 | Bacteria | 1877 |
| 35 | Ga0070671_100402313 | 3300005355 | Bacteria | 1171 |
| 36 | Ga0070673_101013647 | 3300005364 | Bacteria | 773 |
| 37 | Ga0070659_100021534 | 3300005366 | Bacteria | 4911 |
| 38 | Ga0070667_100570175 | 3300005367 | Bacteria | 1041 |
| 39 | Ga0070709_10011718 | 3300005434 | Bacteria | 4896 |
| 40 | Ga0070709_10015775 | 3300005434 | Bacteria | 4302 |
| 41 | Ga0070709_10058098 | 3300005434 | Bacteria | 2453 |
| 42 | Ga0070709_10209076 | 3300005434 | Bacteria | 1386 |
| 43 | Ga0070709_10320740 | 3300005434 | Unclassified | 1137 |
| 44 | Ga0070714_100000184 | 3300005435 | Bacteria | 49943 |
| 45 | Ga0070714_100000196 | 3300005435 | Bacteria | 49140 |
| 46 | Ga0070714_100016070 | 3300005435 | Bacteria | 6033 |
| 47 | Ga0070714_100075795 | 3300005435 | Bacteria | 2919 |
| 48 | Ga0070714_100123216 | 3300005435 | Bacteria | 2308 |
| 49 | Ga0070714_100142042 | 3300005435 | Bacteria | 2156 |
| 50 | Ga0070714_100362206 | 3300005435 | Bacteria | 1363 |
| 51 | Ga0070714_100838515 | 3300005435 | Bacteria | 891 |
| 52 | Ga0070714_101699056 | 3300005435 | Bacteria | 616 |
| 53 | Ga0070713_100003045 | 3300005436 | Bacteria | 11014 |
| 54 | Ga0070713_100045442 | 3300005436 | Bacteria | 3599 |
| 55 | Ga0070713_100091042 | 3300005436 | Bacteria | 2623 |
| 56 | Ga0070710_10155005 | 3300005437 | Bacteria | 1416 |
| 57 | Ga0070710_10409619 | 3300005437 | Bacteria | 911 |
| 58 | Ga0070711_100012188 | 3300005439 | Bacteria | 5367 |
| 59 | Ga0070711_100118278 | 3300005439 | Unclassified | 1956 |
| 60 | Ga0070711_100129309 | 3300005439 | Bacteria | 1879 |
| 61 | Ga0070711_100282738 | 3300005439 | Bacteria | 1313 |
| 62 | Ga0070711_100576500 | 3300005439 | Unclassified | 936 |
| 63 | Ga0070700_100228833 | 3300005441 | Bacteria | 1322 |
| 64 | Ga0070694_100092035 | 3300005444 | Unclassified | 2130 |
| 65 | Ga0070708_100176848 | 3300005445 | Bacteria | 1994 |
| 66 | Ga0070663_100044941 | 3300005455 | Bacteria | 3117 |
| 67 | Ga0070678_100049803 | 3300005456 | Bacteria | 3025 |
| 68 | Ga0070678_100629511 | 3300005456 | Bacteria | 960 |
| 69 | Ga0070662_100003945 | 3300005457 | Bacteria | 9304 |
| 70 | Ga0070662_100202697 | 3300005457 | Bacteria | 1575 |
| 71 | Ga0070681_10003147 | 3300005458 | Bacteria | 15338 |
| 72 | Ga0070681_10043935 | 3300005458 | Bacteria | 4472 |
| 73 | Ga0070681_10200257 | 3300005458 | Bacteria | 1915 |
| 74 | Ga0070681_10272572 | 3300005458 | Bacteria | 1604 |
| 75 | Ga0070681_10700197 | 3300005458 | Bacteria | 929 |
| 76 | Ga0068867_100006051 | 3300005459 | Bacteria | 8575 |
| 77 | Ga0070685_10289759 | 3300005466 | Bacteria | 1099 |
| 78 | Ga0070706_100087895 | 3300005467 | Bacteria | 2881 |
| 79 | Ga0070706_100110071 | 3300005467 | Bacteria | 2563 |
| 80 | Ga0070707_100276001 | 3300005468 | Unclassified | 1634 |
| 81 | Ga0070698_100033125 | 3300005471 | Bacteria | 5352 |
| 82 | Ga0070698_100267250 | 3300005471 | Unclassified | 1642 |
| 83 | Ga0070699_100047687 | 3300005518 | Bacteria | 3707 |
| 84 | Ga0070679_100003335 | 3300005530 | Bacteria | 14706 |
| 85 | Ga0070679_100118409 | 3300005530 | Bacteria | 2633 |
| 86 | Ga0070679_101185062 | 3300005530 | Bacteria | 709 |
| 87 | Ga0070684_100000798 | 3300005535 | Bacteria | 21897 |
| 88 | Ga0070684_100010899 | 3300005535 | Bacteria | 7223 |
| 89 | Ga0070684_100307006 | 3300005535 | Bacteria | 1457 |
| 90 | Ga0070684_100484433 | 3300005535 | Bacteria | 1145 |
| 91 | Ga0070684_101567130 | 3300005535 | Bacteria | 621 |
| 92 | Ga0070697_100675251 | 3300005536 | Bacteria | 911 |
| 93 | Ga0068853_100031102 | 3300005539 | Bacteria | 4514 |
| 94 | Ga0068853_100038680 | 3300005539 | Bacteria | 4064 |
| 95 | Ga0068853_100345919 | 3300005539 | Bacteria | 1382 |
| 96 | Ga0068853_101539394 | 3300005539 | Bacteria | 644 |
| 97 | Ga0070672_100266701 | 3300005543 | Unclassified | 1445 |
| 98 | Ga0070686_100477186 | 3300005544 | Bacteria | 964 |
| 99 | Ga0070695_100108634 | 3300005545 | Bacteria | 1879 |
| 100 | Ga0070693_100009689 | 3300005547 | Unclassified | 4797 |
| 101 | Ga0070693_100027791 | 3300005547 | Unclassified | 3070 |
| 102 | Ga0070693_100198742 | 3300005547 | Unclassified | 1301 |
| 103 | Ga0070665_100068158 | 3300005548 | Bacteria | 3567 |
| 104 | Ga0070665_100193688 | 3300005548 | Bacteria | 2033 |
| 105 | Ga0070704_100982641 | 3300005549 | Bacteria | 763 |
| 106 | Ga0068855_100031252 | 3300005563 | Bacteria | 6359 |
| 107 | Ga0068855_100060060 | 3300005563 | Bacteria | 4447 |
| 108 | Ga0068855_100343135 | 3300005563 | Unclassified | 1646 |
| 109 | Ga0068855_100469239 | 3300005563 | Bacteria | 1371 |
| 110 | Ga0068855_101205210 | 3300005563 | Bacteria | 787 |
| 111 | Ga0070664_100075220 | 3300005564 | Bacteria | 2900 |
| 112 | Ga0070664_100495163 | 3300005564 | Bacteria | 1126 |
| 113 | Ga0068857_100002143 | 3300005577 | Bacteria | 16043 |
| 114 | Ga0068857_100178865 | 3300005577 | Bacteria | 1930 |
| 115 | Ga0068854_100004973 | 3300005578 | Bacteria | 8382 |
| 116 | Ga0068854_100279681 | 3300005578 | Unclassified | 1343 |
| 117 | Ga0068854_100302127 | 3300005578 | Bacteria | 1295 |
| 118 | Ga0068854_100326053 | 3300005578 | Bacteria | 1250 |
| 119 | Ga0068856_100002863 | 3300005614 | Bacteria | 17656 |
| 120 | Ga0068856_100038078 | 3300005614 | Bacteria | 4720 |
| 121 | Ga0068856_100041408 | 3300005614 | Bacteria | 4527 |
| 122 | Ga0068856_100050993 | 3300005614 | Bacteria | 4080 |
| 123 | Ga0068856_100233046 | 3300005614 | Bacteria | 1856 |
| 124 | Ga0068856_101189053 | 3300005614 | Bacteria | 779 |
| 125 | Ga0070702_100105495 | 3300005615 | Bacteria | 1737 |
| 126 | Ga0068852_100023647 | 3300005616 | Bacteria | 4950 |
| 127 | Ga0068852_100281187 | 3300005616 | Bacteria | 1604 |
| 128 | Ga0068852_100365828 | 3300005616 | Bacteria | 1412 |
| 129 | Ga0068859_100026026 | 3300005617 | Bacteria | 5870 |
| 130 | Ga0068864_101002984 | 3300005618 | Bacteria | 828 |
| 131 | Ga0068866_10045875 | 3300005718 | Unclassified | 2195 |
| 132 | Ga0068861_100120365 | 3300005719 | Bacteria | 2117 |
| 133 | Ga0068861_100582870 | 3300005719 | Bacteria | 1024 |
| 134 | Ga0068851_10002143 | 3300005834 | Bacteria | 8672 |
| 135 | Ga0068863_100027810 | 3300005841 | Bacteria | 5398 |
| 136 | Ga0068863_100052645 | 3300005841 | Bacteria | 3858 |
| 137 | Ga0068863_100392632 | 3300005841 | Bacteria | 1356 |
| 138 | Ga0068863_100396478 | 3300005841 | Bacteria | 1349 |
| 139 | Ga0068858_100007268 | 3300005842 | Bacteria | 10731 |
| 140 | Ga0068858_100026156 | 3300005842 | Bacteria | 5426 |
| 141 | Ga0068858_100074306 | 3300005842 | Bacteria | 3156 |
| 142 | Ga0068858_100582282 | 3300005842 | Bacteria | 1085 |
| 143 | Ga0068860_100041978 | 3300005843 | Bacteria | 4370 |
| 144 | Ga0070717_10002948 | 3300006028 | Bacteria | 12089 |
| 145 | Ga0070717_10012548 | 3300006028 | Bacteria | 6464 |
| 146 | Ga0070717_10414818 | 3300006028 | Bacteria | 1211 |
| 147 | Ga0070717_11088842 | 3300006028 | Bacteria | 728 |
| 148 | Ga0070716_100172567 | 3300006173 | Bacteria | 1412 |
| 149 | Ga0070716_100885264 | 3300006173 | Bacteria | 698 |
| 150 | Ga0070712_100002660 | 3300006175 | Bacteria | 11028 |
| 151 | Ga0070712_100017398 | 3300006175 | Bacteria | 4654 |
| 152 | Ga0070712_100123681 | 3300006175 | Bacteria | 1951 |
| 153 | Ga0070712_100835124 | 3300006175 | Unclassified | 792 |
| 154 | Ga0097621_100024420 | 3300006237 | Bacteria | 4720 |
| 155 | Ga0097621_100090938 | 3300006237 | Unclassified | 2554 |
| 156 | Ga0097621_100123059 | 3300006237 | Unclassified | 2202 |
| 157 | Ga0097621_100136248 | 3300006237 | Bacteria | 2094 |
| 158 | Ga0097621_100368114 | 3300006237 | Bacteria | 1282 |
| 159 | Ga0097621_100532194 | 3300006237 | Bacteria | 1068 |
| 160 | Ga0097621_101123578 | 3300006237 | Bacteria | 738 |
| 161 | Ga0068871_100024059 | 3300006358 | Bacteria | 4720 |
| 162 | Ga0068871_100127221 | 3300006358 | Unclassified | 2157 |
| 163 | Ga0068871_100158737 | 3300006358 | Bacteria | 1933 |
| 164 | Ga0075428_100002239 | 3300006844 | Bacteria | 20945 |
| 165 | Ga0075434_100066217 | 3300006871 | Bacteria | 3598 |
| 166 | Ga0075434_100352386 | 3300006871 | Bacteria | 1493 |
| 167 | Ga0068865_100019749 | 3300006881 | Bacteria | 4363 |
| 168 | Ga0068865_100196753 | 3300006881 | Bacteria | 1562 |
| 169 | Ga0075436_100039778 | 3300006914 | Bacteria | 3245 |
| 170 | Ga0097620_100026025 | 3300006931 | Bacteria | 5870 |
| 171 | Ga0105240_10007493 | 3300009093 | Bacteria | 15833 |
| 172 | Ga0105240_10008448 | 3300009093 | Bacteria | 14727 |
| 173 | Ga0105240_10021905 | 3300009093 | Bacteria | 8488 |
| 174 | Ga0105240_10027460 | 3300009093 | Bacteria | 7449 |
| 175 | Ga0105240_10137857 | 3300009093 | Bacteria | 2920 |
| 176 | Ga0105240_10275185 | 3300009093 | Bacteria | 1937 |
| 177 | Ga0111539_10009018 | 3300009094 | Bacteria | 12623 |
| 178 | Ga0111539_10426536 | 3300009094 | Bacteria | 1544 |
| 179 | Ga0105245_10002187 | 3300009098 | Bacteria | 17718 |
| 180 | Ga0105245_10196210 | 3300009098 | Bacteria | 1936 |
| 181 | Ga0105245_10454897 | 3300009098 | Bacteria | 1289 |
| 182 | Ga0105245_11492686 | 3300009098 | Bacteria | 727 |
| 183 | Ga0105245_11705137 | 3300009098 | Bacteria | 682 |
| 184 | Ga0114129_10521962 | 3300009147 | Bacteria | 1548 |
| 185 | Ga0114129_10588851 | 3300009147 | Bacteria | 1442 |
| 186 | Ga0114129_11319680 | 3300009147 | Bacteria | 893 |
| 187 | Ga0105243_10177988 | 3300009148 | Unclassified | 1847 |
| 188 | Ga0105243_10261445 | 3300009148 | Bacteria | 1550 |
| 189 | Ga0105243_10674112 | 3300009148 | Bacteria | 1005 |
| 190 | Ga0105241_10000042 | 3300009174 | Bacteria | 105578 |
| 191 | Ga0105241_10007601 | 3300009174 | Bacteria | 7967 |
| 192 | Ga0105241_10018304 | 3300009174 | Bacteria | 5153 |
| 193 | Ga0105241_10565380 | 3300009174 | Unclassified | 1023 |
| 194 | Ga0105241_10788661 | 3300009174 | Bacteria | 874 |
| 195 | Ga0105241_10852408 | 3300009174 | Bacteria | 843 |
| 196 | Ga0105242_10080574 | 3300009176 | Bacteria | 2721 |
| 197 | Ga0105242_10223824 | 3300009176 | Unclassified | 1683 |
| 198 | Ga0105242_11121595 | 3300009176 | Bacteria | 802 |
| 199 | Ga0105242_11523225 | 3300009176 | Bacteria | 700 |
| 200 | Ga0105248_10006910 | 3300009177 | Bacteria | 12438 |
| 201 | Ga0105248_10137747 | 3300009177 | Bacteria | 2753 |
| 202 | Ga0105248_10166422 | 3300009177 | Bacteria | 2485 |
| 203 | Ga0105248_11012547 | 3300009177 | Unclassified | 938 |
| 204 | Ga0105248_12219432 | 3300009177 | Bacteria | 625 |
| 205 | Ga0105237_10009023 | 3300009545 | Bacteria | 10718 |
| 206 | Ga0105237_10177373 | 3300009545 | Unclassified | 2131 |
| 207 | Ga0105237_10589571 | 3300009545 | Bacteria | 1118 |
| 208 | Ga0105238_10003611 | 3300009551 | Bacteria | 15420 |
| 209 | Ga0105238_10006656 | 3300009551 | Bacteria | 11523 |
| 210 | Ga0105238_10008251 | 3300009551 | Bacteria | 10421 |
| 211 | Ga0105238_10033507 | 3300009551 | Bacteria | 5228 |
| 212 | Ga0105249_10012493 | 3300009553 | Bacteria | 7485 |
| 213 | Ga0105249_10020749 | 3300009553 | Bacteria | 5875 |
| 214 | Ga0105249_10465854 | 3300009553 | Bacteria | 1304 |
| 215 | Ga0105249_10882082 | 3300009553 | Unclassified | 961 |
| 216 | Ga0130087_1005805 | 3300009828 | Bacteria | 573 |
| 217 | Ga0130084_1094136 | 3300009835 | Bacteria | 573 |
| 218 | Ga0105239_10002634 | 3300010375 | Bacteria | 22663 |
| 219 | Ga0105239_10016729 | 3300010375 | Bacteria | 8106 |
| 220 | Ga0105239_10022516 | 3300010375 | Bacteria | 6947 |
| 221 | Ga0105239_10177598 | 3300010375 | Bacteria | 2382 |
| 222 | Ga0105239_10289779 | 3300010375 | Bacteria | 1844 |
| 223 | Ga0105239_10644575 | 3300010375 | Bacteria | 1210 |
| 224 | Ga0105239_10912140 | 3300010375 | Unclassified | 1008 |
| 225 | Ga0105239_11644014 | 3300010375 | Bacteria | 743 |
| 226 | Ga0105246_10006116 | 3300011119 | Bacteria | 7343 |
| 227 | Ga0105246_10014891 | 3300011119 | Bacteria | 4901 |
| 228 | Ga0105246_10046647 | 3300011119 | Bacteria | 2956 |
| 229 | Ga0105246_10102589 | 3300011119 | Unclassified | 2086 |
| 230 | Ga0157373_10078640 | 3300013100 | Bacteria | 2326 |
| 231 | Ga0157373_10082569 | 3300013100 | Bacteria | 2265 |
| 232 | Ga0157371_10041384 | 3300013102 | Bacteria | 3288 |
| 233 | Ga0157371_10081697 | 3300013102 | Bacteria | 2288 |
| 234 | Ga0157371_10082758 | 3300013102 | Unclassified | 2272 |
| 235 | Ga0157370_10004896 | 3300013104 | Bacteria | 15181 |
| 236 | Ga0157369_10003154 | 3300013105 | Bacteria | 19680 |
| 237 | Ga0157369_10012761 | 3300013105 | Bacteria | 9527 |
| 238 | Ga0157369_10189165 | 3300013105 | Bacteria | 2163 |
| 239 | Ga0157369_10360683 | 3300013105 | Bacteria | 1509 |
| 240 | Ga0157374_10000592 | 3300013296 | Bacteria | 32031 |
| 241 | Ga0157374_10004591 | 3300013296 | Bacteria | 11579 |
| 242 | Ga0157374_10144196 | 3300013296 | Bacteria | 2313 |
| 243 | Ga0157374_10184399 | 3300013296 | Bacteria | 2040 |
| 244 | Ga0157374_10230980 | 3300013296 | Unclassified | 1817 |
| 245 | Ga0157378_10000401 | 3300013297 | Bacteria | 42628 |
| 246 | Ga0157378_10163449 | 3300013297 | Unclassified | 2083 |
| 247 | Ga0157378_10333535 | 3300013297 | Unclassified | 1477 |
| 248 | Ga0157378_10379298 | 3300013297 | Unclassified | 1388 |
| 249 | Ga0157378_11040000 | 3300013297 | Bacteria | 854 |
| 250 | Ga0163162_10071110 | 3300013306 | Unclassified | 3532 |
| 251 | Ga0163162_10366163 | 3300013306 | Bacteria | 1574 |
| 252 | Ga0157372_10000528 | 3300013307 | Bacteria | 42366 |
| 253 | Ga0157372_10007720 | 3300013307 | Bacteria | 11436 |
| 254 | Ga0157372_10009455 | 3300013307 | Bacteria | 10366 |
| 255 | Ga0157372_10053510 | 3300013307 | Bacteria | 4500 |
| 256 | Ga0157372_10163930 | 3300013307 | Bacteria | 2570 |
| 257 | Ga0157372_10297780 | 3300013307 | Bacteria | 1876 |
| 258 | Ga0157372_11795776 | 3300013307 | Unclassified | 705 |
| 259 | Ga0157375_10013855 | 3300013308 | Bacteria | 7188 |
| 260 | Ga0157375_10321936 | 3300013308 | Bacteria | 1711 |
| 261 | Ga0157375_11217588 | 3300013308 | Bacteria | 884 |
| 262 | Ga0163163_10153151 | 3300014325 | Unclassified | 2349 |
| 263 | Ga0163163_10417145 | 3300014325 | Bacteria | 1401 |
| 264 | Ga0157380_11065098 | 3300014326 | Bacteria | 846 |
| 265 | Ga0182008_10242538 | 3300014497 | Bacteria | 927 |
| 266 | Ga0157379_10062360 | 3300014968 | Unclassified | 3334 |
| 267 | Ga0157376_10063945 | 3300014969 | Unclassified | 3101 |
| 268 | Ga0157376_10080020 | 3300014969 | Bacteria | 2802 |
| 269 | Ga0206356_10088334 | 3300020070 | Bacteria | 796 |
| 270 | Ga0206356_11021070 | 3300020070 | Bacteria | 848 |
| 271 | Ga0206349_1034394 | 3300020075 | Bacteria | 1150 |
| 272 | Ga0206349_1094117 | 3300020075 | Unclassified | 751 |
| 273 | Ga0206349_1188953 | 3300020075 | Bacteria | 929 |
| 274 | Ga0206355_1103621 | 3300020076 | Bacteria | 844 |
| 275 | Ga0206355_1707686 | 3300020076 | Unclassified | 673 |
| 276 | Ga0206350_10078556 | 3300020080 | Bacteria | 1398 |
| 277 | Ga0206354_11141078 | 3300020081 | Bacteria | 1187 |
| 278 | Ga0206353_11902121 | 3300020082 | Bacteria | 1345 |
| 279 | Ga0154015_1223752 | 3300020610 | Bacteria | 625 |
| 280 | Ga0154015_1299158 | 3300020610 | Bacteria | 650 |
| 281 | Ga0224712_10006784 | 3300022467 | Bacteria | 3291 |
| 282 | Ga0224712_10011102 | 3300022467 | Bacteria | 2779 |
| 283 | Ga0224712_10084498 | 3300022467 | Bacteria | 1317 |
| 284 | Ga0224712_10095992 | 3300022467 | Bacteria | 1249 |
| 285 | Ga0228598_1090971 | 3300024227 | Bacteria | 614 |
| 286 | Ga0207692_10071242 | 3300025898 | Bacteria | 1832 |
| 287 | Ga0207692_10158533 | 3300025898 | Bacteria | 1302 |
| 288 | Ga0207692_10332859 | 3300025898 | Bacteria | 932 |
| 289 | Ga0207642_10312268 | 3300025899 | Unclassified | 915 |
| 290 | Ga0207699_10009555 | 3300025906 | Bacteria | 4835 |
| 291 | Ga0207699_10040258 | 3300025906 | Bacteria | 2692 |
| 292 | Ga0207699_10125253 | 3300025906 | Bacteria | 1667 |
| 293 | Ga0207699_10147239 | 3300025906 | Bacteria | 1554 |
| 294 | Ga0207699_10352972 | 3300025906 | Unclassified | 1038 |
| 295 | Ga0207699_10423231 | 3300025906 | Bacteria | 952 |
| 296 | Ga0207699_10477970 | 3300025906 | Unclassified | 897 |
| 297 | Ga0207645_10075568 | 3300025907 | Bacteria | 2156 |
| 298 | Ga0207645_10086439 | 3300025907 | Bacteria | 2015 |
| 299 | Ga0207684_10090513 | 3300025910 | Bacteria | 2607 |
| 300 | Ga0207684_10548420 | 3300025910 | Bacteria | 989 |
| 301 | Ga0207654_10000038 | 3300025911 | Bacteria | 108576 |
| 302 | Ga0207654_10016732 | 3300025911 | Viruses | 3821 |
| 303 | Ga0207654_10107262 | 3300025911 | Unclassified | 1731 |
| 304 | Ga0207654_10376220 | 3300025911 | Bacteria | 983 |
| 305 | Ga0207654_10482818 | 3300025911 | Bacteria | 873 |
| 306 | Ga0207707_10007487 | 3300025912 | Bacteria | 9514 |
| 307 | Ga0207707_10042284 | 3300025912 | Bacteria | 3978 |
| 308 | Ga0207707_10391627 | 3300025912 | Bacteria | 1194 |
| 309 | Ga0207707_10581584 | 3300025912 | Unclassified | 949 |
| 310 | Ga0207707_10842854 | 3300025912 | Bacteria | 761 |
| 311 | Ga0207695_10000391 | 3300025913 | Bacteria | 98481 |
| 312 | Ga0207695_10007875 | 3300025913 | Bacteria | 13451 |
| 313 | Ga0207695_10078018 | 3300025913 | Unclassified | 3361 |
| 314 | Ga0207695_10157875 | 3300025913 | Bacteria | 2202 |
| 315 | Ga0207695_10183898 | 3300025913 | Bacteria | 2010 |
| 316 | Ga0207671_10013582 | 3300025914 | Bacteria | 6479 |
| 317 | Ga0207671_10156710 | 3300025914 | Unclassified | 1762 |
| 318 | Ga0207671_10967350 | 3300025914 | Bacteria | 672 |
| 319 | Ga0207693_10000171 | 3300025915 | Bacteria | 58894 |
| 320 | Ga0207693_10023401 | 3300025915 | Bacteria | 4906 |
| 321 | Ga0207693_10070021 | 3300025915 | Bacteria | 2745 |
| 322 | Ga0207693_10452389 | 3300025915 | Unclassified | 1003 |
| 323 | Ga0207663_10032161 | 3300025916 | Bacteria | 3112 |
| 324 | Ga0207663_10065562 | 3300025916 | Bacteria | 2322 |
| 325 | Ga0207663_10109017 | 3300025916 | Bacteria | 1876 |
| 326 | Ga0207663_10162780 | 3300025916 | Unclassified | 1577 |
| 327 | Ga0207663_10169745 | 3300025916 | Bacteria | 1548 |
| 328 | Ga0207663_10271886 | 3300025916 | Bacteria | 1255 |
| 329 | Ga0207660_10015347 | 3300025917 | Bacteria | 5054 |
| 330 | Ga0207657_10008171 | 3300025919 | Bacteria | 10661 |
| 331 | Ga0207657_10097313 | 3300025919 | Bacteria | 2447 |
| 332 | Ga0207649_10194916 | 3300025920 | Unclassified | 1427 |
| 333 | Ga0207652_10107552 | 3300025921 | Bacteria | 2470 |
| 334 | Ga0207646_10465710 | 3300025922 | Unclassified | 1140 |
| 335 | Ga0207646_11366919 | 3300025922 | Bacteria | 617 |
| 336 | Ga0207681_10522216 | 3300025923 | Unclassified | 974 |
| 337 | Ga0207694_10007379 | 3300025924 | Bacteria | 8339 |
| 338 | Ga0207659_10874970 | 3300025926 | Bacteria | 772 |
| 339 | Ga0207687_10002567 | 3300025927 | Bacteria | 12336 |
| 340 | Ga0207687_10011399 | 3300025927 | Bacteria | 5811 |
| 341 | Ga0207687_10482828 | 3300025927 | Bacteria | 1032 |
| 342 | Ga0207700_10006248 | 3300025928 | Bacteria | 7185 |
| 343 | Ga0207700_10009438 | 3300025928 | Bacteria | 6094 |
| 344 | Ga0207700_10009659 | 3300025928 | Bacteria | 6040 |
| 345 | Ga0207700_11178185 | 3300025928 | Bacteria | 684 |
| 346 | Ga0207664_10000075 | 3300025929 | Bacteria | 102649 |
| 347 | Ga0207664_10000236 | 3300025929 | Bacteria | 41929 |
| 348 | Ga0207664_10025618 | 3300025929 | Bacteria | 4447 |
| 349 | Ga0207664_10539229 | 3300025929 | Unclassified | 1046 |
| 350 | Ga0207664_10717742 | 3300025929 | Bacteria | 899 |
| 351 | Ga0207664_10870717 | 3300025929 | Bacteria | 809 |
| 352 | Ga0207644_10127918 | 3300025931 | Bacteria | 1941 |
| 353 | Ga0207706_10000331 | 3300025933 | Bacteria | 51309 |
| 354 | Ga0207706_10087971 | 3300025933 | Bacteria | 2732 |
| 355 | Ga0207706_10161718 | 3300025933 | Bacteria | 1968 |
| 356 | Ga0207686_10042322 | 3300025934 | Bacteria | 2783 |
| 357 | Ga0207709_10099674 | 3300025935 | Bacteria | 1918 |
| 358 | Ga0207670_10021549 | 3300025936 | Bacteria | 3978 |
| 359 | Ga0207704_10029317 | 3300025938 | Bacteria | 3067 |
| 360 | Ga0207704_10977112 | 3300025938 | Unclassified | 715 |
| 361 | Ga0207704_11514669 | 3300025938 | Bacteria | 576 |
| 362 | Ga0207665_10047244 | 3300025939 | Bacteria | 2885 |
| 363 | Ga0207665_10268796 | 3300025939 | Bacteria | 1265 |
| 364 | Ga0207665_10504182 | 3300025939 | Bacteria | 935 |
| 365 | Ga0207711_10000693 | 3300025941 | Bacteria | 33226 |
| 366 | Ga0207711_10003843 | 3300025941 | Bacteria | 12920 |
| 367 | Ga0207711_10042547 | 3300025941 | Unclassified | 3871 |
| 368 | Ga0207711_10599418 | 3300025941 | Unclassified | 1028 |
| 369 | Ga0207711_11464195 | 3300025941 | Bacteria | 626 |
| 370 | Ga0207689_10035894 | 3300025942 | Bacteria | 4115 |
| 371 | Ga0207661_10005480 | 3300025944 | Bacteria | 8951 |
| 372 | Ga0207661_10098080 | 3300025944 | Bacteria | 2455 |
| 373 | Ga0207661_10823850 | 3300025944 | Unclassified | 854 |
| 374 | Ga0207679_10239096 | 3300025945 | Bacteria | 1538 |
| 375 | Ga0207679_10355172 | 3300025945 | Bacteria | 1278 |
| 376 | Ga0207679_10491605 | 3300025945 | Bacteria | 1094 |
| 377 | Ga0207667_10000252 | 3300025949 | Bacteria | 75421 |
| 378 | Ga0207667_10003404 | 3300025949 | Bacteria | 19635 |
| 379 | Ga0207667_10005205 | 3300025949 | Bacteria | 15878 |
| 380 | Ga0207667_10014228 | 3300025949 | Bacteria | 9077 |
| 381 | Ga0207667_10595208 | 3300025949 | Bacteria | 1115 |
| 382 | Ga0207651_10323242 | 3300025960 | Bacteria | 1290 |
| 383 | Ga0207712_10032245 | 3300025961 | Bacteria | 3535 |
| 384 | Ga0207712_10590845 | 3300025961 | Unclassified | 959 |
| 385 | Ga0207668_10118089 | 3300025972 | Unclassified | 2003 |
| 386 | Ga0207640_10051096 | 3300025981 | Bacteria | 2685 |
| 387 | Ga0207640_10221630 | 3300025981 | Unclassified | 1449 |
| 388 | Ga0207640_10414370 | 3300025981 | Bacteria | 1101 |
| 389 | Ga0207658_10993817 | 3300025986 | Bacteria | 765 |
| 390 | Ga0207677_10019300 | 3300026023 | Unclassified | 4115 |
| 391 | Ga0207677_10097454 | 3300026023 | Bacteria | 2154 |
| 392 | Ga0207677_10188007 | 3300026023 | Bacteria | 1631 |
| 393 | Ga0207703_10008795 | 3300026035 | Bacteria | 7961 |
| 394 | Ga0207703_10172256 | 3300026035 | Bacteria | 1905 |
| 395 | Ga0207703_10652143 | 3300026035 | Unclassified | 999 |
| 396 | Ga0207639_10049006 | 3300026041 | Bacteria | 3200 |
| 397 | Ga0207639_10052627 | 3300026041 | Unclassified | 3103 |
| 398 | Ga0207639_10090825 | 3300026041 | Bacteria | 2443 |
| 399 | Ga0207639_10220757 | 3300026041 | Bacteria | 1637 |
| 400 | Ga0207678_10003640 | 3300026067 | Bacteria | 13854 |
| 401 | Ga0207708_10226036 | 3300026075 | Bacteria | 1501 |
| 402 | Ga0207708_10227555 | 3300026075 | Unclassified | 1496 |
| 403 | Ga0207708_10933061 | 3300026075 | Bacteria | 752 |
| 404 | Ga0207702_10000375 | 3300026078 | Bacteria | 50994 |
| 405 | Ga0207702_10002595 | 3300026078 | Bacteria | 16977 |
| 406 | Ga0207702_10072138 | 3300026078 | Bacteria | 2975 |
| 407 | Ga0207702_10362926 | 3300026078 | Bacteria | 1389 |
| 408 | Ga0207702_10641977 | 3300026078 | Bacteria | 1044 |
| 409 | Ga0207702_10799096 | 3300026078 | Unclassified | 932 |
| 410 | Ga0207641_10004392 | 3300026088 | Bacteria | 12224 |
| 411 | Ga0207641_10010766 | 3300026088 | Bacteria | 7499 |
| 412 | Ga0207641_10151150 | 3300026088 | Unclassified | 2103 |
| 413 | Ga0207648_10042586 | 3300026089 | Unclassified | 3985 |
| 414 | Ga0207676_10064889 | 3300026095 | Unclassified | 2906 |
| 415 | Ga0207676_10807545 | 3300026095 | Bacteria | 915 |
| 416 | Ga0207676_10844816 | 3300026095 | Bacteria | 895 |
| 417 | Ga0207676_10872557 | 3300026095 | Unclassified | 881 |
| 418 | Ga0207674_10005073 | 3300026116 | Bacteria | 15716 |
| 419 | Ga0207674_10146633 | 3300026116 | Bacteria | 2318 |
| 420 | Ga0207674_10146843 | 3300026116 | Bacteria | 2317 |
| 421 | Ga0207674_10228834 | 3300026116 | Bacteria | 1807 |
| 422 | Ga0207675_100072595 | 3300026118 | Bacteria | 3219 |
| 423 | Ga0207683_10009501 | 3300026121 | Bacteria | 8289 |
| 424 | Ga0207683_10064629 | 3300026121 | Unclassified | 3225 |
| 425 | Ga0207698_10259794 | 3300026142 | Bacteria | 1595 |
| 426 | Ga0207698_12107951 | 3300026142 | Bacteria | 577 |
| 427 | Ga0268266_10202669 | 3300028379 | Bacteria | 1816 |
| 428 | Ga0268266_10209202 | 3300028379 | Bacteria | 1788 |
| 429 | Ga0268265_10021745 | 3300028380 | Bacteria | 4498 |
| 430 | Ga0265338_10029087 | 3300028800 | Bacteria | 5490 |
| 431 | Ga0265338_10052123 | 3300028800 | Bacteria | 3677 |
| 432 | Ga0265338_10081244 | 3300028800 | Bacteria | 2719 |
| 433 | Ga0265760_10338037 | 3300031090 | Bacteria | 538 |
| 434 | Ga0265332_10214687 | 3300031238 | Unclassified | 798 |
| 435 | Ga0265325_10116480 | 3300031241 | Bacteria | 1293 |
| 436 | Ga0265325_10149016 | 3300031241 | Bacteria | 1108 |
| 437 | Ga0265339_10016736 | 3300031249 | Bacteria | 4363 |
| 438 | Ga0265316_10010562 | 3300031344 | Bacteria | 8406 |
| 439 | Ga0307408_100156265 | 3300031548 | Bacteria | 1806 |
| 440 | Ga0265313_10003403 | 3300031595 | Bacteria | 12897 |
| 441 | Ga0265314_10000463 | 3300031711 | Bacteria | 54000 |
| 442 | Ga0265314_10010997 | 3300031711 | Bacteria | 7510 |
| 443 | Ga0307410_10069397 | 3300031852 | Bacteria | 2438 |
| 444 | Ga0307406_10085836 | 3300031901 | Bacteria | 2106 |
| 445 | Ga0307412_10064454 | 3300031911 | Bacteria | 2476 |
| 446 | Ga0307409_100232443 | 3300031995 | Bacteria | 1672 |
| 447 | Ga0307416_100066535 | 3300032002 | Bacteria | 2967 |
| 448 | Ga0307411_10156624 | 3300032005 | Bacteria | 1700 |
| 449 | Ga0373928_0059645 | 3300035084 | Bacteria | 920 |
| 450 | Ga0373934_0010836 | 3300035086 | Bacteria | 3426 |
| 451 | Ga0373934_0038102 | 3300035086 | Unclassified | 1893 |
| 452 | Ga0373934_0042018 | 3300035086 | Bacteria | 1805 |
| 453 | Ga0373934_0052537 | 3300035086 | Bacteria | 1616 |
| 454 | Ga0373923_0014358 | 3300035111 | Bacteria | 2975 |
| 455 | Ga0373923_0029056 | 3300035111 | Bacteria | 2215 |
| 456 | Ga0373923_0496428 | 3300035111 | Bacteria | 595 |
| 457 | Ga0373936_0000926 | 3300035113 | Bacteria | 10468 |
| 458 | Ga0373945_0006173 | 3300035116 | Unclassified | 3853 |
| 459 | Ga0373945_0149041 | 3300035116 | Bacteria | 947 |
| 460 | Ga0373953_0024102 | 3300035117 | Bacteria | 2310 |
| 461 | Ga0373953_0045847 | 3300035117 | Bacteria | 1754 |
| 462 | Ga0373953_0225644 | 3300035117 | Bacteria | 812 |
| 463 | Ga0373953_0298899 | 3300035117 | Bacteria | 702 |
| 464 | Ga0373954_0004741 | 3300035118 | Bacteria | 5861 |
| 465 | Ga0373954_0006591 | 3300035118 | Bacteria | 5066 |
| 466 | Ga0373954_0024635 | 3300035118 | Bacteria | 2744 |
| 467 | Ga0373954_0307455 | 3300035118 | Bacteria | 782 |
| 468 | Ga0373956_0050917 | 3300035119 | Bacteria | 1861 |
| 469 | Ga0373956_0123131 | 3300035119 | Bacteria | 1212 |
| 470 | Ga0373956_0270565 | 3300035119 | Bacteria | 808 |
| 471 | Ga0373957_0014680 | 3300035120 | Bacteria | 2682 |
| 472 | Ga0373943_0000008 | 3300035170 | Bacteria | 69214 |
| 473 | Ga0373943_0064657 | 3300035170 | Bacteria | 1837 |
| 474 | Ga0373943_0150886 | 3300035170 | Bacteria | 1259 |
| 475 | Ga0373946_0009208 | 3300035171 | Bacteria | 3634 |
| 476 | Ga0373946_0084627 | 3300035171 | Bacteria | 1395 |
| 477 | Ga0373946_0510466 | 3300035171 | Archaea | 617 |
| 478 | Ga0373955_0014870 | 3300035172 | Bacteria | 3797 |
| 479 | Ga0373955_0023017 | 3300035172 | Unclassified | 3169 |
| 480 | Ga0373955_0051386 | 3300035172 | Bacteria | 2245 |
| 481 | Ga0373962_0032684 | 3300035242 | Bacteria | 1432 |
| 482 | Ga0373924_0052185 | 3300035410 | Bacteria | 1697 |
| 483 | Ga0373931_0019442 | 3300035691 | Bacteria | 3390 |
| 484 | Ga0373931_0021385 | 3300035691 | Bacteria | 3246 |
| 485 | Ga0373935_0015919 | 3300035692 | Bacteria | 4550 |
| 486 | Ga0373935_0137340 | 3300035692 | Bacteria | 1648 |
| 487 | Ga0373935_0286996 | 3300035692 | Bacteria | 1160 |
| 488 | Ga0373935_0394825 | 3300035692 | Bacteria | 993 |
| 489 | Ga0373935_0878970 | 3300035692 | Unclassified | 663 |
| 490 | Ga0373935_0918791 | 3300035692 | Bacteria | 649 |
| 491 | Ga0373927_0000102 | 3300035695 | Bacteria | 64428 |
| 492 | Ga0373927_0092825 | 3300035695 | Bacteria | 1961 |
| 493 | Ga0373927_0123393 | 3300035695 | Bacteria | 1691 |
| 494 | Ga0373927_0717496 | 3300035695 | Bacteria | 660 |
| 495 | Ga0373927_0856542 | 3300035695 | Unclassified | 600 |
| 496 | Ga0373933_0007991 | 3300035724 | Bacteria | 5771 |
| 497 | Ga0373933_0095232 | 3300035724 | Bacteria | 1842 |
| 498 | Ga0373933_0339157 | 3300035724 | Bacteria | 975 |
| 499 | Ga0373933_0342739 | 3300035724 | Bacteria | 970 |
| 500 | Ga0373933_0648033 | 3300035724 | Bacteria | 694 |
| 501 | Ga0373933_1111185 | 3300035724 | Unclassified | 521 |
| 502 | Ga0373947_0007459 | 3300035725 | Bacteria | 6330 |
| 503 | Ga0373947_0023114 | 3300035725 | Bacteria | 3614 |
| 504 | Ga0373947_0111322 | 3300035725 | Bacteria | 1730 |
| 505 | Ga0373947_0191601 | 3300035725 | Bacteria | 1334 |
| 506 | Ga0373947_0203346 | 3300035725 | Bacteria | 1297 |
| 507 | Ga0373937_0004135 | 3300036401 | Bacteria | 12311 |
| 508 | Ga0373937_0010536 | 3300036401 | Bacteria | 8073 |
| 509 | Ga0373937_0012098 | 3300036401 | Bacteria | 7574 |
| 510 | Ga0373937_0042259 | 3300036401 | Bacteria | 4158 |
| 511 | Ga0373937_0049028 | 3300036401 | Unclassified | 3867 |
| 512 | Ga0373937_0064012 | 3300036401 | Unclassified | 3382 |
| 513 | Ga0373937_0108483 | 3300036401 | Bacteria | 2581 |
| 514 | Ga0373937_0358237 | 3300036401 | Bacteria | 1382 |
| 515 | Ga0373937_1124278 | 3300036401 | Archaea | 734 |
| 516 | Ga0373925_0005430 | 3300037068 | Bacteria | 9495 |
| 517 | Ga0373925_0052120 | 3300037068 | Bacteria | 3057 |
| 518 | Ga0373925_0066152 | 3300037068 | Bacteria | 2724 |
| 519 | Ga0373925_0124983 | 3300037068 | Bacteria | 2000 |
| 520 | Ga0373925_0140385 | 3300037068 | Bacteria | 1890 |
| 521 | Ga0373925_1728823 | 3300037068 | Bacteria | 511 |
| 522 | Ga0400483_020675 | 3300039062 | Bacteria | 3429 |
| 523 | Ga0400483_087793 | 3300039062 | Bacteria | 1478 |
| 524 | Ga0400483_233653 | 3300039062 | Bacteria | 2165 |
| 525 | Ga0436365_0216498 | 3300039437 | Unclassified | 1049 |
| 526 | Ga0436365_0750502 | 3300039437 | Bacteria | 922 |
| 527 | Ga0436363_1170530 | 3300039450 | Unclassified | 848 |
| 528 | Ga0450910_078793 | 3300042147 | Bacteria | 574 |
| 529 | Ga0439434_0044928 | 3300042435 | Archaea | 1362 |
| 530 | Ga0451577_0326027 | 3300042876 | Bacteria | 1393 |
| 531 | Ga0451577_0835218 | 3300042876 | Bacteria | 831 |
| 532 | Ga0466959_0458910 | 3300045049 | Bacteria | 863 |
| 533 | Ga0451576_0033816 | 3300045051 | Bacteria | 5433 |
| 534 | Ga0451576_0040912 | 3300045051 | Bacteria | 4901 |
| 535 | Ga0451576_1021834 | 3300045051 | Bacteria | 866 |
| 536 | Ga0466958_0577367 | 3300045836 | Bacteria | 731 |
| 537 | Ga0495592_0432588 | 3300046454 | Bacteria | 828 |
| 538 | Ga0495629_0387843 | 3300046459 | Bacteria | 950 |
| 539 | Ga0495580_0000330 | 3300046472 | Bacteria | 38785 |
| 540 | Ga0495580_0003707 | 3300046472 | Bacteria | 12949 |
| 541 | Ga0495580_0015710 | 3300046472 | Bacteria | 5704 |
| 542 | Ga0495580_0056284 | 3300046472 | Bacteria | 2770 |
| 543 | Ga0495580_0164848 | 3300046472 | Bacteria | 1533 |
| 544 | Ga0495580_0630442 | 3300046472 | Bacteria | 706 |
| 545 | Ga0495582_0051933 | 3300046473 | Bacteria | 2261 |
| 546 | Ga0495582_0076817 | 3300046473 | Bacteria | 1852 |
| 547 | Ga0495582_0103869 | 3300046473 | Bacteria | 1592 |
| 548 | Ga0495582_0192800 | 3300046473 | Bacteria | 1163 |
| 549 | Ga0495582_0340533 | 3300046473 | Bacteria | 863 |
| 550 | Ga0495639_0128947 | 3300046475 | Bacteria | 1210 |
| 551 | Ga0495664_0005480 | 3300046477 | Bacteria | 6968 |
| 552 | Ga0495664_0647742 | 3300046477 | Unclassified | 626 |
| 553 | Ga0495664_0767207 | 3300046477 | Bacteria | 568 |
| 554 | Ga0495608_0403480 | 3300046511 | Bacteria | 836 |
| 555 | Ga0495628_0297635 | 3300046516 | Bacteria | 1195 |
| 556 | Ga0495630_0052204 | 3300046517 | Bacteria | 3061 |
| 557 | Ga0495630_0082560 | 3300046517 | Bacteria | 2426 |
| 558 | Ga0495630_0197755 | 3300046517 | Unclassified | 1534 |
| 559 | Ga0495666_0278120 | 3300046526 | Bacteria | 759 |
| 560 | Ga0495652_0021899 | 3300046529 | Bacteria | 5681 |
| 561 | Ga0495652_0177030 | 3300046529 | Unclassified | 1641 |
| 562 | Ga0495665_0029473 | 3300046531 | Unclassified | 2940 |
| 563 | Ga0495665_0066480 | 3300046531 | Bacteria | 1903 |
| 564 | Ga0495665_0073210 | 3300046531 | Bacteria | 1804 |
| 565 | Ga0495640_0669795 | 3300046533 | Bacteria | 624 |
| 566 | Ga0495586_0032842 | 3300046535 | Bacteria | 2783 |
| 567 | Ga0495586_0042186 | 3300046535 | Bacteria | 2457 |
| 568 | Ga0495587_0023365 | 3300046536 | Bacteria | 3799 |
| 569 | Ga0495587_0047465 | 3300046536 | Bacteria | 2546 |
| 570 | Ga0495645_0060850 | 3300046543 | Bacteria | 2737 |
| 571 | Ga0495645_0076931 | 3300046543 | Bacteria | 2400 |
| 572 | Ga0495645_0508685 | 3300046543 | Bacteria | 752 |
| 573 | Ga0495667_0011602 | 3300046559 | Bacteria | 5967 |
| 574 | Ga0495667_0495759 | 3300046559 | Bacteria | 765 |
| 575 | Ga0495634_0040183 | 3300046642 | Bacteria | 3183 |
| 576 | Ga0495657_0355743 | 3300046675 | Bacteria | 866 |
| 577 | Ga0495657_0776669 | 3300046675 | Bacteria | 548 |
| 578 | Ga0495599_0003312 | 3300046678 | Bacteria | 9403 |
| 579 | Ga0495599_0291538 | 3300046678 | Bacteria | 986 |
| 580 | Ga0495623_0140096 | 3300046679 | Bacteria | 1440 |
| 581 | Ga0495646_0464416 | 3300046680 | Bacteria | 653 |
| 582 | Ga0495647_0017424 | 3300046681 | Bacteria | 2541 |
| 583 | Ga0495647_0237407 | 3300046681 | Bacteria | 808 |
| 584 | Ga0495658_0060730 | 3300046683 | Bacteria | 2169 |
| 585 | Ga0495669_0018810 | 3300046684 | Bacteria | 2975 |
| 586 | Ga0495613_0171452 | 3300046689 | Bacteria | 1540 |
| 587 | Ga0495613_0176362 | 3300046689 | Bacteria | 1515 |
| 588 | Ga0495624_0422623 | 3300046690 | Bacteria | 799 |
| 589 | Ga0495581_0301909 | 3300047315 | Bacteria | 936 |
| 590 | Ga0495604_0361924 | 3300047317 | Bacteria | 962 |
| 591 | Ga0495674_0006305 | 3300047319 | Bacteria | 11371 |
| 592 | Ga0495674_0105005 | 3300047319 | Bacteria | 2401 |
| 593 | Ga0495674_0124645 | 3300047319 | Bacteria | 2175 |
| 594 | Ga0495674_0155442 | 3300047319 | Unclassified | 1916 |
| 595 | Ga0495674_0171816 | 3300047319 | Bacteria | 1808 |
| 596 | Ga0495674_0511963 | 3300047319 | Archaea | 959 |
| 597 | Ga0495680_0294707 | 3300047322 | Bacteria | 1140 |
| 598 | Ga0495675_0236266 | 3300047444 | Bacteria | 1101 |
| 599 | Ga0495675_0412203 | 3300047444 | Bacteria | 786 |
| 600 | Ga0495684_0014366 | 3300047471 | Bacteria | 6092 |
| 601 | Ga0495684_0164736 | 3300047471 | Bacteria | 1652 |
| 602 | Ga0495684_0444956 | 3300047471 | Unclassified | 902 |
| 603 | Ga0495602_0001423 | 3300048088 | Bacteria | 23732 |
| 604 | Ga0495602_0786062 | 3300048088 | Unclassified | 640 |
| 605 | Ga0495602_0790522 | 3300048088 | Bacteria | 638 |
| 606 | Ga0495614_0445321 | 3300048089 | Unclassified | 612 |
| 607 | Ga0496100_0038151 | 3300048903 | Bacteria | 3043 |
| 608 | Ga0496100_0509093 | 3300048903 | Bacteria | 928 |
| 609 | Ga0496101_0265297 | 3300048904 | Bacteria | 1340 |
| 610 | Ga0496102_0752203 | 3300048905 | Bacteria | 897 |
| 611 | Ga0496102_0802771 | 3300048905 | Unclassified | 863 |
| 612 | Ga0496104_0263943 | 3300048907 | Bacteria | 1634 |
| 613 | Ga0496104_0294508 | 3300048907 | Bacteria | 1535 |
| 614 | Ga0496106_0236895 | 3300048909 | Bacteria | 1458 |
| 615 | Ga0496106_0327471 | 3300048909 | Bacteria | 1230 |
| 616 | Ga0496107_0492231 | 3300048910 | Bacteria | 910 |
| 617 | Ga0496108_0077860 | 3300048911 | Bacteria | 2806 |
| 618 | Ga0496108_0191305 | 3300048911 | Bacteria | 1774 |
| 619 | Ga0496110_0649728 | 3300048913 | Bacteria | 955 |
| 620 | Ga0496110_1031765 | 3300048913 | Bacteria | 730 |
| 621 | Ga0496111_0013007 | 3300048914 | Bacteria | 5650 |
| 622 | Ga0496112_0215986 | 3300048915 | Bacteria | 1874 |
| 623 | Ga0496112_0421395 | 3300048915 | Bacteria | 1274 |
| 624 | Ga0496113_0055044 | 3300048916 | Bacteria | 2981 |
| 625 | Ga0496114_0839027 | 3300048917 | Bacteria | 799 |
| 626 | Ga0496115_0281221 | 3300048918 | Bacteria | 1366 |
| 627 | Ga0496115_1343229 | 3300048918 | Bacteria | 530 |
| 628 | Ga0501292_016666 | 3300049515 | Bacteria | 1157 |
| 629 | Ga0501298_009341 | 3300049521 | Bacteria | 1666 |
| 630 | Ga0501201_005385 | 3300049651 | Bacteria | 1197 |
| 631 | Ga0501216_000779 | 3300049660 | Bacteria | 3985 |
| 632 | Ga0501217_011337 | 3300049661 | Bacteria | 1971 |
| 633 | Ga0501235_001045 | 3300049669 | Bacteria | 5765 |
| 634 | Ga0501240_006644 | 3300049673 | Bacteria | 1429 |
| 635 | Ga0501249_002079 | 3300049679 | Bacteria | 4078 |
| 636 | Ga0501250_001085 | 3300049680 | Bacteria | 2117 |
| 637 | Ga0501256_002072 | 3300049685 | Bacteria | 1564 |
| 638 | Ga0501257_007777 | 3300049686 | Bacteria | 2399 |
| 639 | Ga0501258_003682 | 3300049687 | Bacteria | 1416 |
| 640 | Ga0501259_009811 | 3300049688 | Bacteria | 1557 |
| 641 | Ga0501221_012359 | 3300049704 | Bacteria | 1552 |
| 642 | Ga0501225_0016027 | 3300049705 | Bacteria | 2083 |
| 643 | Ga0501245_024957 | 3300049708 | Bacteria | 958 |
| 644 | Ga0501081_0618662 | 3300049743 | Bacteria | 811 |
| 645 | Ga0501262_009453 | 3300049759 | Bacteria | 1206 |
| 646 | Ga0501263_010375 | 3300049760 | Bacteria | 1142 |
| 647 | Ga0501266_002452 | 3300049763 | Bacteria | 2339 |
| 648 | Ga0501267_031856 | 3300049764 | Unclassified | 625 |
| 649 | Ga0501271_003699 | 3300049768 | Bacteria | 1423 |
| 650 | Ga0501276_008316 | 3300049773 | Bacteria | 843 |
| 651 | Ga0501282_015066 | 3300049778 | Bacteria | 840 |
| 652 | Ga0501212_004097 | 3300049851 | Bacteria | 1861 |
| 653 | nmdc:mga05p37_419729_c1 | 3300050507 | Bacteria | 1557 |
| 654 | nmdc:mga05p37_475417_c1 | 3300050507 | Bacteria | 1441 |
| 655 | nmdc:mga09592_45612_c1 | 3300050508 | Bacteria | 3692 |
| 656 | nmdc:mga08y16_8658_c1 | 3300050511 | Bacteria | 10669 |
| 657 | nmdc:mga0n895_112446_c1 | 3300050512 | Bacteria | 2740 |
| 658 | nmdc:mga0rr50_44888_c1 | 3300050513 | Bacteria | 3244 |
| 659 | nmdc:mga0rr50_676370_c1 | 3300050513 | Bacteria | 881 |
| 660 | nmdc:mga08x19_21733_c1 | 3300050514 | Bacteria | 3965 |
| 661 | Ga0495601_0020814 | 3300053077 | Bacteria | 4010 |
| 662 | Ga0495601_0344856 | 3300053077 | Bacteria | 969 |
| 663 | Ga0495612_0058151 | 3300053078 | Bacteria | 1598 |
| 664 | Ga0495612_0251181 | 3300053078 | Bacteria | 787 |
| 665 | Ga0495595_0249690 | 3300053084 | Bacteria | 888 |
| 666 | Ga0495619_0109225 | 3300053085 | Bacteria | 1889 |
| 667 | Ga0495619_0923475 | 3300053085 | Bacteria | 586 |
| 668 | Ga0587071_215060 | 3300060344 | Bacteria | 509 |
| 669 | Ga0070711_100182265 | |||
| 670 | MBSR1b_contig_12244917 | |||
| 671 | Ga0058863_10079809 | |||
| 672 | Ga0058863_11344591 | |||
| 673 | Ga0058862_12874744 | |||
| 674 | Ga0065715_10090051 | |||
| 675 | Ga0070676_10308146 | |||
| 676 | Ga0070683_100006580 | |||
| 677 | Ga0070683_100016852 | |||
| 678 | Ga0070683_100055751 | |||
| 679 | Ga0070683_100590040 | |||
| 680 | Ga0070683_100625922 | |||
| 681 | Ga0070690_100014274 | |||
| 682 | Ga0070690_100346333 | |||
| 683 | Ga0070690_100862054 | |||
| 684 | Ga0070666_10169736 | |||
| 685 | Ga0070680_100008281 | |||
| 686 | Ga0070680_100190523 | |||
| 687 | Ga0070682_100018518 | |||
| 688 | Ga0070682_100425124 | |||
| 689 | Ga0070682_101215549 | |||
| 690 | Ga0068868_100004658 | |||
| 691 | Ga0068868_100310710 | |||
| 692 | Ga0070660_100082716 | |||
| 693 | Ga0070660_100098519 | |||
| 694 | Ga0070689_100381588 | |||
| 695 | Ga0070691_10062436 | |||
| 696 | Ga0070691_10106478 | |||
| 697 | Ga0070687_100229211 | |||
| 698 | Ga0070692_10405223 | |||
| 699 | Ga0070668_100006783 | |||
| 700 | Ga0070669_100246303 | |||
| 701 | Ga0070675_100833542 | |||
| 702 | Ga0070671_100164282 | |||
| 703 | Ga0070671_100402313 | |||
| 704 | Ga0070673_101013647 | |||
| 705 | Ga0070659_100021534 | |||
| 706 | Ga0070667_100570175 | |||
| 707 | Ga0070709_10011718 | |||
| 708 | Ga0070709_10015775 | |||
| 709 | Ga0070709_10058098 | |||
| 710 | Ga0070709_10209076 | |||
| 711 | Ga0070709_10320740 | |||
| 712 | Ga0070714_100000184 | |||
| 713 | Ga0070714_100000196 | |||
| 714 | Ga0070714_100016070 | |||
| 715 | Ga0070714_100075795 | |||
| 716 | Ga0070714_100123216 | |||
| 717 | Ga0070714_100142042 | |||
| 718 | Ga0070714_100362206 | |||
| 719 | Ga0070714_100838515 | |||
| 720 | Ga0070714_101699056 | |||
| 721 | Ga0070713_100003045 | |||
| 722 | Ga0070713_100045442 | |||
| 723 | Ga0070713_100091042 | |||
| 724 | Ga0070710_10155005 | |||
| 725 | Ga0070710_10409619 | |||
| 726 | Ga0070711_100012188 | |||
| 727 | Ga0070711_100118278 | |||
| 728 | Ga0070711_100129309 | |||
| 729 | Ga0070711_100282738 | |||
| 730 | Ga0070711_100576500 | |||
| 731 | Ga0070700_100228833 | |||
| 732 | Ga0070694_100092035 | |||
| 733 | Ga0070708_100176848 | |||
| 734 | Ga0070663_100044941 | |||
| 735 | Ga0070678_100049803 | |||
| 736 | Ga0070678_100629511 | |||
| 737 | Ga0070662_100003945 | |||
| 738 | Ga0070662_100202697 | |||
| 739 | Ga0070681_10003147 | |||
| 740 | Ga0070681_10043935 | |||
| 741 | Ga0070681_10200257 | |||
| 742 | Ga0070681_10272572 | |||
| 743 | Ga0070681_10700197 | |||
| 744 | Ga0068867_100006051 | |||
| 745 | Ga0070685_10289759 | |||
| 746 | Ga0070706_100087895 | |||
| 747 | Ga0070706_100110071 | |||
| 748 | Ga0070707_100276001 | |||
| 749 | Ga0070698_100033125 | |||
| 750 | Ga0070698_100267250 | |||
| 751 | Ga0070699_100047687 | |||
| 752 | Ga0070679_100003335 | |||
| 753 | Ga0070679_100118409 | |||
| 754 | Ga0070679_101185062 | |||
| 755 | Ga0070684_100000798 | |||
| 756 | Ga0070684_100010899 | |||
| 757 | Ga0070684_100307006 | |||
| 758 | Ga0070684_100484433 | |||
| 759 | Ga0070684_101567130 | |||
| 760 | Ga0070697_100675251 | |||
| 761 | Ga0068853_100031102 | |||
| 762 | Ga0068853_100038680 | |||
| 763 | Ga0068853_100345919 | |||
| 764 | Ga0068853_101539394 | |||
| 765 | Ga0070672_100266701 | |||
| 766 | Ga0070686_100477186 | |||
| 767 | Ga0070695_100108634 | |||
| 768 | Ga0070693_100009689 | |||
| 769 | Ga0070693_100027791 | |||
| 770 | Ga0070693_100198742 | |||
| 771 | Ga0070665_100068158 | |||
| 772 | Ga0070665_100193688 | |||
| 773 | Ga0070704_100982641 | |||
| 774 | Ga0068855_100031252 | |||
| 775 | Ga0068855_100060060 | |||
| 776 | Ga0068855_100343135 | |||
| 777 | Ga0068855_100469239 | |||
| 778 | Ga0068855_101205210 | |||
| 779 | Ga0070664_100075220 | |||
| 780 | Ga0070664_100495163 | |||
| 781 | Ga0068857_100002143 | |||
| 782 | Ga0068857_100178865 | |||
| 783 | Ga0068854_100004973 | |||
| 784 | Ga0068854_100279681 | |||
| 785 | Ga0068854_100302127 | |||
| 786 | Ga0068854_100326053 | |||
| 787 | Ga0068856_100002863 | |||
| 788 | Ga0068856_100038078 | |||
| 789 | Ga0068856_100041408 | |||
| 790 | Ga0068856_100050993 | |||
| 791 | Ga0068856_100233046 | |||
| 792 | Ga0068856_101189053 | |||
| 793 | Ga0070702_100105495 | |||
| 794 | Ga0068852_100023647 | |||
| 795 | Ga0068852_100281187 | |||
| 796 | Ga0068852_100365828 | |||
| 797 | Ga0068859_100026026 | |||
| 798 | Ga0068864_101002984 | |||
| 799 | Ga0068866_10045875 | |||
| 800 | Ga0068861_100120365 | |||
| 801 | Ga0068861_100582870 | |||
| 802 | Ga0068851_10002143 | |||
| 803 | Ga0068863_100027810 | |||
| 804 | Ga0068863_100052645 | |||
| 805 | Ga0068863_100392632 | |||
| 806 | Ga0068863_100396478 | |||
| 807 | Ga0068858_100007268 | |||
| 808 | Ga0068858_100026156 | |||
| 809 | Ga0068858_100074306 | |||
| 810 | Ga0068858_100582282 | |||
| 811 | Ga0068860_100041978 | |||
| 812 | Ga0070717_10002948 | |||
| 813 | Ga0070717_10012548 | |||
| 814 | Ga0070717_10414818 | |||
| 815 | Ga0070717_11088842 | |||
| 816 | Ga0070716_100172567 | |||
| 817 | Ga0070716_100885264 | |||
| 818 | Ga0070712_100002660 | |||
| 819 | Ga0070712_100017398 | |||
| 820 | Ga0070712_100123681 | |||
| 821 | Ga0070712_100835124 | |||
| 822 | Ga0097621_100024420 | |||
| 823 | Ga0097621_100090938 | |||
| 824 | Ga0097621_100123059 | |||
| 825 | Ga0097621_100136248 | |||
| 826 | Ga0097621_100368114 | |||
| 827 | Ga0097621_100532194 | |||
| 828 | Ga0097621_101123578 | |||
| 829 | Ga0068871_100024059 | |||
| 830 | Ga0068871_100127221 | |||
| 831 | Ga0068871_100158737 | |||
| 832 | Ga0075428_100002239 | |||
| 833 | Ga0075434_100066217 | |||
| 834 | Ga0075434_100352386 | |||
| 835 | Ga0068865_100019749 | |||
| 836 | Ga0068865_100196753 | |||
| 837 | Ga0075436_100039778 | |||
| 838 | Ga0097620_100026025 | |||
| 839 | Ga0105240_10007493 | |||
| 840 | Ga0105240_10008448 | |||
| 841 | Ga0105240_10021905 | |||
| 842 | Ga0105240_10027460 | |||
| 843 | Ga0105240_10137857 | |||
| 844 | Ga0105240_10275185 | |||
| 845 | Ga0111539_10009018 | |||
| 846 | Ga0111539_10426536 | |||
| 847 | Ga0105245_10002187 | |||
| 848 | Ga0105245_10196210 | |||
| 849 | Ga0105245_10454897 | |||
| 850 | Ga0105245_11492686 | |||
| 851 | Ga0105245_11705137 | |||
| 852 | Ga0114129_10521962 | |||
| 853 | Ga0114129_10588851 | |||
| 854 | Ga0114129_11319680 | |||
| 855 | Ga0105243_10177988 | |||
| 856 | Ga0105243_10261445 | |||
| 857 | Ga0105243_10674112 | |||
| 858 | Ga0105241_10000042 | |||
| 859 | Ga0105241_10007601 | |||
| 860 | Ga0105241_10018304 | |||
| 861 | Ga0105241_10565380 | |||
| 862 | Ga0105241_10788661 | |||
| 863 | Ga0105241_10852408 | |||
| 864 | Ga0105242_10080574 | |||
| 865 | Ga0105242_10223824 | |||
| 866 | Ga0105242_11121595 | |||
| 867 | Ga0105242_11523225 | |||
| 868 | Ga0105248_10006910 | |||
| 869 | Ga0105248_10137747 | |||
| 870 | Ga0105248_10166422 | |||
| 871 | Ga0105248_11012547 | |||
| 872 | Ga0105248_12219432 | |||
| 873 | Ga0105237_10009023 | |||
| 874 | Ga0105237_10177373 | |||
| 875 | Ga0105237_10589571 | |||
| 876 | Ga0105238_10003611 | |||
| 877 | Ga0105238_10006656 | |||
| 878 | Ga0105238_10008251 | |||
| 879 | Ga0105238_10033507 | |||
| 880 | Ga0105249_10012493 | |||
| 881 | Ga0105249_10020749 | |||
| 882 | Ga0105249_10465854 | |||
| 883 | Ga0105249_10882082 | |||
| 884 | Ga0130087_1005805 | |||
| 885 | Ga0130084_1094136 | |||
| 886 | Ga0105239_10002634 | |||
| 887 | Ga0105239_10016729 | |||
| 888 | Ga0105239_10022516 | |||
| 889 | Ga0105239_10177598 | |||
| 890 | Ga0105239_10289779 | |||
| 891 | Ga0105239_10644575 | |||
| 892 | Ga0105239_10912140 | |||
| 893 | Ga0105239_11644014 | |||
| 894 | Ga0105246_10006116 | |||
| 895 | Ga0105246_10014891 | |||
| 896 | Ga0105246_10046647 | |||
| 897 | Ga0105246_10102589 | |||
| 898 | Ga0157373_10078640 | |||
| 899 | Ga0157373_10082569 | |||
| 900 | Ga0157371_10041384 | |||
| 901 | Ga0157371_10081697 | |||
| 902 | Ga0157371_10082758 | |||
| 903 | Ga0157370_10004896 | |||
| 904 | Ga0157369_10003154 | |||
| 905 | Ga0157369_10012761 | |||
| 906 | Ga0157369_10189165 | |||
| 907 | Ga0157369_10360683 | |||
| 908 | Ga0157374_10000592 | |||
| 909 | Ga0157374_10004591 | |||
| 910 | Ga0157374_10144196 | |||
| 911 | Ga0157374_10184399 | |||
| 912 | Ga0157374_10230980 | |||
| 913 | Ga0157378_10000401 | |||
| 914 | Ga0157378_10163449 | |||
| 915 | Ga0157378_10333535 | |||
| 916 | Ga0157378_10379298 | |||
| 917 | Ga0157378_11040000 | |||
| 918 | Ga0163162_10071110 | |||
| 919 | Ga0163162_10366163 | |||
| 920 | Ga0157372_10000528 | |||
| 921 | Ga0157372_10007720 | |||
| 922 | Ga0157372_10009455 | |||
| 923 | Ga0157372_10053510 | |||
| 924 | Ga0157372_10163930 | |||
| 925 | Ga0157372_10297780 | |||
| 926 | Ga0157372_11795776 | |||
| 927 | Ga0157375_10013855 | |||
| 928 | Ga0157375_10321936 | |||
| 929 | Ga0157375_11217588 | |||
| 930 | Ga0163163_10153151 | |||
| 931 | Ga0163163_10417145 | |||
| 932 | Ga0157380_11065098 | |||
| 933 | Ga0182008_10242538 | |||
| 934 | Ga0157379_10062360 | |||
| 935 | Ga0157376_10063945 | |||
| 936 | Ga0157376_10080020 | |||
| 937 | Ga0206356_10088334 | |||
| 938 | Ga0206356_11021070 | |||
| 939 | Ga0206349_1034394 | |||
| 940 | Ga0206349_1094117 | |||
| 941 | Ga0206349_1188953 | |||
| 942 | Ga0206355_1103621 | |||
| 943 | Ga0206355_1707686 | |||
| 944 | Ga0206350_10078556 | |||
| 945 | Ga0206354_11141078 | |||
| 946 | Ga0206353_11902121 | |||
| 947 | Ga0154015_1223752 | |||
| 948 | Ga0154015_1299158 | |||
| 949 | Ga0224712_10006784 | |||
| 950 | Ga0224712_10011102 | |||
| 951 | Ga0224712_10084498 | |||
| 952 | Ga0224712_10095992 | |||
| 953 | Ga0228598_1090971 | |||
| 954 | Ga0207692_10071242 | |||
| 955 | Ga0207692_10158533 | |||
| 956 | Ga0207692_10332859 | |||
| 957 | Ga0207642_10312268 | |||
| 958 | Ga0207699_10009555 | |||
| 959 | Ga0207699_10040258 | |||
| 960 | Ga0207699_10125253 | |||
| 961 | Ga0207699_10147239 | |||
| 962 | Ga0207699_10352972 | |||
| 963 | Ga0207699_10423231 | |||
| 964 | Ga0207699_10477970 | |||
| 965 | Ga0207645_10075568 | |||
| 966 | Ga0207645_10086439 | |||
| 967 | Ga0207684_10090513 | |||
| 968 | Ga0207684_10548420 | |||
| 969 | Ga0207654_10000038 | |||
| 970 | Ga0207654_10016732 | |||
| 971 | Ga0207654_10107262 | |||
| 972 | Ga0207654_10376220 | |||
| 973 | Ga0207654_10482818 | |||
| 974 | Ga0207707_10007487 | |||
| 975 | Ga0207707_10042284 | |||
| 976 | Ga0207707_10391627 | |||
| 977 | Ga0207707_10581584 | |||
| 978 | Ga0207707_10842854 | |||
| 979 | Ga0207695_10000391 | |||
| 980 | Ga0207695_10007875 | |||
| 981 | Ga0207695_10078018 | |||
| 982 | Ga0207695_10157875 | |||
| 983 | Ga0207695_10183898 | |||
| 984 | Ga0207671_10013582 | |||
| 985 | Ga0207671_10156710 | |||
| 986 | Ga0207671_10967350 | |||
| 987 | Ga0207693_10000171 | |||
| 988 | Ga0207693_10023401 | |||
| 989 | Ga0207693_10070021 | |||
| 990 | Ga0207693_10452389 | |||
| 991 | Ga0207663_10032161 | |||
| 992 | Ga0207663_10065562 | |||
| 993 | Ga0207663_10109017 | |||
| 994 | Ga0207663_10162780 | |||
| 995 | Ga0207663_10169745 | |||
| 996 | Ga0207663_10271886 | |||
| 997 | Ga0207660_10015347 | |||
| 998 | Ga0207657_10008171 | |||
| 999 | Ga0207657_10097313 | |||
| 1000 | Ga0207649_10194916 | |||
| 1001 | Ga0207652_10107552 | |||
| 1002 | Ga0207646_10465710 | |||
| 1003 | Ga0207646_11366919 | |||
| 1004 | Ga0207681_10522216 | |||
| 1005 | Ga0207694_10007379 | |||
| 1006 | Ga0207659_10874970 | |||
| 1007 | Ga0207687_10002567 | |||
| 1008 | Ga0207687_10011399 | |||
| 1009 | Ga0207687_10482828 | |||
| 1010 | Ga0207700_10006248 | |||
| 1011 | Ga0207700_10009438 | |||
| 1012 | Ga0207700_10009659 | |||
| 1013 | Ga0207700_11178185 | |||
| 1014 | Ga0207664_10000075 | |||
| 1015 | Ga0207664_10000236 | |||
| 1016 | Ga0207664_10025618 | |||
| 1017 | Ga0207664_10539229 | |||
| 1018 | Ga0207664_10717742 | |||
| 1019 | Ga0207664_10870717 | |||
| 1020 | Ga0207644_10127918 | |||
| 1021 | Ga0207706_10000331 | |||
| 1022 | Ga0207706_10087971 | |||
| 1023 | Ga0207706_10161718 | |||
| 1024 | Ga0207686_10042322 | |||
| 1025 | Ga0207709_10099674 | |||
| 1026 | Ga0207670_10021549 | |||
| 1027 | Ga0207704_10029317 | |||
| 1028 | Ga0207704_10977112 | |||
| 1029 | Ga0207704_11514669 | |||
| 1030 | Ga0207665_10047244 | |||
| 1031 | Ga0207665_10268796 | |||
| 1032 | Ga0207665_10504182 | |||
| 1033 | Ga0207711_10000693 | |||
| 1034 | Ga0207711_10003843 | |||
| 1035 | Ga0207711_10042547 | |||
| 1036 | Ga0207711_10599418 | |||
| 1037 | Ga0207711_11464195 | |||
| 1038 | Ga0207689_10035894 | |||
| 1039 | Ga0207661_10005480 | |||
| 1040 | Ga0207661_10098080 | |||
| 1041 | Ga0207661_10823850 | |||
| 1042 | Ga0207679_10239096 | |||
| 1043 | Ga0207679_10355172 | |||
| 1044 | Ga0207679_10491605 | |||
| 1045 | Ga0207667_10000252 | |||
| 1046 | Ga0207667_10003404 | |||
| 1047 | Ga0207667_10005205 | |||
| 1048 | Ga0207667_10014228 | |||
| 1049 | Ga0207667_10595208 | |||
| 1050 | Ga0207651_10323242 | |||
| 1051 | Ga0207712_10032245 | |||
| 1052 | Ga0207712_10590845 | |||
| 1053 | Ga0207668_10118089 | |||
| 1054 | Ga0207640_10051096 | |||
| 1055 | Ga0207640_10221630 | |||
| 1056 | Ga0207640_10414370 | |||
| 1057 | Ga0207658_10993817 | |||
| 1058 | Ga0207677_10019300 | |||
| 1059 | Ga0207677_10097454 | |||
| 1060 | Ga0207677_10188007 | |||
| 1061 | Ga0207703_10008795 | |||
| 1062 | Ga0207703_10172256 | |||
| 1063 | Ga0207703_10652143 | |||
| 1064 | Ga0207639_10049006 | |||
| 1065 | Ga0207639_10052627 | |||
| 1066 | Ga0207639_10090825 | |||
| 1067 | Ga0207639_10220757 | |||
| 1068 | Ga0207678_10003640 | |||
| 1069 | Ga0207708_10226036 | |||
| 1070 | Ga0207708_10227555 | |||
| 1071 | Ga0207708_10933061 | |||
| 1072 | Ga0207702_10000375 | |||
| 1073 | Ga0207702_10002595 | |||
| 1074 | Ga0207702_10072138 | |||
| 1075 | Ga0207702_10362926 | |||
| 1076 | Ga0207702_10641977 | |||
| 1077 | Ga0207702_10799096 | |||
| 1078 | Ga0207641_10004392 | |||
| 1079 | Ga0207641_10010766 | |||
| 1080 | Ga0207641_10151150 | |||
| 1081 | Ga0207648_10042586 | |||
| 1082 | Ga0207676_10064889 | |||
| 1083 | Ga0207676_10807545 | |||
| 1084 | Ga0207676_10844816 | |||
| 1085 | Ga0207676_10872557 | |||
| 1086 | Ga0207674_10005073 | |||
| 1087 | Ga0207674_10146633 | |||
| 1088 | Ga0207674_10146843 | |||
| 1089 | Ga0207674_10228834 | |||
| 1090 | Ga0207675_100072595 | |||
| 1091 | Ga0207683_10009501 | |||
| 1092 | Ga0207683_10064629 | |||
| 1093 | Ga0207698_10259794 | |||
| 1094 | Ga0207698_12107951 | |||
| 1095 | Ga0268266_10202669 | |||
| 1096 | Ga0268266_10209202 | |||
| 1097 | Ga0268265_10021745 | |||
| 1098 | Ga0265338_10029087 | |||
| 1099 | Ga0265338_10052123 | |||
| 1100 | Ga0265338_10081244 | |||
| 1101 | Ga0265760_10338037 | |||
| 1102 | Ga0265332_10214687 | |||
| 1103 | Ga0265325_10116480 | |||
| 1104 | Ga0265325_10149016 | |||
| 1105 | Ga0265339_10016736 | |||
| 1106 | Ga0265316_10010562 | |||
| 1107 | Ga0307408_100156265 | |||
| 1108 | Ga0265313_10003403 | |||
| 1109 | Ga0265314_10000463 | |||
| 1110 | Ga0265314_10010997 | |||
| 1111 | Ga0307410_10069397 | |||
| 1112 | Ga0307406_10085836 | |||
| 1113 | Ga0307412_10064454 | |||
| 1114 | Ga0307409_100232443 | |||
| 1115 | Ga0307416_100066535 | |||
| 1116 | Ga0307411_10156624 | |||
| 1117 | Ga0373928_0059645 | |||
| 1118 | Ga0373934_0010836 | |||
| 1119 | Ga0373934_0038102 | |||
| 1120 | Ga0373934_0042018 | |||
| 1121 | Ga0373934_0052537 | |||
| 1122 | Ga0373923_0014358 | |||
| 1123 | Ga0373923_0029056 | |||
| 1124 | Ga0373923_0496428 | |||
| 1125 | Ga0373936_0000926 | |||
| 1126 | Ga0373945_0006173 | |||
| 1127 | Ga0373945_0149041 | |||
| 1128 | Ga0373953_0024102 | |||
| 1129 | Ga0373953_0045847 | |||
| 1130 | Ga0373953_0225644 | |||
| 1131 | Ga0373953_0298899 | |||
| 1132 | Ga0373954_0004741 | |||
| 1133 | Ga0373954_0006591 | |||
| 1134 | Ga0373954_0024635 | |||
| 1135 | Ga0373954_0307455 | |||
| 1136 | Ga0373956_0050917 | |||
| 1137 | Ga0373956_0123131 | |||
| 1138 | Ga0373956_0270565 | |||
| 1139 | Ga0373957_0014680 | |||
| 1140 | Ga0373943_0000008 | |||
| 1141 | Ga0373943_0064657 | |||
| 1142 | Ga0373943_0150886 | |||
| 1143 | Ga0373946_0009208 | |||
| 1144 | Ga0373946_0084627 | |||
| 1145 | Ga0373946_0510466 | |||
| 1146 | Ga0373955_0014870 | |||
| 1147 | Ga0373955_0023017 | |||
| 1148 | Ga0373955_0051386 | |||
| 1149 | Ga0373962_0032684 | |||
| 1150 | Ga0373924_0052185 | |||
| 1151 | Ga0373931_0019442 | |||
| 1152 | Ga0373931_0021385 | |||
| 1153 | Ga0373935_0015919 | |||
| 1154 | Ga0373935_0137340 | |||
| 1155 | Ga0373935_0286996 | |||
| 1156 | Ga0373935_0394825 | |||
| 1157 | Ga0373935_0878970 | |||
| 1158 | Ga0373935_0918791 | |||
| 1159 | Ga0373927_0000102 | |||
| 1160 | Ga0373927_0092825 | |||
| 1161 | Ga0373927_0123393 | |||
| 1162 | Ga0373927_0717496 | |||
| 1163 | Ga0373927_0856542 | |||
| 1164 | Ga0373933_0007991 | |||
| 1165 | Ga0373933_0095232 | |||
| 1166 | Ga0373933_0339157 | |||
| 1167 | Ga0373933_0342739 | |||
| 1168 | Ga0373933_0648033 | |||
| 1169 | Ga0373933_1111185 | |||
| 1170 | Ga0373947_0007459 | |||
| 1171 | Ga0373947_0023114 | |||
| 1172 | Ga0373947_0111322 | |||
| 1173 | Ga0373947_0191601 | |||
| 1174 | Ga0373947_0203346 | |||
| 1175 | Ga0373937_0004135 | |||
| 1176 | Ga0373937_0010536 | |||
| 1177 | Ga0373937_0012098 | |||
| 1178 | Ga0373937_0042259 | |||
| 1179 | Ga0373937_0049028 | |||
| 1180 | Ga0373937_0064012 | |||
| 1181 | Ga0373937_0108483 | |||
| 1182 | Ga0373937_0358237 | |||
| 1183 | Ga0373937_1124278 | |||
| 1184 | Ga0373925_0005430 | |||
| 1185 | Ga0373925_0052120 | |||
| 1186 | Ga0373925_0066152 | |||
| 1187 | Ga0373925_0124983 | |||
| 1188 | Ga0373925_0140385 | |||
| 1189 | Ga0373925_1728823 | |||
| 1190 | Ga0400483_020675 | |||
| 1191 | Ga0400483_087793 | |||
| 1192 | Ga0400483_233653 | |||
| 1193 | Ga0436365_0216498 | |||
| 1194 | Ga0436365_0750502 | |||
| 1195 | Ga0436363_1170530 | |||
| 1196 | Ga0450910_078793 | |||
| 1197 | Ga0439434_0044928 | |||
| 1198 | Ga0451577_0326027 | |||
| 1199 | Ga0451577_0835218 | |||
| 1200 | Ga0466959_0458910 | |||
| 1201 | Ga0451576_0033816 | |||
| 1202 | Ga0451576_0040912 | |||
| 1203 | Ga0451576_1021834 | |||
| 1204 | Ga0466958_0577367 | |||
| 1205 | Ga0495592_0432588 | |||
| 1206 | Ga0495629_0387843 | |||
| 1207 | Ga0495580_0000330 | |||
| 1208 | Ga0495580_0003707 | |||
| 1209 | Ga0495580_0015710 | |||
| 1210 | Ga0495580_0056284 | |||
| 1211 | Ga0495580_0164848 | |||
| 1212 | Ga0495580_0630442 | |||
| 1213 | Ga0495582_0051933 | |||
| 1214 | Ga0495582_0076817 | |||
| 1215 | Ga0495582_0103869 | |||
| 1216 | Ga0495582_0192800 | |||
| 1217 | Ga0495582_0340533 | |||
| 1218 | Ga0495639_0128947 | |||
| 1219 | Ga0495664_0005480 | |||
| 1220 | Ga0495664_0647742 | |||
| 1221 | Ga0495664_0767207 | |||
| 1222 | Ga0495608_0403480 | |||
| 1223 | Ga0495628_0297635 | |||
| 1224 | Ga0495630_0052204 | |||
| 1225 | Ga0495630_0082560 | |||
| 1226 | Ga0495630_0197755 | |||
| 1227 | Ga0495666_0278120 | |||
| 1228 | Ga0495652_0021899 | |||
| 1229 | Ga0495652_0177030 | |||
| 1230 | Ga0495665_0029473 | |||
| 1231 | Ga0495665_0066480 | |||
| 1232 | Ga0495665_0073210 | |||
| 1233 | Ga0495640_0669795 | |||
| 1234 | Ga0495586_0032842 | |||
| 1235 | Ga0495586_0042186 | |||
| 1236 | Ga0495587_0023365 | |||
| 1237 | Ga0495587_0047465 | |||
| 1238 | Ga0495645_0060850 | |||
| 1239 | Ga0495645_0076931 | |||
| 1240 | Ga0495645_0508685 | |||
| 1241 | Ga0495667_0011602 | |||
| 1242 | Ga0495667_0495759 | |||
| 1243 | Ga0495634_0040183 | |||
| 1244 | Ga0495657_0355743 | |||
| 1245 | Ga0495657_0776669 | |||
| 1246 | Ga0495599_0003312 | |||
| 1247 | Ga0495599_0291538 | |||
| 1248 | Ga0495623_0140096 | |||
| 1249 | Ga0495646_0464416 | |||
| 1250 | Ga0495647_0017424 | |||
| 1251 | Ga0495647_0237407 | |||
| 1252 | Ga0495658_0060730 | |||
| 1253 | Ga0495669_0018810 | |||
| 1254 | Ga0495613_0171452 | |||
| 1255 | Ga0495613_0176362 | |||
| 1256 | Ga0495624_0422623 | |||
| 1257 | Ga0495581_0301909 | |||
| 1258 | Ga0495604_0361924 | |||
| 1259 | Ga0495674_0006305 | |||
| 1260 | Ga0495674_0105005 | |||
| 1261 | Ga0495674_0124645 | |||
| 1262 | Ga0495674_0155442 | |||
| 1263 | Ga0495674_0171816 | |||
| 1264 | Ga0495674_0511963 | |||
| 1265 | Ga0495680_0294707 | |||
| 1266 | Ga0495675_0236266 | |||
| 1267 | Ga0495675_0412203 | |||
| 1268 | Ga0495684_0014366 | |||
| 1269 | Ga0495684_0164736 | |||
| 1270 | Ga0495684_0444956 | |||
| 1271 | Ga0495602_0001423 | |||
| 1272 | Ga0495602_0786062 | |||
| 1273 | Ga0495602_0790522 | |||
| 1274 | Ga0495614_0445321 | |||
| 1275 | Ga0496100_0038151 | |||
| 1276 | Ga0496100_0509093 | |||
| 1277 | Ga0496101_0265297 | |||
| 1278 | Ga0496102_0752203 | |||
| 1279 | Ga0496102_0802771 | |||
| 1280 | Ga0496104_0263943 | |||
| 1281 | Ga0496104_0294508 | |||
| 1282 | Ga0496106_0236895 | |||
| 1283 | Ga0496106_0327471 | |||
| 1284 | Ga0496107_0492231 | |||
| 1285 | Ga0496108_0077860 | |||
| 1286 | Ga0496108_0191305 | |||
| 1287 | Ga0496110_0649728 | |||
| 1288 | Ga0496110_1031765 | |||
| 1289 | Ga0496111_0013007 | |||
| 1290 | Ga0496112_0215986 | |||
| 1291 | Ga0496112_0421395 | |||
| 1292 | Ga0496113_0055044 | |||
| 1293 | Ga0496114_0839027 | |||
| 1294 | Ga0496115_0281221 | |||
| 1295 | Ga0496115_1343229 | |||
| 1296 | Ga0501292_016666 | |||
| 1297 | Ga0501298_009341 | |||
| 1298 | Ga0501201_005385 | |||
| 1299 | Ga0501216_000779 | |||
| 1300 | Ga0501217_011337 | |||
| 1301 | Ga0501235_001045 | |||
| 1302 | Ga0501240_006644 | |||
| 1303 | Ga0501249_002079 | |||
| 1304 | Ga0501250_001085 | |||
| 1305 | Ga0501256_002072 | |||
| 1306 | Ga0501257_007777 | |||
| 1307 | Ga0501258_003682 | |||
| 1308 | Ga0501259_009811 | |||
| 1309 | Ga0501221_012359 | |||
| 1310 | Ga0501225_0016027 | |||
| 1311 | Ga0501245_024957 | |||
| 1312 | Ga0501081_0618662 | |||
| 1313 | Ga0501262_009453 | |||
| 1314 | Ga0501263_010375 | |||
| 1315 | Ga0501266_002452 | |||
| 1316 | Ga0501267_031856 | |||
| 1317 | Ga0501271_003699 | |||
| 1318 | Ga0501276_008316 | |||
| 1319 | Ga0501282_015066 | |||
| 1320 | Ga0501212_004097 | |||
| 1321 | nmdc:mga05p37_419729_c1 | |||
| 1322 | nmdc:mga05p37_475417_c1 | |||
| 1323 | nmdc:mga09592_45612_c1 | |||
| 1324 | nmdc:mga08y16_8658_c1 | |||
| 1325 | nmdc:mga0n895_112446_c1 | |||
| 1326 | nmdc:mga0rr50_44888_c1 | |||
| 1327 | nmdc:mga0rr50_676370_c1 | |||
| 1328 | nmdc:mga08x19_21733_c1 | |||
| 1329 | Ga0495601_0020814 | |||
| 1330 | Ga0495601_0344856 | |||
| 1331 | Ga0495612_0058151 | |||
| 1332 | Ga0495612_0251181 | |||
| 1333 | Ga0495595_0249690 | |||
| 1334 | Ga0495619_0109225 | |||
| 1335 | Ga0495619_0923475 | |||
| 1336 | Ga0587071_215060 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2j89-assembly1.cif.gz_A | functional and structural aspects of poplar cytosolic and plastidial type a methionine sulfoxide reductases | 0.9597 | 1 | 147 |
| 1ff3-assembly3.cif.gz_C | structure of the peptide methionine sulfoxide reductase from escherichia coli | 0.944 | 1 | 145 |
| 6agv-assembly1.cif.gz_A | crystal structure of apo mouse msra | 0.9422 | 1 | 148 |
| 4lwk-assembly2.cif.gz_B | crystal structure of methionine sulfoxide reductase u16s from clostridium oremlandii | 0.9397 | 1 | 144 |
| 4lwm-assembly1.cif.gz_A | crystal structure of methionine sulfoxide reductase u16c/e55d from clostridium oremlandii with methionie sulfoxide | 0.9392 | 1 | 144 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q551H3_1_147_3.30.1060.10 | Alpha Beta;2-Layer Sandwich;Peptide Methionine Sulfoxide Reductase; Chain A;Peptide methionine sulphoxide reductase MsrA | 0.9566 | 1 | 147 | 3.30.1060.10 |
| af_Q9SL43_48_247_3.30.1060.10 | Alpha Beta;2-Layer Sandwich;Peptide Methionine Sulfoxide Reductase; Chain A;Peptide methionine sulphoxide reductase MsrA | 0.9515 | 1 | 144 | 3.30.1060.10 |
| af_B6TNT5_14_185_3.30.1060.10 | Alpha Beta;2-Layer Sandwich;Peptide Methionine Sulfoxide Reductase; Chain A;Peptide methionine sulphoxide reductase MsrA | 0.9498 | 1 | 149 | 3.30.1060.10 |
| af_P0A086_1_166_3.30.1060.10 | Alpha Beta;2-Layer Sandwich;Peptide Methionine Sulfoxide Reductase; Chain A;Peptide methionine sulphoxide reductase MsrA | 0.9425 | 1 | 151 | 3.30.1060.10 |
| 4lwkB00 | Alpha Beta;2-Layer Sandwich;Peptide Methionine Sulfoxide Reductase; Chain A;Peptide methionine sulphoxide reductase MsrA | 0.9397 | 1 | 144 | 3.30.1060.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3D5KKB0-F1-model_v4 | peptide-methionine (S)-S-oxide reductase (EC 1.8.4.11) | 0.9795 | 1 | 140 |
GO:0008113
|
| AF-A0A2V6KNQ5-F1-model_v4 | Peptide methionine sulfoxide reductase MsrA (Protein-methionine-S-oxide reductase) (EC 1.8.4.11) (Peptide-methionine (S)-S-oxide reductase) (Peptide Met(O) reductase) | 0.9784 | 1 | 138 |
GO:0008113
GO:0033744 GO:0036211 |
| AF-A0A381V5V8-F1-model_v4 | peptide-methionine (S)-S-oxide reductase (EC 1.8.4.11) | 0.9748 | 1 | 139 |
GO:0008113
|
| AF-A0A3M1IVW0-F1-model_v4 | Peptide methionine sulfoxide reductase MsrA (Protein-methionine-S-oxide reductase) (EC 1.8.4.11) (Peptide-methionine (S)-S-oxide reductase) (Peptide Met(O) reductase) | 0.9741 | 1 | 144 |
GO:0008113
GO:0033744 GO:0036211 |
| AF-D5MJT8-F1-model_v4 | Peptide methionine sulfoxide reductase MsrA (Protein-methionine-S-oxide reductase) (EC 1.8.4.11) (Peptide-methionine (S)-S-oxide reductase) (Peptide Met(O) reductase) | 0.9735 | 1 | 144 |
GO:0008113
GO:0033744 GO:0036211 |