F473900

General Info

Members Datasets Scaffolds Average Seq Length
668 297 1336 158

Family's Representative Sequence

Representative Sequence 3300005439|Ga0070711_100182265|Ga0070711_1001822651
Length 194
Sequence MRGIRFFVTMALLGSVPLTAAYAAAKGGHSNMEKTTTVEKATFAAGCFWGVEAAFRQVPGVVSTQVGYTGGRTVNPSYEDVCTDRTGHAEAVEVTYDPSRVRYEDLLEVFWKNHDPTTSNRQGPDVGEQYRSAIFFHSPAQETAAKASKARLLAEHRYRRPIVTEIVAAGPFYRAEEYHQQYLEKRGLSVCHIK

Samples

Sample ID Description Type Environment
1 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
26 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
27 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
28 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
29 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
30 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
31 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
38 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
39 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
40 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
41 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
42 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
43 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
44 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
45 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
46 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
47 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
48 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
49 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
50 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
51 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
52 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
53 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
54 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
55 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
56 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
57 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
58 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
59 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
60 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
61 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
62 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
63 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
64 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
65 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
66 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
67 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
68 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
69 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
70 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
72 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
73 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
74 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
75 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
76 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
78 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
80 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
82 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
83 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
84 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
85 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
86 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
87 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
88 3300009828 Sorghum rhizosphere soil microbial communities in Albany, CA(condition:control)- sample E Metatranscriptome Rhizosphere
89 3300009835 Sorghum rhizosphere soil microbial communities under drought stress in Albany, CA - sample B Metatranscriptome Rhizosphere
90 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
91 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
92 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
93 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
94 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
95 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
96 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
97 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
98 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
99 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
100 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
101 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
102 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
103 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
104 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
105 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
106 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
107 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
108 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
109 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
110 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
111 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
112 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
113 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
114 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
115 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
170 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
171 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
172 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
173 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
174 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
175 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
176 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
177 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
178 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
179 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
180 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
181 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
182 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
183 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
184 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
185 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
186 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
187 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
188 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
189 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
190 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
191 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
192 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
193 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
194 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
195 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
196 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
197 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
198 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
199 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
200 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
201 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
202 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
203 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
204 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
205 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
206 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
207 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
208 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
209 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
210 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
211 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
212 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
213 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
214 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
215 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
216 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
217 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
218 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
219 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
220 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
221 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
222 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
223 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
224 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
225 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
226 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
227 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
228 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
229 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
230 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
231 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
232 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
233 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
234 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
235 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
236 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
237 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
238 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
239 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
240 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
241 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
242 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
243 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
244 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
245 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
246 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
247 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
248 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
249 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
250 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
251 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
252 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
253 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
254 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
255 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
256 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
257 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
258 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
259 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
260 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
261 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
262 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
263 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
264 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
265 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
266 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
267 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
268 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
269 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
270 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
271 3300049685 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_B_3_control Metagenome Rhizosphere
272 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
273 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
274 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
275 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
276 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
277 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
278 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
279 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
280 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
281 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
282 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
283 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
284 3300049773 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_B_4_control Metagenome Rhizosphere
285 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
286 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
287 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
288 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
289 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
290 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
291 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
292 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
293 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
294 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
295 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
296 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
297 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.56
Metatranscriptomes 3.44
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.14
Rhizosphere 95.96
Stem 0
Stem Tuber 0
Unclassified 14.52

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070711_100182265 3300005439 Bacteria 1608
2 MBSR1b_contig_12244917 2162886012 Bacteria 1191
3 Ga0058863_10079809 3300004799 Bacteria 1174
4 Ga0058863_11344591 3300004799 Unclassified 639
5 Ga0058862_12874744 3300004803 Bacteria 1266
6 Ga0065715_10090051 3300005293 Bacteria 7803
7 Ga0070676_10308146 3300005328 Bacteria 1076
8 Ga0070683_100006580 3300005329 Bacteria 9758
9 Ga0070683_100016852 3300005329 Bacteria 6446
10 Ga0070683_100055751 3300005329 Bacteria 3668
11 Ga0070683_100590040 3300005329 Bacteria 1063
12 Ga0070683_100625922 3300005329 Bacteria 1030
13 Ga0070690_100014274 3300005330 Unclassified 4711
14 Ga0070690_100346333 3300005330 Unclassified 1077
15 Ga0070690_100862054 3300005330 Unclassified 706
16 Ga0070666_10169736 3300005335 Bacteria 1527
17 Ga0070680_100008281 3300005336 Bacteria 7955
18 Ga0070680_100190523 3300005336 Bacteria 1728
19 Ga0070682_100018518 3300005337 Unclassified 4073
20 Ga0070682_100425124 3300005337 Bacteria 1011
21 Ga0070682_101215549 3300005337 Bacteria 637
22 Ga0068868_100004658 3300005338 Bacteria 9626
23 Ga0068868_100310710 3300005338 Bacteria 1341
24 Ga0070660_100082716 3300005339 Unclassified 2521
25 Ga0070660_100098519 3300005339 Bacteria 2314
26 Ga0070689_100381588 3300005340 Unclassified 1188
27 Ga0070691_10062436 3300005341 Bacteria 1794
28 Ga0070691_10106478 3300005341 Unclassified 1398
29 Ga0070687_100229211 3300005343 Bacteria 1142
30 Ga0070692_10405223 3300005345 Bacteria 862
31 Ga0070668_100006783 3300005347 Bacteria 8489
32 Ga0070669_100246303 3300005353 Bacteria 1421
33 Ga0070675_100833542 3300005354 Unclassified 844
34 Ga0070671_100164282 3300005355 Bacteria 1877
35 Ga0070671_100402313 3300005355 Bacteria 1171
36 Ga0070673_101013647 3300005364 Bacteria 773
37 Ga0070659_100021534 3300005366 Bacteria 4911
38 Ga0070667_100570175 3300005367 Bacteria 1041
39 Ga0070709_10011718 3300005434 Bacteria 4896
40 Ga0070709_10015775 3300005434 Bacteria 4302
41 Ga0070709_10058098 3300005434 Bacteria 2453
42 Ga0070709_10209076 3300005434 Bacteria 1386
43 Ga0070709_10320740 3300005434 Unclassified 1137
44 Ga0070714_100000184 3300005435 Bacteria 49943
45 Ga0070714_100000196 3300005435 Bacteria 49140
46 Ga0070714_100016070 3300005435 Bacteria 6033
47 Ga0070714_100075795 3300005435 Bacteria 2919
48 Ga0070714_100123216 3300005435 Bacteria 2308
49 Ga0070714_100142042 3300005435 Bacteria 2156
50 Ga0070714_100362206 3300005435 Bacteria 1363
51 Ga0070714_100838515 3300005435 Bacteria 891
52 Ga0070714_101699056 3300005435 Bacteria 616
53 Ga0070713_100003045 3300005436 Bacteria 11014
54 Ga0070713_100045442 3300005436 Bacteria 3599
55 Ga0070713_100091042 3300005436 Bacteria 2623
56 Ga0070710_10155005 3300005437 Bacteria 1416
57 Ga0070710_10409619 3300005437 Bacteria 911
58 Ga0070711_100012188 3300005439 Bacteria 5367
59 Ga0070711_100118278 3300005439 Unclassified 1956
60 Ga0070711_100129309 3300005439 Bacteria 1879
61 Ga0070711_100282738 3300005439 Bacteria 1313
62 Ga0070711_100576500 3300005439 Unclassified 936
63 Ga0070700_100228833 3300005441 Bacteria 1322
64 Ga0070694_100092035 3300005444 Unclassified 2130
65 Ga0070708_100176848 3300005445 Bacteria 1994
66 Ga0070663_100044941 3300005455 Bacteria 3117
67 Ga0070678_100049803 3300005456 Bacteria 3025
68 Ga0070678_100629511 3300005456 Bacteria 960
69 Ga0070662_100003945 3300005457 Bacteria 9304
70 Ga0070662_100202697 3300005457 Bacteria 1575
71 Ga0070681_10003147 3300005458 Bacteria 15338
72 Ga0070681_10043935 3300005458 Bacteria 4472
73 Ga0070681_10200257 3300005458 Bacteria 1915
74 Ga0070681_10272572 3300005458 Bacteria 1604
75 Ga0070681_10700197 3300005458 Bacteria 929
76 Ga0068867_100006051 3300005459 Bacteria 8575
77 Ga0070685_10289759 3300005466 Bacteria 1099
78 Ga0070706_100087895 3300005467 Bacteria 2881
79 Ga0070706_100110071 3300005467 Bacteria 2563
80 Ga0070707_100276001 3300005468 Unclassified 1634
81 Ga0070698_100033125 3300005471 Bacteria 5352
82 Ga0070698_100267250 3300005471 Unclassified 1642
83 Ga0070699_100047687 3300005518 Bacteria 3707
84 Ga0070679_100003335 3300005530 Bacteria 14706
85 Ga0070679_100118409 3300005530 Bacteria 2633
86 Ga0070679_101185062 3300005530 Bacteria 709
87 Ga0070684_100000798 3300005535 Bacteria 21897
88 Ga0070684_100010899 3300005535 Bacteria 7223
89 Ga0070684_100307006 3300005535 Bacteria 1457
90 Ga0070684_100484433 3300005535 Bacteria 1145
91 Ga0070684_101567130 3300005535 Bacteria 621
92 Ga0070697_100675251 3300005536 Bacteria 911
93 Ga0068853_100031102 3300005539 Bacteria 4514
94 Ga0068853_100038680 3300005539 Bacteria 4064
95 Ga0068853_100345919 3300005539 Bacteria 1382
96 Ga0068853_101539394 3300005539 Bacteria 644
97 Ga0070672_100266701 3300005543 Unclassified 1445
98 Ga0070686_100477186 3300005544 Bacteria 964
99 Ga0070695_100108634 3300005545 Bacteria 1879
100 Ga0070693_100009689 3300005547 Unclassified 4797
101 Ga0070693_100027791 3300005547 Unclassified 3070
102 Ga0070693_100198742 3300005547 Unclassified 1301
103 Ga0070665_100068158 3300005548 Bacteria 3567
104 Ga0070665_100193688 3300005548 Bacteria 2033
105 Ga0070704_100982641 3300005549 Bacteria 763
106 Ga0068855_100031252 3300005563 Bacteria 6359
107 Ga0068855_100060060 3300005563 Bacteria 4447
108 Ga0068855_100343135 3300005563 Unclassified 1646
109 Ga0068855_100469239 3300005563 Bacteria 1371
110 Ga0068855_101205210 3300005563 Bacteria 787
111 Ga0070664_100075220 3300005564 Bacteria 2900
112 Ga0070664_100495163 3300005564 Bacteria 1126
113 Ga0068857_100002143 3300005577 Bacteria 16043
114 Ga0068857_100178865 3300005577 Bacteria 1930
115 Ga0068854_100004973 3300005578 Bacteria 8382
116 Ga0068854_100279681 3300005578 Unclassified 1343
117 Ga0068854_100302127 3300005578 Bacteria 1295
118 Ga0068854_100326053 3300005578 Bacteria 1250
119 Ga0068856_100002863 3300005614 Bacteria 17656
120 Ga0068856_100038078 3300005614 Bacteria 4720
121 Ga0068856_100041408 3300005614 Bacteria 4527
122 Ga0068856_100050993 3300005614 Bacteria 4080
123 Ga0068856_100233046 3300005614 Bacteria 1856
124 Ga0068856_101189053 3300005614 Bacteria 779
125 Ga0070702_100105495 3300005615 Bacteria 1737
126 Ga0068852_100023647 3300005616 Bacteria 4950
127 Ga0068852_100281187 3300005616 Bacteria 1604
128 Ga0068852_100365828 3300005616 Bacteria 1412
129 Ga0068859_100026026 3300005617 Bacteria 5870
130 Ga0068864_101002984 3300005618 Bacteria 828
131 Ga0068866_10045875 3300005718 Unclassified 2195
132 Ga0068861_100120365 3300005719 Bacteria 2117
133 Ga0068861_100582870 3300005719 Bacteria 1024
134 Ga0068851_10002143 3300005834 Bacteria 8672
135 Ga0068863_100027810 3300005841 Bacteria 5398
136 Ga0068863_100052645 3300005841 Bacteria 3858
137 Ga0068863_100392632 3300005841 Bacteria 1356
138 Ga0068863_100396478 3300005841 Bacteria 1349
139 Ga0068858_100007268 3300005842 Bacteria 10731
140 Ga0068858_100026156 3300005842 Bacteria 5426
141 Ga0068858_100074306 3300005842 Bacteria 3156
142 Ga0068858_100582282 3300005842 Bacteria 1085
143 Ga0068860_100041978 3300005843 Bacteria 4370
144 Ga0070717_10002948 3300006028 Bacteria 12089
145 Ga0070717_10012548 3300006028 Bacteria 6464
146 Ga0070717_10414818 3300006028 Bacteria 1211
147 Ga0070717_11088842 3300006028 Bacteria 728
148 Ga0070716_100172567 3300006173 Bacteria 1412
149 Ga0070716_100885264 3300006173 Bacteria 698
150 Ga0070712_100002660 3300006175 Bacteria 11028
151 Ga0070712_100017398 3300006175 Bacteria 4654
152 Ga0070712_100123681 3300006175 Bacteria 1951
153 Ga0070712_100835124 3300006175 Unclassified 792
154 Ga0097621_100024420 3300006237 Bacteria 4720
155 Ga0097621_100090938 3300006237 Unclassified 2554
156 Ga0097621_100123059 3300006237 Unclassified 2202
157 Ga0097621_100136248 3300006237 Bacteria 2094
158 Ga0097621_100368114 3300006237 Bacteria 1282
159 Ga0097621_100532194 3300006237 Bacteria 1068
160 Ga0097621_101123578 3300006237 Bacteria 738
161 Ga0068871_100024059 3300006358 Bacteria 4720
162 Ga0068871_100127221 3300006358 Unclassified 2157
163 Ga0068871_100158737 3300006358 Bacteria 1933
164 Ga0075428_100002239 3300006844 Bacteria 20945
165 Ga0075434_100066217 3300006871 Bacteria 3598
166 Ga0075434_100352386 3300006871 Bacteria 1493
167 Ga0068865_100019749 3300006881 Bacteria 4363
168 Ga0068865_100196753 3300006881 Bacteria 1562
169 Ga0075436_100039778 3300006914 Bacteria 3245
170 Ga0097620_100026025 3300006931 Bacteria 5870
171 Ga0105240_10007493 3300009093 Bacteria 15833
172 Ga0105240_10008448 3300009093 Bacteria 14727
173 Ga0105240_10021905 3300009093 Bacteria 8488
174 Ga0105240_10027460 3300009093 Bacteria 7449
175 Ga0105240_10137857 3300009093 Bacteria 2920
176 Ga0105240_10275185 3300009093 Bacteria 1937
177 Ga0111539_10009018 3300009094 Bacteria 12623
178 Ga0111539_10426536 3300009094 Bacteria 1544
179 Ga0105245_10002187 3300009098 Bacteria 17718
180 Ga0105245_10196210 3300009098 Bacteria 1936
181 Ga0105245_10454897 3300009098 Bacteria 1289
182 Ga0105245_11492686 3300009098 Bacteria 727
183 Ga0105245_11705137 3300009098 Bacteria 682
184 Ga0114129_10521962 3300009147 Bacteria 1548
185 Ga0114129_10588851 3300009147 Bacteria 1442
186 Ga0114129_11319680 3300009147 Bacteria 893
187 Ga0105243_10177988 3300009148 Unclassified 1847
188 Ga0105243_10261445 3300009148 Bacteria 1550
189 Ga0105243_10674112 3300009148 Bacteria 1005
190 Ga0105241_10000042 3300009174 Bacteria 105578
191 Ga0105241_10007601 3300009174 Bacteria 7967
192 Ga0105241_10018304 3300009174 Bacteria 5153
193 Ga0105241_10565380 3300009174 Unclassified 1023
194 Ga0105241_10788661 3300009174 Bacteria 874
195 Ga0105241_10852408 3300009174 Bacteria 843
196 Ga0105242_10080574 3300009176 Bacteria 2721
197 Ga0105242_10223824 3300009176 Unclassified 1683
198 Ga0105242_11121595 3300009176 Bacteria 802
199 Ga0105242_11523225 3300009176 Bacteria 700
200 Ga0105248_10006910 3300009177 Bacteria 12438
201 Ga0105248_10137747 3300009177 Bacteria 2753
202 Ga0105248_10166422 3300009177 Bacteria 2485
203 Ga0105248_11012547 3300009177 Unclassified 938
204 Ga0105248_12219432 3300009177 Bacteria 625
205 Ga0105237_10009023 3300009545 Bacteria 10718
206 Ga0105237_10177373 3300009545 Unclassified 2131
207 Ga0105237_10589571 3300009545 Bacteria 1118
208 Ga0105238_10003611 3300009551 Bacteria 15420
209 Ga0105238_10006656 3300009551 Bacteria 11523
210 Ga0105238_10008251 3300009551 Bacteria 10421
211 Ga0105238_10033507 3300009551 Bacteria 5228
212 Ga0105249_10012493 3300009553 Bacteria 7485
213 Ga0105249_10020749 3300009553 Bacteria 5875
214 Ga0105249_10465854 3300009553 Bacteria 1304
215 Ga0105249_10882082 3300009553 Unclassified 961
216 Ga0130087_1005805 3300009828 Bacteria 573
217 Ga0130084_1094136 3300009835 Bacteria 573
218 Ga0105239_10002634 3300010375 Bacteria 22663
219 Ga0105239_10016729 3300010375 Bacteria 8106
220 Ga0105239_10022516 3300010375 Bacteria 6947
221 Ga0105239_10177598 3300010375 Bacteria 2382
222 Ga0105239_10289779 3300010375 Bacteria 1844
223 Ga0105239_10644575 3300010375 Bacteria 1210
224 Ga0105239_10912140 3300010375 Unclassified 1008
225 Ga0105239_11644014 3300010375 Bacteria 743
226 Ga0105246_10006116 3300011119 Bacteria 7343
227 Ga0105246_10014891 3300011119 Bacteria 4901
228 Ga0105246_10046647 3300011119 Bacteria 2956
229 Ga0105246_10102589 3300011119 Unclassified 2086
230 Ga0157373_10078640 3300013100 Bacteria 2326
231 Ga0157373_10082569 3300013100 Bacteria 2265
232 Ga0157371_10041384 3300013102 Bacteria 3288
233 Ga0157371_10081697 3300013102 Bacteria 2288
234 Ga0157371_10082758 3300013102 Unclassified 2272
235 Ga0157370_10004896 3300013104 Bacteria 15181
236 Ga0157369_10003154 3300013105 Bacteria 19680
237 Ga0157369_10012761 3300013105 Bacteria 9527
238 Ga0157369_10189165 3300013105 Bacteria 2163
239 Ga0157369_10360683 3300013105 Bacteria 1509
240 Ga0157374_10000592 3300013296 Bacteria 32031
241 Ga0157374_10004591 3300013296 Bacteria 11579
242 Ga0157374_10144196 3300013296 Bacteria 2313
243 Ga0157374_10184399 3300013296 Bacteria 2040
244 Ga0157374_10230980 3300013296 Unclassified 1817
245 Ga0157378_10000401 3300013297 Bacteria 42628
246 Ga0157378_10163449 3300013297 Unclassified 2083
247 Ga0157378_10333535 3300013297 Unclassified 1477
248 Ga0157378_10379298 3300013297 Unclassified 1388
249 Ga0157378_11040000 3300013297 Bacteria 854
250 Ga0163162_10071110 3300013306 Unclassified 3532
251 Ga0163162_10366163 3300013306 Bacteria 1574
252 Ga0157372_10000528 3300013307 Bacteria 42366
253 Ga0157372_10007720 3300013307 Bacteria 11436
254 Ga0157372_10009455 3300013307 Bacteria 10366
255 Ga0157372_10053510 3300013307 Bacteria 4500
256 Ga0157372_10163930 3300013307 Bacteria 2570
257 Ga0157372_10297780 3300013307 Bacteria 1876
258 Ga0157372_11795776 3300013307 Unclassified 705
259 Ga0157375_10013855 3300013308 Bacteria 7188
260 Ga0157375_10321936 3300013308 Bacteria 1711
261 Ga0157375_11217588 3300013308 Bacteria 884
262 Ga0163163_10153151 3300014325 Unclassified 2349
263 Ga0163163_10417145 3300014325 Bacteria 1401
264 Ga0157380_11065098 3300014326 Bacteria 846
265 Ga0182008_10242538 3300014497 Bacteria 927
266 Ga0157379_10062360 3300014968 Unclassified 3334
267 Ga0157376_10063945 3300014969 Unclassified 3101
268 Ga0157376_10080020 3300014969 Bacteria 2802
269 Ga0206356_10088334 3300020070 Bacteria 796
270 Ga0206356_11021070 3300020070 Bacteria 848
271 Ga0206349_1034394 3300020075 Bacteria 1150
272 Ga0206349_1094117 3300020075 Unclassified 751
273 Ga0206349_1188953 3300020075 Bacteria 929
274 Ga0206355_1103621 3300020076 Bacteria 844
275 Ga0206355_1707686 3300020076 Unclassified 673
276 Ga0206350_10078556 3300020080 Bacteria 1398
277 Ga0206354_11141078 3300020081 Bacteria 1187
278 Ga0206353_11902121 3300020082 Bacteria 1345
279 Ga0154015_1223752 3300020610 Bacteria 625
280 Ga0154015_1299158 3300020610 Bacteria 650
281 Ga0224712_10006784 3300022467 Bacteria 3291
282 Ga0224712_10011102 3300022467 Bacteria 2779
283 Ga0224712_10084498 3300022467 Bacteria 1317
284 Ga0224712_10095992 3300022467 Bacteria 1249
285 Ga0228598_1090971 3300024227 Bacteria 614
286 Ga0207692_10071242 3300025898 Bacteria 1832
287 Ga0207692_10158533 3300025898 Bacteria 1302
288 Ga0207692_10332859 3300025898 Bacteria 932
289 Ga0207642_10312268 3300025899 Unclassified 915
290 Ga0207699_10009555 3300025906 Bacteria 4835
291 Ga0207699_10040258 3300025906 Bacteria 2692
292 Ga0207699_10125253 3300025906 Bacteria 1667
293 Ga0207699_10147239 3300025906 Bacteria 1554
294 Ga0207699_10352972 3300025906 Unclassified 1038
295 Ga0207699_10423231 3300025906 Bacteria 952
296 Ga0207699_10477970 3300025906 Unclassified 897
297 Ga0207645_10075568 3300025907 Bacteria 2156
298 Ga0207645_10086439 3300025907 Bacteria 2015
299 Ga0207684_10090513 3300025910 Bacteria 2607
300 Ga0207684_10548420 3300025910 Bacteria 989
301 Ga0207654_10000038 3300025911 Bacteria 108576
302 Ga0207654_10016732 3300025911 Viruses 3821
303 Ga0207654_10107262 3300025911 Unclassified 1731
304 Ga0207654_10376220 3300025911 Bacteria 983
305 Ga0207654_10482818 3300025911 Bacteria 873
306 Ga0207707_10007487 3300025912 Bacteria 9514
307 Ga0207707_10042284 3300025912 Bacteria 3978
308 Ga0207707_10391627 3300025912 Bacteria 1194
309 Ga0207707_10581584 3300025912 Unclassified 949
310 Ga0207707_10842854 3300025912 Bacteria 761
311 Ga0207695_10000391 3300025913 Bacteria 98481
312 Ga0207695_10007875 3300025913 Bacteria 13451
313 Ga0207695_10078018 3300025913 Unclassified 3361
314 Ga0207695_10157875 3300025913 Bacteria 2202
315 Ga0207695_10183898 3300025913 Bacteria 2010
316 Ga0207671_10013582 3300025914 Bacteria 6479
317 Ga0207671_10156710 3300025914 Unclassified 1762
318 Ga0207671_10967350 3300025914 Bacteria 672
319 Ga0207693_10000171 3300025915 Bacteria 58894
320 Ga0207693_10023401 3300025915 Bacteria 4906
321 Ga0207693_10070021 3300025915 Bacteria 2745
322 Ga0207693_10452389 3300025915 Unclassified 1003
323 Ga0207663_10032161 3300025916 Bacteria 3112
324 Ga0207663_10065562 3300025916 Bacteria 2322
325 Ga0207663_10109017 3300025916 Bacteria 1876
326 Ga0207663_10162780 3300025916 Unclassified 1577
327 Ga0207663_10169745 3300025916 Bacteria 1548
328 Ga0207663_10271886 3300025916 Bacteria 1255
329 Ga0207660_10015347 3300025917 Bacteria 5054
330 Ga0207657_10008171 3300025919 Bacteria 10661
331 Ga0207657_10097313 3300025919 Bacteria 2447
332 Ga0207649_10194916 3300025920 Unclassified 1427
333 Ga0207652_10107552 3300025921 Bacteria 2470
334 Ga0207646_10465710 3300025922 Unclassified 1140
335 Ga0207646_11366919 3300025922 Bacteria 617
336 Ga0207681_10522216 3300025923 Unclassified 974
337 Ga0207694_10007379 3300025924 Bacteria 8339
338 Ga0207659_10874970 3300025926 Bacteria 772
339 Ga0207687_10002567 3300025927 Bacteria 12336
340 Ga0207687_10011399 3300025927 Bacteria 5811
341 Ga0207687_10482828 3300025927 Bacteria 1032
342 Ga0207700_10006248 3300025928 Bacteria 7185
343 Ga0207700_10009438 3300025928 Bacteria 6094
344 Ga0207700_10009659 3300025928 Bacteria 6040
345 Ga0207700_11178185 3300025928 Bacteria 684
346 Ga0207664_10000075 3300025929 Bacteria 102649
347 Ga0207664_10000236 3300025929 Bacteria 41929
348 Ga0207664_10025618 3300025929 Bacteria 4447
349 Ga0207664_10539229 3300025929 Unclassified 1046
350 Ga0207664_10717742 3300025929 Bacteria 899
351 Ga0207664_10870717 3300025929 Bacteria 809
352 Ga0207644_10127918 3300025931 Bacteria 1941
353 Ga0207706_10000331 3300025933 Bacteria 51309
354 Ga0207706_10087971 3300025933 Bacteria 2732
355 Ga0207706_10161718 3300025933 Bacteria 1968
356 Ga0207686_10042322 3300025934 Bacteria 2783
357 Ga0207709_10099674 3300025935 Bacteria 1918
358 Ga0207670_10021549 3300025936 Bacteria 3978
359 Ga0207704_10029317 3300025938 Bacteria 3067
360 Ga0207704_10977112 3300025938 Unclassified 715
361 Ga0207704_11514669 3300025938 Bacteria 576
362 Ga0207665_10047244 3300025939 Bacteria 2885
363 Ga0207665_10268796 3300025939 Bacteria 1265
364 Ga0207665_10504182 3300025939 Bacteria 935
365 Ga0207711_10000693 3300025941 Bacteria 33226
366 Ga0207711_10003843 3300025941 Bacteria 12920
367 Ga0207711_10042547 3300025941 Unclassified 3871
368 Ga0207711_10599418 3300025941 Unclassified 1028
369 Ga0207711_11464195 3300025941 Bacteria 626
370 Ga0207689_10035894 3300025942 Bacteria 4115
371 Ga0207661_10005480 3300025944 Bacteria 8951
372 Ga0207661_10098080 3300025944 Bacteria 2455
373 Ga0207661_10823850 3300025944 Unclassified 854
374 Ga0207679_10239096 3300025945 Bacteria 1538
375 Ga0207679_10355172 3300025945 Bacteria 1278
376 Ga0207679_10491605 3300025945 Bacteria 1094
377 Ga0207667_10000252 3300025949 Bacteria 75421
378 Ga0207667_10003404 3300025949 Bacteria 19635
379 Ga0207667_10005205 3300025949 Bacteria 15878
380 Ga0207667_10014228 3300025949 Bacteria 9077
381 Ga0207667_10595208 3300025949 Bacteria 1115
382 Ga0207651_10323242 3300025960 Bacteria 1290
383 Ga0207712_10032245 3300025961 Bacteria 3535
384 Ga0207712_10590845 3300025961 Unclassified 959
385 Ga0207668_10118089 3300025972 Unclassified 2003
386 Ga0207640_10051096 3300025981 Bacteria 2685
387 Ga0207640_10221630 3300025981 Unclassified 1449
388 Ga0207640_10414370 3300025981 Bacteria 1101
389 Ga0207658_10993817 3300025986 Bacteria 765
390 Ga0207677_10019300 3300026023 Unclassified 4115
391 Ga0207677_10097454 3300026023 Bacteria 2154
392 Ga0207677_10188007 3300026023 Bacteria 1631
393 Ga0207703_10008795 3300026035 Bacteria 7961
394 Ga0207703_10172256 3300026035 Bacteria 1905
395 Ga0207703_10652143 3300026035 Unclassified 999
396 Ga0207639_10049006 3300026041 Bacteria 3200
397 Ga0207639_10052627 3300026041 Unclassified 3103
398 Ga0207639_10090825 3300026041 Bacteria 2443
399 Ga0207639_10220757 3300026041 Bacteria 1637
400 Ga0207678_10003640 3300026067 Bacteria 13854
401 Ga0207708_10226036 3300026075 Bacteria 1501
402 Ga0207708_10227555 3300026075 Unclassified 1496
403 Ga0207708_10933061 3300026075 Bacteria 752
404 Ga0207702_10000375 3300026078 Bacteria 50994
405 Ga0207702_10002595 3300026078 Bacteria 16977
406 Ga0207702_10072138 3300026078 Bacteria 2975
407 Ga0207702_10362926 3300026078 Bacteria 1389
408 Ga0207702_10641977 3300026078 Bacteria 1044
409 Ga0207702_10799096 3300026078 Unclassified 932
410 Ga0207641_10004392 3300026088 Bacteria 12224
411 Ga0207641_10010766 3300026088 Bacteria 7499
412 Ga0207641_10151150 3300026088 Unclassified 2103
413 Ga0207648_10042586 3300026089 Unclassified 3985
414 Ga0207676_10064889 3300026095 Unclassified 2906
415 Ga0207676_10807545 3300026095 Bacteria 915
416 Ga0207676_10844816 3300026095 Bacteria 895
417 Ga0207676_10872557 3300026095 Unclassified 881
418 Ga0207674_10005073 3300026116 Bacteria 15716
419 Ga0207674_10146633 3300026116 Bacteria 2318
420 Ga0207674_10146843 3300026116 Bacteria 2317
421 Ga0207674_10228834 3300026116 Bacteria 1807
422 Ga0207675_100072595 3300026118 Bacteria 3219
423 Ga0207683_10009501 3300026121 Bacteria 8289
424 Ga0207683_10064629 3300026121 Unclassified 3225
425 Ga0207698_10259794 3300026142 Bacteria 1595
426 Ga0207698_12107951 3300026142 Bacteria 577
427 Ga0268266_10202669 3300028379 Bacteria 1816
428 Ga0268266_10209202 3300028379 Bacteria 1788
429 Ga0268265_10021745 3300028380 Bacteria 4498
430 Ga0265338_10029087 3300028800 Bacteria 5490
431 Ga0265338_10052123 3300028800 Bacteria 3677
432 Ga0265338_10081244 3300028800 Bacteria 2719
433 Ga0265760_10338037 3300031090 Bacteria 538
434 Ga0265332_10214687 3300031238 Unclassified 798
435 Ga0265325_10116480 3300031241 Bacteria 1293
436 Ga0265325_10149016 3300031241 Bacteria 1108
437 Ga0265339_10016736 3300031249 Bacteria 4363
438 Ga0265316_10010562 3300031344 Bacteria 8406
439 Ga0307408_100156265 3300031548 Bacteria 1806
440 Ga0265313_10003403 3300031595 Bacteria 12897
441 Ga0265314_10000463 3300031711 Bacteria 54000
442 Ga0265314_10010997 3300031711 Bacteria 7510
443 Ga0307410_10069397 3300031852 Bacteria 2438
444 Ga0307406_10085836 3300031901 Bacteria 2106
445 Ga0307412_10064454 3300031911 Bacteria 2476
446 Ga0307409_100232443 3300031995 Bacteria 1672
447 Ga0307416_100066535 3300032002 Bacteria 2967
448 Ga0307411_10156624 3300032005 Bacteria 1700
449 Ga0373928_0059645 3300035084 Bacteria 920
450 Ga0373934_0010836 3300035086 Bacteria 3426
451 Ga0373934_0038102 3300035086 Unclassified 1893
452 Ga0373934_0042018 3300035086 Bacteria 1805
453 Ga0373934_0052537 3300035086 Bacteria 1616
454 Ga0373923_0014358 3300035111 Bacteria 2975
455 Ga0373923_0029056 3300035111 Bacteria 2215
456 Ga0373923_0496428 3300035111 Bacteria 595
457 Ga0373936_0000926 3300035113 Bacteria 10468
458 Ga0373945_0006173 3300035116 Unclassified 3853
459 Ga0373945_0149041 3300035116 Bacteria 947
460 Ga0373953_0024102 3300035117 Bacteria 2310
461 Ga0373953_0045847 3300035117 Bacteria 1754
462 Ga0373953_0225644 3300035117 Bacteria 812
463 Ga0373953_0298899 3300035117 Bacteria 702
464 Ga0373954_0004741 3300035118 Bacteria 5861
465 Ga0373954_0006591 3300035118 Bacteria 5066
466 Ga0373954_0024635 3300035118 Bacteria 2744
467 Ga0373954_0307455 3300035118 Bacteria 782
468 Ga0373956_0050917 3300035119 Bacteria 1861
469 Ga0373956_0123131 3300035119 Bacteria 1212
470 Ga0373956_0270565 3300035119 Bacteria 808
471 Ga0373957_0014680 3300035120 Bacteria 2682
472 Ga0373943_0000008 3300035170 Bacteria 69214
473 Ga0373943_0064657 3300035170 Bacteria 1837
474 Ga0373943_0150886 3300035170 Bacteria 1259
475 Ga0373946_0009208 3300035171 Bacteria 3634
476 Ga0373946_0084627 3300035171 Bacteria 1395
477 Ga0373946_0510466 3300035171 Archaea 617
478 Ga0373955_0014870 3300035172 Bacteria 3797
479 Ga0373955_0023017 3300035172 Unclassified 3169
480 Ga0373955_0051386 3300035172 Bacteria 2245
481 Ga0373962_0032684 3300035242 Bacteria 1432
482 Ga0373924_0052185 3300035410 Bacteria 1697
483 Ga0373931_0019442 3300035691 Bacteria 3390
484 Ga0373931_0021385 3300035691 Bacteria 3246
485 Ga0373935_0015919 3300035692 Bacteria 4550
486 Ga0373935_0137340 3300035692 Bacteria 1648
487 Ga0373935_0286996 3300035692 Bacteria 1160
488 Ga0373935_0394825 3300035692 Bacteria 993
489 Ga0373935_0878970 3300035692 Unclassified 663
490 Ga0373935_0918791 3300035692 Bacteria 649
491 Ga0373927_0000102 3300035695 Bacteria 64428
492 Ga0373927_0092825 3300035695 Bacteria 1961
493 Ga0373927_0123393 3300035695 Bacteria 1691
494 Ga0373927_0717496 3300035695 Bacteria 660
495 Ga0373927_0856542 3300035695 Unclassified 600
496 Ga0373933_0007991 3300035724 Bacteria 5771
497 Ga0373933_0095232 3300035724 Bacteria 1842
498 Ga0373933_0339157 3300035724 Bacteria 975
499 Ga0373933_0342739 3300035724 Bacteria 970
500 Ga0373933_0648033 3300035724 Bacteria 694
501 Ga0373933_1111185 3300035724 Unclassified 521
502 Ga0373947_0007459 3300035725 Bacteria 6330
503 Ga0373947_0023114 3300035725 Bacteria 3614
504 Ga0373947_0111322 3300035725 Bacteria 1730
505 Ga0373947_0191601 3300035725 Bacteria 1334
506 Ga0373947_0203346 3300035725 Bacteria 1297
507 Ga0373937_0004135 3300036401 Bacteria 12311
508 Ga0373937_0010536 3300036401 Bacteria 8073
509 Ga0373937_0012098 3300036401 Bacteria 7574
510 Ga0373937_0042259 3300036401 Bacteria 4158
511 Ga0373937_0049028 3300036401 Unclassified 3867
512 Ga0373937_0064012 3300036401 Unclassified 3382
513 Ga0373937_0108483 3300036401 Bacteria 2581
514 Ga0373937_0358237 3300036401 Bacteria 1382
515 Ga0373937_1124278 3300036401 Archaea 734
516 Ga0373925_0005430 3300037068 Bacteria 9495
517 Ga0373925_0052120 3300037068 Bacteria 3057
518 Ga0373925_0066152 3300037068 Bacteria 2724
519 Ga0373925_0124983 3300037068 Bacteria 2000
520 Ga0373925_0140385 3300037068 Bacteria 1890
521 Ga0373925_1728823 3300037068 Bacteria 511
522 Ga0400483_020675 3300039062 Bacteria 3429
523 Ga0400483_087793 3300039062 Bacteria 1478
524 Ga0400483_233653 3300039062 Bacteria 2165
525 Ga0436365_0216498 3300039437 Unclassified 1049
526 Ga0436365_0750502 3300039437 Bacteria 922
527 Ga0436363_1170530 3300039450 Unclassified 848
528 Ga0450910_078793 3300042147 Bacteria 574
529 Ga0439434_0044928 3300042435 Archaea 1362
530 Ga0451577_0326027 3300042876 Bacteria 1393
531 Ga0451577_0835218 3300042876 Bacteria 831
532 Ga0466959_0458910 3300045049 Bacteria 863
533 Ga0451576_0033816 3300045051 Bacteria 5433
534 Ga0451576_0040912 3300045051 Bacteria 4901
535 Ga0451576_1021834 3300045051 Bacteria 866
536 Ga0466958_0577367 3300045836 Bacteria 731
537 Ga0495592_0432588 3300046454 Bacteria 828
538 Ga0495629_0387843 3300046459 Bacteria 950
539 Ga0495580_0000330 3300046472 Bacteria 38785
540 Ga0495580_0003707 3300046472 Bacteria 12949
541 Ga0495580_0015710 3300046472 Bacteria 5704
542 Ga0495580_0056284 3300046472 Bacteria 2770
543 Ga0495580_0164848 3300046472 Bacteria 1533
544 Ga0495580_0630442 3300046472 Bacteria 706
545 Ga0495582_0051933 3300046473 Bacteria 2261
546 Ga0495582_0076817 3300046473 Bacteria 1852
547 Ga0495582_0103869 3300046473 Bacteria 1592
548 Ga0495582_0192800 3300046473 Bacteria 1163
549 Ga0495582_0340533 3300046473 Bacteria 863
550 Ga0495639_0128947 3300046475 Bacteria 1210
551 Ga0495664_0005480 3300046477 Bacteria 6968
552 Ga0495664_0647742 3300046477 Unclassified 626
553 Ga0495664_0767207 3300046477 Bacteria 568
554 Ga0495608_0403480 3300046511 Bacteria 836
555 Ga0495628_0297635 3300046516 Bacteria 1195
556 Ga0495630_0052204 3300046517 Bacteria 3061
557 Ga0495630_0082560 3300046517 Bacteria 2426
558 Ga0495630_0197755 3300046517 Unclassified 1534
559 Ga0495666_0278120 3300046526 Bacteria 759
560 Ga0495652_0021899 3300046529 Bacteria 5681
561 Ga0495652_0177030 3300046529 Unclassified 1641
562 Ga0495665_0029473 3300046531 Unclassified 2940
563 Ga0495665_0066480 3300046531 Bacteria 1903
564 Ga0495665_0073210 3300046531 Bacteria 1804
565 Ga0495640_0669795 3300046533 Bacteria 624
566 Ga0495586_0032842 3300046535 Bacteria 2783
567 Ga0495586_0042186 3300046535 Bacteria 2457
568 Ga0495587_0023365 3300046536 Bacteria 3799
569 Ga0495587_0047465 3300046536 Bacteria 2546
570 Ga0495645_0060850 3300046543 Bacteria 2737
571 Ga0495645_0076931 3300046543 Bacteria 2400
572 Ga0495645_0508685 3300046543 Bacteria 752
573 Ga0495667_0011602 3300046559 Bacteria 5967
574 Ga0495667_0495759 3300046559 Bacteria 765
575 Ga0495634_0040183 3300046642 Bacteria 3183
576 Ga0495657_0355743 3300046675 Bacteria 866
577 Ga0495657_0776669 3300046675 Bacteria 548
578 Ga0495599_0003312 3300046678 Bacteria 9403
579 Ga0495599_0291538 3300046678 Bacteria 986
580 Ga0495623_0140096 3300046679 Bacteria 1440
581 Ga0495646_0464416 3300046680 Bacteria 653
582 Ga0495647_0017424 3300046681 Bacteria 2541
583 Ga0495647_0237407 3300046681 Bacteria 808
584 Ga0495658_0060730 3300046683 Bacteria 2169
585 Ga0495669_0018810 3300046684 Bacteria 2975
586 Ga0495613_0171452 3300046689 Bacteria 1540
587 Ga0495613_0176362 3300046689 Bacteria 1515
588 Ga0495624_0422623 3300046690 Bacteria 799
589 Ga0495581_0301909 3300047315 Bacteria 936
590 Ga0495604_0361924 3300047317 Bacteria 962
591 Ga0495674_0006305 3300047319 Bacteria 11371
592 Ga0495674_0105005 3300047319 Bacteria 2401
593 Ga0495674_0124645 3300047319 Bacteria 2175
594 Ga0495674_0155442 3300047319 Unclassified 1916
595 Ga0495674_0171816 3300047319 Bacteria 1808
596 Ga0495674_0511963 3300047319 Archaea 959
597 Ga0495680_0294707 3300047322 Bacteria 1140
598 Ga0495675_0236266 3300047444 Bacteria 1101
599 Ga0495675_0412203 3300047444 Bacteria 786
600 Ga0495684_0014366 3300047471 Bacteria 6092
601 Ga0495684_0164736 3300047471 Bacteria 1652
602 Ga0495684_0444956 3300047471 Unclassified 902
603 Ga0495602_0001423 3300048088 Bacteria 23732
604 Ga0495602_0786062 3300048088 Unclassified 640
605 Ga0495602_0790522 3300048088 Bacteria 638
606 Ga0495614_0445321 3300048089 Unclassified 612
607 Ga0496100_0038151 3300048903 Bacteria 3043
608 Ga0496100_0509093 3300048903 Bacteria 928
609 Ga0496101_0265297 3300048904 Bacteria 1340
610 Ga0496102_0752203 3300048905 Bacteria 897
611 Ga0496102_0802771 3300048905 Unclassified 863
612 Ga0496104_0263943 3300048907 Bacteria 1634
613 Ga0496104_0294508 3300048907 Bacteria 1535
614 Ga0496106_0236895 3300048909 Bacteria 1458
615 Ga0496106_0327471 3300048909 Bacteria 1230
616 Ga0496107_0492231 3300048910 Bacteria 910
617 Ga0496108_0077860 3300048911 Bacteria 2806
618 Ga0496108_0191305 3300048911 Bacteria 1774
619 Ga0496110_0649728 3300048913 Bacteria 955
620 Ga0496110_1031765 3300048913 Bacteria 730
621 Ga0496111_0013007 3300048914 Bacteria 5650
622 Ga0496112_0215986 3300048915 Bacteria 1874
623 Ga0496112_0421395 3300048915 Bacteria 1274
624 Ga0496113_0055044 3300048916 Bacteria 2981
625 Ga0496114_0839027 3300048917 Bacteria 799
626 Ga0496115_0281221 3300048918 Bacteria 1366
627 Ga0496115_1343229 3300048918 Bacteria 530
628 Ga0501292_016666 3300049515 Bacteria 1157
629 Ga0501298_009341 3300049521 Bacteria 1666
630 Ga0501201_005385 3300049651 Bacteria 1197
631 Ga0501216_000779 3300049660 Bacteria 3985
632 Ga0501217_011337 3300049661 Bacteria 1971
633 Ga0501235_001045 3300049669 Bacteria 5765
634 Ga0501240_006644 3300049673 Bacteria 1429
635 Ga0501249_002079 3300049679 Bacteria 4078
636 Ga0501250_001085 3300049680 Bacteria 2117
637 Ga0501256_002072 3300049685 Bacteria 1564
638 Ga0501257_007777 3300049686 Bacteria 2399
639 Ga0501258_003682 3300049687 Bacteria 1416
640 Ga0501259_009811 3300049688 Bacteria 1557
641 Ga0501221_012359 3300049704 Bacteria 1552
642 Ga0501225_0016027 3300049705 Bacteria 2083
643 Ga0501245_024957 3300049708 Bacteria 958
644 Ga0501081_0618662 3300049743 Bacteria 811
645 Ga0501262_009453 3300049759 Bacteria 1206
646 Ga0501263_010375 3300049760 Bacteria 1142
647 Ga0501266_002452 3300049763 Bacteria 2339
648 Ga0501267_031856 3300049764 Unclassified 625
649 Ga0501271_003699 3300049768 Bacteria 1423
650 Ga0501276_008316 3300049773 Bacteria 843
651 Ga0501282_015066 3300049778 Bacteria 840
652 Ga0501212_004097 3300049851 Bacteria 1861
653 nmdc:mga05p37_419729_c1 3300050507 Bacteria 1557
654 nmdc:mga05p37_475417_c1 3300050507 Bacteria 1441
655 nmdc:mga09592_45612_c1 3300050508 Bacteria 3692
656 nmdc:mga08y16_8658_c1 3300050511 Bacteria 10669
657 nmdc:mga0n895_112446_c1 3300050512 Bacteria 2740
658 nmdc:mga0rr50_44888_c1 3300050513 Bacteria 3244
659 nmdc:mga0rr50_676370_c1 3300050513 Bacteria 881
660 nmdc:mga08x19_21733_c1 3300050514 Bacteria 3965
661 Ga0495601_0020814 3300053077 Bacteria 4010
662 Ga0495601_0344856 3300053077 Bacteria 969
663 Ga0495612_0058151 3300053078 Bacteria 1598
664 Ga0495612_0251181 3300053078 Bacteria 787
665 Ga0495595_0249690 3300053084 Bacteria 888
666 Ga0495619_0109225 3300053085 Bacteria 1889
667 Ga0495619_0923475 3300053085 Bacteria 586
668 Ga0587071_215060 3300060344 Bacteria 509
669 Ga0070711_100182265
670 MBSR1b_contig_12244917
671 Ga0058863_10079809
672 Ga0058863_11344591
673 Ga0058862_12874744
674 Ga0065715_10090051
675 Ga0070676_10308146
676 Ga0070683_100006580
677 Ga0070683_100016852
678 Ga0070683_100055751
679 Ga0070683_100590040
680 Ga0070683_100625922
681 Ga0070690_100014274
682 Ga0070690_100346333
683 Ga0070690_100862054
684 Ga0070666_10169736
685 Ga0070680_100008281
686 Ga0070680_100190523
687 Ga0070682_100018518
688 Ga0070682_100425124
689 Ga0070682_101215549
690 Ga0068868_100004658
691 Ga0068868_100310710
692 Ga0070660_100082716
693 Ga0070660_100098519
694 Ga0070689_100381588
695 Ga0070691_10062436
696 Ga0070691_10106478
697 Ga0070687_100229211
698 Ga0070692_10405223
699 Ga0070668_100006783
700 Ga0070669_100246303
701 Ga0070675_100833542
702 Ga0070671_100164282
703 Ga0070671_100402313
704 Ga0070673_101013647
705 Ga0070659_100021534
706 Ga0070667_100570175
707 Ga0070709_10011718
708 Ga0070709_10015775
709 Ga0070709_10058098
710 Ga0070709_10209076
711 Ga0070709_10320740
712 Ga0070714_100000184
713 Ga0070714_100000196
714 Ga0070714_100016070
715 Ga0070714_100075795
716 Ga0070714_100123216
717 Ga0070714_100142042
718 Ga0070714_100362206
719 Ga0070714_100838515
720 Ga0070714_101699056
721 Ga0070713_100003045
722 Ga0070713_100045442
723 Ga0070713_100091042
724 Ga0070710_10155005
725 Ga0070710_10409619
726 Ga0070711_100012188
727 Ga0070711_100118278
728 Ga0070711_100129309
729 Ga0070711_100282738
730 Ga0070711_100576500
731 Ga0070700_100228833
732 Ga0070694_100092035
733 Ga0070708_100176848
734 Ga0070663_100044941
735 Ga0070678_100049803
736 Ga0070678_100629511
737 Ga0070662_100003945
738 Ga0070662_100202697
739 Ga0070681_10003147
740 Ga0070681_10043935
741 Ga0070681_10200257
742 Ga0070681_10272572
743 Ga0070681_10700197
744 Ga0068867_100006051
745 Ga0070685_10289759
746 Ga0070706_100087895
747 Ga0070706_100110071
748 Ga0070707_100276001
749 Ga0070698_100033125
750 Ga0070698_100267250
751 Ga0070699_100047687
752 Ga0070679_100003335
753 Ga0070679_100118409
754 Ga0070679_101185062
755 Ga0070684_100000798
756 Ga0070684_100010899
757 Ga0070684_100307006
758 Ga0070684_100484433
759 Ga0070684_101567130
760 Ga0070697_100675251
761 Ga0068853_100031102
762 Ga0068853_100038680
763 Ga0068853_100345919
764 Ga0068853_101539394
765 Ga0070672_100266701
766 Ga0070686_100477186
767 Ga0070695_100108634
768 Ga0070693_100009689
769 Ga0070693_100027791
770 Ga0070693_100198742
771 Ga0070665_100068158
772 Ga0070665_100193688
773 Ga0070704_100982641
774 Ga0068855_100031252
775 Ga0068855_100060060
776 Ga0068855_100343135
777 Ga0068855_100469239
778 Ga0068855_101205210
779 Ga0070664_100075220
780 Ga0070664_100495163
781 Ga0068857_100002143
782 Ga0068857_100178865
783 Ga0068854_100004973
784 Ga0068854_100279681
785 Ga0068854_100302127
786 Ga0068854_100326053
787 Ga0068856_100002863
788 Ga0068856_100038078
789 Ga0068856_100041408
790 Ga0068856_100050993
791 Ga0068856_100233046
792 Ga0068856_101189053
793 Ga0070702_100105495
794 Ga0068852_100023647
795 Ga0068852_100281187
796 Ga0068852_100365828
797 Ga0068859_100026026
798 Ga0068864_101002984
799 Ga0068866_10045875
800 Ga0068861_100120365
801 Ga0068861_100582870
802 Ga0068851_10002143
803 Ga0068863_100027810
804 Ga0068863_100052645
805 Ga0068863_100392632
806 Ga0068863_100396478
807 Ga0068858_100007268
808 Ga0068858_100026156
809 Ga0068858_100074306
810 Ga0068858_100582282
811 Ga0068860_100041978
812 Ga0070717_10002948
813 Ga0070717_10012548
814 Ga0070717_10414818
815 Ga0070717_11088842
816 Ga0070716_100172567
817 Ga0070716_100885264
818 Ga0070712_100002660
819 Ga0070712_100017398
820 Ga0070712_100123681
821 Ga0070712_100835124
822 Ga0097621_100024420
823 Ga0097621_100090938
824 Ga0097621_100123059
825 Ga0097621_100136248
826 Ga0097621_100368114
827 Ga0097621_100532194
828 Ga0097621_101123578
829 Ga0068871_100024059
830 Ga0068871_100127221
831 Ga0068871_100158737
832 Ga0075428_100002239
833 Ga0075434_100066217
834 Ga0075434_100352386
835 Ga0068865_100019749
836 Ga0068865_100196753
837 Ga0075436_100039778
838 Ga0097620_100026025
839 Ga0105240_10007493
840 Ga0105240_10008448
841 Ga0105240_10021905
842 Ga0105240_10027460
843 Ga0105240_10137857
844 Ga0105240_10275185
845 Ga0111539_10009018
846 Ga0111539_10426536
847 Ga0105245_10002187
848 Ga0105245_10196210
849 Ga0105245_10454897
850 Ga0105245_11492686
851 Ga0105245_11705137
852 Ga0114129_10521962
853 Ga0114129_10588851
854 Ga0114129_11319680
855 Ga0105243_10177988
856 Ga0105243_10261445
857 Ga0105243_10674112
858 Ga0105241_10000042
859 Ga0105241_10007601
860 Ga0105241_10018304
861 Ga0105241_10565380
862 Ga0105241_10788661
863 Ga0105241_10852408
864 Ga0105242_10080574
865 Ga0105242_10223824
866 Ga0105242_11121595
867 Ga0105242_11523225
868 Ga0105248_10006910
869 Ga0105248_10137747
870 Ga0105248_10166422
871 Ga0105248_11012547
872 Ga0105248_12219432
873 Ga0105237_10009023
874 Ga0105237_10177373
875 Ga0105237_10589571
876 Ga0105238_10003611
877 Ga0105238_10006656
878 Ga0105238_10008251
879 Ga0105238_10033507
880 Ga0105249_10012493
881 Ga0105249_10020749
882 Ga0105249_10465854
883 Ga0105249_10882082
884 Ga0130087_1005805
885 Ga0130084_1094136
886 Ga0105239_10002634
887 Ga0105239_10016729
888 Ga0105239_10022516
889 Ga0105239_10177598
890 Ga0105239_10289779
891 Ga0105239_10644575
892 Ga0105239_10912140
893 Ga0105239_11644014
894 Ga0105246_10006116
895 Ga0105246_10014891
896 Ga0105246_10046647
897 Ga0105246_10102589
898 Ga0157373_10078640
899 Ga0157373_10082569
900 Ga0157371_10041384
901 Ga0157371_10081697
902 Ga0157371_10082758
903 Ga0157370_10004896
904 Ga0157369_10003154
905 Ga0157369_10012761
906 Ga0157369_10189165
907 Ga0157369_10360683
908 Ga0157374_10000592
909 Ga0157374_10004591
910 Ga0157374_10144196
911 Ga0157374_10184399
912 Ga0157374_10230980
913 Ga0157378_10000401
914 Ga0157378_10163449
915 Ga0157378_10333535
916 Ga0157378_10379298
917 Ga0157378_11040000
918 Ga0163162_10071110
919 Ga0163162_10366163
920 Ga0157372_10000528
921 Ga0157372_10007720
922 Ga0157372_10009455
923 Ga0157372_10053510
924 Ga0157372_10163930
925 Ga0157372_10297780
926 Ga0157372_11795776
927 Ga0157375_10013855
928 Ga0157375_10321936
929 Ga0157375_11217588
930 Ga0163163_10153151
931 Ga0163163_10417145
932 Ga0157380_11065098
933 Ga0182008_10242538
934 Ga0157379_10062360
935 Ga0157376_10063945
936 Ga0157376_10080020
937 Ga0206356_10088334
938 Ga0206356_11021070
939 Ga0206349_1034394
940 Ga0206349_1094117
941 Ga0206349_1188953
942 Ga0206355_1103621
943 Ga0206355_1707686
944 Ga0206350_10078556
945 Ga0206354_11141078
946 Ga0206353_11902121
947 Ga0154015_1223752
948 Ga0154015_1299158
949 Ga0224712_10006784
950 Ga0224712_10011102
951 Ga0224712_10084498
952 Ga0224712_10095992
953 Ga0228598_1090971
954 Ga0207692_10071242
955 Ga0207692_10158533
956 Ga0207692_10332859
957 Ga0207642_10312268
958 Ga0207699_10009555
959 Ga0207699_10040258
960 Ga0207699_10125253
961 Ga0207699_10147239
962 Ga0207699_10352972
963 Ga0207699_10423231
964 Ga0207699_10477970
965 Ga0207645_10075568
966 Ga0207645_10086439
967 Ga0207684_10090513
968 Ga0207684_10548420
969 Ga0207654_10000038
970 Ga0207654_10016732
971 Ga0207654_10107262
972 Ga0207654_10376220
973 Ga0207654_10482818
974 Ga0207707_10007487
975 Ga0207707_10042284
976 Ga0207707_10391627
977 Ga0207707_10581584
978 Ga0207707_10842854
979 Ga0207695_10000391
980 Ga0207695_10007875
981 Ga0207695_10078018
982 Ga0207695_10157875
983 Ga0207695_10183898
984 Ga0207671_10013582
985 Ga0207671_10156710
986 Ga0207671_10967350
987 Ga0207693_10000171
988 Ga0207693_10023401
989 Ga0207693_10070021
990 Ga0207693_10452389
991 Ga0207663_10032161
992 Ga0207663_10065562
993 Ga0207663_10109017
994 Ga0207663_10162780
995 Ga0207663_10169745
996 Ga0207663_10271886
997 Ga0207660_10015347
998 Ga0207657_10008171
999 Ga0207657_10097313
1000 Ga0207649_10194916
1001 Ga0207652_10107552
1002 Ga0207646_10465710
1003 Ga0207646_11366919
1004 Ga0207681_10522216
1005 Ga0207694_10007379
1006 Ga0207659_10874970
1007 Ga0207687_10002567
1008 Ga0207687_10011399
1009 Ga0207687_10482828
1010 Ga0207700_10006248
1011 Ga0207700_10009438
1012 Ga0207700_10009659
1013 Ga0207700_11178185
1014 Ga0207664_10000075
1015 Ga0207664_10000236
1016 Ga0207664_10025618
1017 Ga0207664_10539229
1018 Ga0207664_10717742
1019 Ga0207664_10870717
1020 Ga0207644_10127918
1021 Ga0207706_10000331
1022 Ga0207706_10087971
1023 Ga0207706_10161718
1024 Ga0207686_10042322
1025 Ga0207709_10099674
1026 Ga0207670_10021549
1027 Ga0207704_10029317
1028 Ga0207704_10977112
1029 Ga0207704_11514669
1030 Ga0207665_10047244
1031 Ga0207665_10268796
1032 Ga0207665_10504182
1033 Ga0207711_10000693
1034 Ga0207711_10003843
1035 Ga0207711_10042547
1036 Ga0207711_10599418
1037 Ga0207711_11464195
1038 Ga0207689_10035894
1039 Ga0207661_10005480
1040 Ga0207661_10098080
1041 Ga0207661_10823850
1042 Ga0207679_10239096
1043 Ga0207679_10355172
1044 Ga0207679_10491605
1045 Ga0207667_10000252
1046 Ga0207667_10003404
1047 Ga0207667_10005205
1048 Ga0207667_10014228
1049 Ga0207667_10595208
1050 Ga0207651_10323242
1051 Ga0207712_10032245
1052 Ga0207712_10590845
1053 Ga0207668_10118089
1054 Ga0207640_10051096
1055 Ga0207640_10221630
1056 Ga0207640_10414370
1057 Ga0207658_10993817
1058 Ga0207677_10019300
1059 Ga0207677_10097454
1060 Ga0207677_10188007
1061 Ga0207703_10008795
1062 Ga0207703_10172256
1063 Ga0207703_10652143
1064 Ga0207639_10049006
1065 Ga0207639_10052627
1066 Ga0207639_10090825
1067 Ga0207639_10220757
1068 Ga0207678_10003640
1069 Ga0207708_10226036
1070 Ga0207708_10227555
1071 Ga0207708_10933061
1072 Ga0207702_10000375
1073 Ga0207702_10002595
1074 Ga0207702_10072138
1075 Ga0207702_10362926
1076 Ga0207702_10641977
1077 Ga0207702_10799096
1078 Ga0207641_10004392
1079 Ga0207641_10010766
1080 Ga0207641_10151150
1081 Ga0207648_10042586
1082 Ga0207676_10064889
1083 Ga0207676_10807545
1084 Ga0207676_10844816
1085 Ga0207676_10872557
1086 Ga0207674_10005073
1087 Ga0207674_10146633
1088 Ga0207674_10146843
1089 Ga0207674_10228834
1090 Ga0207675_100072595
1091 Ga0207683_10009501
1092 Ga0207683_10064629
1093 Ga0207698_10259794
1094 Ga0207698_12107951
1095 Ga0268266_10202669
1096 Ga0268266_10209202
1097 Ga0268265_10021745
1098 Ga0265338_10029087
1099 Ga0265338_10052123
1100 Ga0265338_10081244
1101 Ga0265760_10338037
1102 Ga0265332_10214687
1103 Ga0265325_10116480
1104 Ga0265325_10149016
1105 Ga0265339_10016736
1106 Ga0265316_10010562
1107 Ga0307408_100156265
1108 Ga0265313_10003403
1109 Ga0265314_10000463
1110 Ga0265314_10010997
1111 Ga0307410_10069397
1112 Ga0307406_10085836
1113 Ga0307412_10064454
1114 Ga0307409_100232443
1115 Ga0307416_100066535
1116 Ga0307411_10156624
1117 Ga0373928_0059645
1118 Ga0373934_0010836
1119 Ga0373934_0038102
1120 Ga0373934_0042018
1121 Ga0373934_0052537
1122 Ga0373923_0014358
1123 Ga0373923_0029056
1124 Ga0373923_0496428
1125 Ga0373936_0000926
1126 Ga0373945_0006173
1127 Ga0373945_0149041
1128 Ga0373953_0024102
1129 Ga0373953_0045847
1130 Ga0373953_0225644
1131 Ga0373953_0298899
1132 Ga0373954_0004741
1133 Ga0373954_0006591
1134 Ga0373954_0024635
1135 Ga0373954_0307455
1136 Ga0373956_0050917
1137 Ga0373956_0123131
1138 Ga0373956_0270565
1139 Ga0373957_0014680
1140 Ga0373943_0000008
1141 Ga0373943_0064657
1142 Ga0373943_0150886
1143 Ga0373946_0009208
1144 Ga0373946_0084627
1145 Ga0373946_0510466
1146 Ga0373955_0014870
1147 Ga0373955_0023017
1148 Ga0373955_0051386
1149 Ga0373962_0032684
1150 Ga0373924_0052185
1151 Ga0373931_0019442
1152 Ga0373931_0021385
1153 Ga0373935_0015919
1154 Ga0373935_0137340
1155 Ga0373935_0286996
1156 Ga0373935_0394825
1157 Ga0373935_0878970
1158 Ga0373935_0918791
1159 Ga0373927_0000102
1160 Ga0373927_0092825
1161 Ga0373927_0123393
1162 Ga0373927_0717496
1163 Ga0373927_0856542
1164 Ga0373933_0007991
1165 Ga0373933_0095232
1166 Ga0373933_0339157
1167 Ga0373933_0342739
1168 Ga0373933_0648033
1169 Ga0373933_1111185
1170 Ga0373947_0007459
1171 Ga0373947_0023114
1172 Ga0373947_0111322
1173 Ga0373947_0191601
1174 Ga0373947_0203346
1175 Ga0373937_0004135
1176 Ga0373937_0010536
1177 Ga0373937_0012098
1178 Ga0373937_0042259
1179 Ga0373937_0049028
1180 Ga0373937_0064012
1181 Ga0373937_0108483
1182 Ga0373937_0358237
1183 Ga0373937_1124278
1184 Ga0373925_0005430
1185 Ga0373925_0052120
1186 Ga0373925_0066152
1187 Ga0373925_0124983
1188 Ga0373925_0140385
1189 Ga0373925_1728823
1190 Ga0400483_020675
1191 Ga0400483_087793
1192 Ga0400483_233653
1193 Ga0436365_0216498
1194 Ga0436365_0750502
1195 Ga0436363_1170530
1196 Ga0450910_078793
1197 Ga0439434_0044928
1198 Ga0451577_0326027
1199 Ga0451577_0835218
1200 Ga0466959_0458910
1201 Ga0451576_0033816
1202 Ga0451576_0040912
1203 Ga0451576_1021834
1204 Ga0466958_0577367
1205 Ga0495592_0432588
1206 Ga0495629_0387843
1207 Ga0495580_0000330
1208 Ga0495580_0003707
1209 Ga0495580_0015710
1210 Ga0495580_0056284
1211 Ga0495580_0164848
1212 Ga0495580_0630442
1213 Ga0495582_0051933
1214 Ga0495582_0076817
1215 Ga0495582_0103869
1216 Ga0495582_0192800
1217 Ga0495582_0340533
1218 Ga0495639_0128947
1219 Ga0495664_0005480
1220 Ga0495664_0647742
1221 Ga0495664_0767207
1222 Ga0495608_0403480
1223 Ga0495628_0297635
1224 Ga0495630_0052204
1225 Ga0495630_0082560
1226 Ga0495630_0197755
1227 Ga0495666_0278120
1228 Ga0495652_0021899
1229 Ga0495652_0177030
1230 Ga0495665_0029473
1231 Ga0495665_0066480
1232 Ga0495665_0073210
1233 Ga0495640_0669795
1234 Ga0495586_0032842
1235 Ga0495586_0042186
1236 Ga0495587_0023365
1237 Ga0495587_0047465
1238 Ga0495645_0060850
1239 Ga0495645_0076931
1240 Ga0495645_0508685
1241 Ga0495667_0011602
1242 Ga0495667_0495759
1243 Ga0495634_0040183
1244 Ga0495657_0355743
1245 Ga0495657_0776669
1246 Ga0495599_0003312
1247 Ga0495599_0291538
1248 Ga0495623_0140096
1249 Ga0495646_0464416
1250 Ga0495647_0017424
1251 Ga0495647_0237407
1252 Ga0495658_0060730
1253 Ga0495669_0018810
1254 Ga0495613_0171452
1255 Ga0495613_0176362
1256 Ga0495624_0422623
1257 Ga0495581_0301909
1258 Ga0495604_0361924
1259 Ga0495674_0006305
1260 Ga0495674_0105005
1261 Ga0495674_0124645
1262 Ga0495674_0155442
1263 Ga0495674_0171816
1264 Ga0495674_0511963
1265 Ga0495680_0294707
1266 Ga0495675_0236266
1267 Ga0495675_0412203
1268 Ga0495684_0014366
1269 Ga0495684_0164736
1270 Ga0495684_0444956
1271 Ga0495602_0001423
1272 Ga0495602_0786062
1273 Ga0495602_0790522
1274 Ga0495614_0445321
1275 Ga0496100_0038151
1276 Ga0496100_0509093
1277 Ga0496101_0265297
1278 Ga0496102_0752203
1279 Ga0496102_0802771
1280 Ga0496104_0263943
1281 Ga0496104_0294508
1282 Ga0496106_0236895
1283 Ga0496106_0327471
1284 Ga0496107_0492231
1285 Ga0496108_0077860
1286 Ga0496108_0191305
1287 Ga0496110_0649728
1288 Ga0496110_1031765
1289 Ga0496111_0013007
1290 Ga0496112_0215986
1291 Ga0496112_0421395
1292 Ga0496113_0055044
1293 Ga0496114_0839027
1294 Ga0496115_0281221
1295 Ga0496115_1343229
1296 Ga0501292_016666
1297 Ga0501298_009341
1298 Ga0501201_005385
1299 Ga0501216_000779
1300 Ga0501217_011337
1301 Ga0501235_001045
1302 Ga0501240_006644
1303 Ga0501249_002079
1304 Ga0501250_001085
1305 Ga0501256_002072
1306 Ga0501257_007777
1307 Ga0501258_003682
1308 Ga0501259_009811
1309 Ga0501221_012359
1310 Ga0501225_0016027
1311 Ga0501245_024957
1312 Ga0501081_0618662
1313 Ga0501262_009453
1314 Ga0501263_010375
1315 Ga0501266_002452
1316 Ga0501267_031856
1317 Ga0501271_003699
1318 Ga0501276_008316
1319 Ga0501282_015066
1320 Ga0501212_004097
1321 nmdc:mga05p37_419729_c1
1322 nmdc:mga05p37_475417_c1
1323 nmdc:mga09592_45612_c1
1324 nmdc:mga08y16_8658_c1
1325 nmdc:mga0n895_112446_c1
1326 nmdc:mga0rr50_44888_c1
1327 nmdc:mga0rr50_676370_c1
1328 nmdc:mga08x19_21733_c1
1329 Ga0495601_0020814
1330 Ga0495601_0344856
1331 Ga0495612_0058151
1332 Ga0495612_0251181
1333 Ga0495595_0249690
1334 Ga0495619_0109225
1335 Ga0495619_0923475
1336 Ga0587071_215060

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01625

PMSR

Peptide methionine sulfoxide reductase

40

192

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
2j89-assembly1.cif.gz_A functional and structural aspects of poplar cytosolic and plastidial type a methionine sulfoxide reductases 0.9597 1 147
1ff3-assembly3.cif.gz_C structure of the peptide methionine sulfoxide reductase from escherichia coli 0.944 1 145
6agv-assembly1.cif.gz_A crystal structure of apo mouse msra 0.9422 1 148
4lwk-assembly2.cif.gz_B crystal structure of methionine sulfoxide reductase u16s from clostridium oremlandii 0.9397 1 144
4lwm-assembly1.cif.gz_A crystal structure of methionine sulfoxide reductase u16c/e55d from clostridium oremlandii with methionie sulfoxide 0.9392 1 144
ID Description Score Start End Superfamily
af_Q551H3_1_147_3.30.1060.10 Alpha Beta;2-Layer Sandwich;Peptide Methionine Sulfoxide Reductase; Chain A;Peptide methionine sulphoxide reductase MsrA 0.9566 1 147 3.30.1060.10
af_Q9SL43_48_247_3.30.1060.10 Alpha Beta;2-Layer Sandwich;Peptide Methionine Sulfoxide Reductase; Chain A;Peptide methionine sulphoxide reductase MsrA 0.9515 1 144 3.30.1060.10
af_B6TNT5_14_185_3.30.1060.10 Alpha Beta;2-Layer Sandwich;Peptide Methionine Sulfoxide Reductase; Chain A;Peptide methionine sulphoxide reductase MsrA 0.9498 1 149 3.30.1060.10
af_P0A086_1_166_3.30.1060.10 Alpha Beta;2-Layer Sandwich;Peptide Methionine Sulfoxide Reductase; Chain A;Peptide methionine sulphoxide reductase MsrA 0.9425 1 151 3.30.1060.10
4lwkB00 Alpha Beta;2-Layer Sandwich;Peptide Methionine Sulfoxide Reductase; Chain A;Peptide methionine sulphoxide reductase MsrA 0.9397 1 144 3.30.1060.10
ID Description Score Start End GO Terms
AF-A0A3D5KKB0-F1-model_v4 peptide-methionine (S)-S-oxide reductase (EC 1.8.4.11) 0.9795 1 140 GO:0008113
AF-A0A2V6KNQ5-F1-model_v4 Peptide methionine sulfoxide reductase MsrA (Protein-methionine-S-oxide reductase) (EC 1.8.4.11) (Peptide-methionine (S)-S-oxide reductase) (Peptide Met(O) reductase) 0.9784 1 138 GO:0008113
GO:0033744
GO:0036211
AF-A0A381V5V8-F1-model_v4 peptide-methionine (S)-S-oxide reductase (EC 1.8.4.11) 0.9748 1 139 GO:0008113
AF-A0A3M1IVW0-F1-model_v4 Peptide methionine sulfoxide reductase MsrA (Protein-methionine-S-oxide reductase) (EC 1.8.4.11) (Peptide-methionine (S)-S-oxide reductase) (Peptide Met(O) reductase) 0.9741 1 144 GO:0008113
GO:0033744
GO:0036211
AF-D5MJT8-F1-model_v4 Peptide methionine sulfoxide reductase MsrA (Protein-methionine-S-oxide reductase) (EC 1.8.4.11) (Peptide-methionine (S)-S-oxide reductase) (Peptide Met(O) reductase) 0.9735 1 144 GO:0008113
GO:0033744
GO:0036211

Map