F473627

General Info

Members Datasets Scaffolds Average Seq Length
664 252 1328 146

Family's Representative Sequence

Representative Sequence 3300014325|Ga0163163_10901570|Ga0163163_109015702
Length 163
Sequence LARPTLIVLSFVETTMDISPASVWWIAAGVTVAAELATGTFYLLMIALGLAAGAIAVLFGAAPAVQLVVAALVGGGATAIWHWRRVSHAGPALPAARDRDVNLDIGERVHVSTWADDGTARVSYRGSTWAARVQPGAPLAPGEHVVAAVEGNWLVLAPAVARH

Samples

Sample ID Description Type Environment
1 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
2 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
3 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
4 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
5 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
6 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
7 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
42 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
52 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
53 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
54 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
55 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
56 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
57 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
58 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
59 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
60 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
62 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
63 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
64 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
66 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
67 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
68 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
69 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
70 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
71 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
72 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
73 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
74 3300012475 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.old.080610 Metagenome Rhizosphere
75 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
76 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
77 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
78 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
79 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
80 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
81 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
82 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
83 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
84 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
85 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
86 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
87 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
88 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
89 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
90 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
91 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
92 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
93 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
94 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
95 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
97 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
154 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
155 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
156 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
157 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
158 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
159 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
160 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
161 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
162 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
163 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
164 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
165 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
166 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
167 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
168 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
169 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
170 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
171 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
172 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
173 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
174 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
175 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
176 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
177 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
178 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
179 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
180 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
181 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
182 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
183 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
184 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
185 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
186 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
187 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
188 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
189 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
190 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
191 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
192 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
193 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
194 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
195 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
196 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
197 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
198 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
199 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
200 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
201 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
202 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
203 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
204 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
205 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
206 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
207 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
208 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
209 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
210 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
211 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
212 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
213 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
214 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
215 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
216 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
217 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
218 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
219 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
220 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
221 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
222 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
223 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
224 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
225 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
226 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
227 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
228 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
229 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
230 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
231 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
232 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
233 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
234 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
235 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
236 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
237 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
238 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
239 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
240 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
241 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
242 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
243 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
244 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
245 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
246 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
247 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
248 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
249 2643221611 Acidovorax sp. Root219 Isolate Unclassified
250 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
251 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
252 2643221654 Rhizobacter sp. Root404 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.8
Metatranscriptomes 0
Isolates 1.2

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.23
Nodule 0
Rhizoplane 3.61
Rhizosphere 84.94
Stem 0
Stem Tuber 0
Unclassified 0.3

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0163163_10901570 3300014325 Bacteria 947
2 JGI25152J39213_1000777 3300002773 Bacteria 16076
3 JGI25150J39212_1015697 3300002774 Bacteria 1256
4 JGI25153J46596_10000277 3300003215 Bacteria 39318
5 JGI25153J46596_10000961 3300003215 Bacteria 17463
6 Ga0055526_1008853 3300003771 Bacteria 4944
7 Ga0055530_10005586 3300003791 Bacteria 5914
8 Ga0065165_1001001 3300005262 Bacteria 34644
9 Ga0070658_10098144 3300005327 Bacteria 2419
10 Ga0070658_10162040 3300005327 Bacteria 1877
11 Ga0070676_10196303 3300005328 Bacteria 1320
12 Ga0070676_10208875 3300005328 Bacteria 1284
13 Ga0070683_100102007 3300005329 Bacteria 2702
14 Ga0070683_100265019 3300005329 Bacteria 1634
15 Ga0070690_100319337 3300005330 Bacteria 1118
16 Ga0070670_100100868 3300005331 Bacteria 2485
17 Ga0070670_100159078 3300005331 Bacteria 1957
18 Ga0070670_100357583 3300005331 Bacteria 1283
19 Ga0070670_100613142 3300005331 Bacteria 974
20 Ga0070670_100625558 3300005331 Bacteria 964
21 Ga0070670_101292590 3300005331 Bacteria 668
22 Ga0070670_101422798 3300005331 Bacteria 636
23 Ga0070677_10150116 3300005333 Bacteria 1083
24 Ga0070677_10172517 3300005333 Bacteria 1023
25 Ga0070677_10197403 3300005333 Bacteria 969
26 Ga0070677_10221326 3300005333 Bacteria 925
27 Ga0070677_10287452 3300005333 Bacteria 830
28 Ga0070677_10291610 3300005333 Bacteria 825
29 Ga0070677_10372079 3300005333 Bacteria 746
30 Ga0068869_100004453 3300005334 Bacteria 8710
31 Ga0068869_100036515 3300005334 Bacteria 3489
32 Ga0068869_100062005 3300005334 Bacteria 2743
33 Ga0070666_10034227 3300005335 Bacteria 3367
34 Ga0070666_10240692 3300005335 Bacteria 1279
35 Ga0070666_10362523 3300005335 Bacteria 1038
36 Ga0070666_10385977 3300005335 Bacteria 1006
37 Ga0070666_10430900 3300005335 Bacteria 951
38 Ga0068868_100006115 3300005338 Bacteria 8504
39 Ga0068868_100034499 3300005338 Bacteria 3906
40 Ga0068868_100035642 3300005338 Bacteria 3847
41 Ga0068868_100358444 3300005338 Bacteria 1250
42 Ga0068868_100435611 3300005338 Bacteria 1137
43 Ga0070689_100025176 3300005340 Bacteria 4469
44 Ga0070687_100027094 3300005343 Bacteria 2764
45 Ga0070687_100039147 3300005343 Bacteria 2380
46 Ga0070687_100676761 3300005343 Unclassified 718
47 Ga0070661_100386877 3300005344 Bacteria 1104
48 Ga0070661_100426780 3300005344 Bacteria 1051
49 Ga0070661_100454431 3300005344 Bacteria 1019
50 Ga0070692_10169412 3300005345 Bacteria 1258
51 Ga0070692_10224523 3300005345 Bacteria 1112
52 Ga0070668_100271138 3300005347 Bacteria 1414
53 Ga0070668_100283877 3300005347 Bacteria 1384
54 Ga0070668_100799404 3300005347 Bacteria 838
55 Ga0070668_100827747 3300005347 Bacteria 824
56 Ga0070669_100012472 3300005353 Bacteria 6030
57 Ga0070669_100138738 3300005353 Bacteria 1872
58 Ga0070669_100174789 3300005353 Bacteria 1676
59 Ga0070669_100190313 3300005353 Bacteria 1609
60 Ga0070669_100231939 3300005353 Bacteria 1463
61 Ga0070675_100008713 3300005354 Bacteria 7880
62 Ga0070675_100060893 3300005354 Bacteria 3116
63 Ga0070675_100101556 3300005354 Bacteria 2423
64 Ga0070675_100139921 3300005354 Bacteria 2068
65 Ga0070675_100596400 3300005354 Bacteria 1002
66 Ga0070675_100954899 3300005354 Bacteria 786
67 Ga0070675_101302324 3300005354 Bacteria 669
68 Ga0070671_100021946 3300005355 Bacteria 5215
69 Ga0070671_100042994 3300005355 Bacteria 3757
70 Ga0070671_100085391 3300005355 Bacteria 2640
71 Ga0070671_100220125 3300005355 Bacteria 1610
72 Ga0070671_100276584 3300005355 Bacteria 1427
73 Ga0070671_100392522 3300005355 Bacteria 1187
74 Ga0070671_100524201 3300005355 Bacteria 1020
75 Ga0070671_100780083 3300005355 Bacteria 831
76 Ga0070671_100871769 3300005355 Bacteria 786
77 Ga0070671_100997803 3300005355 Bacteria 733
78 Ga0070671_101042062 3300005355 Bacteria 718
79 Ga0070674_100056262 3300005356 Bacteria 2727
80 Ga0070674_100156781 3300005356 Bacteria 1723
81 Ga0070674_100306224 3300005356 Bacteria 1268
82 Ga0070674_100443849 3300005356 Bacteria 1069
83 Ga0070674_101087102 3300005356 Bacteria 706
84 Ga0070673_100060104 3300005364 Bacteria 3010
85 Ga0070673_100134498 3300005364 Bacteria 2079
86 Ga0070673_100366086 3300005364 Bacteria 1282
87 Ga0070673_100525797 3300005364 Bacteria 1072
88 Ga0070673_100843883 3300005364 Bacteria 847
89 Ga0070673_101615134 3300005364 Bacteria 613
90 Ga0070688_100036773 3300005365 Bacteria 2979
91 Ga0070688_100305280 3300005365 Bacteria 1152
92 Ga0070659_100014599 3300005366 Bacteria 5872
93 Ga0070659_100091361 3300005366 Bacteria 2440
94 Ga0070659_100514420 3300005366 Bacteria 1021
95 Ga0070659_100828745 3300005366 Bacteria 806
96 Ga0070659_101619918 3300005366 Bacteria 578
97 Ga0070667_100084214 3300005367 Bacteria 2725
98 Ga0070667_100137261 3300005367 Bacteria 2139
99 Ga0070667_100221961 3300005367 Bacteria 1682
100 Ga0070667_100270118 3300005367 Bacteria 1524
101 Ga0070667_100463716 3300005367 Bacteria 1158
102 Ga0070667_100540492 3300005367 Bacteria 1070
103 Ga0070701_10472566 3300005438 Bacteria 809
104 Ga0070700_100055061 3300005441 Bacteria 2489
105 Ga0070663_100265171 3300005455 Bacteria 1363
106 Ga0070663_100332829 3300005455 Bacteria 1224
107 Ga0070663_100467120 3300005455 Bacteria 1043
108 Ga0070663_100600619 3300005455 Bacteria 925
109 Ga0070663_100789133 3300005455 Bacteria 814
110 Ga0070678_100045257 3300005456 Bacteria 3147
111 Ga0070678_100185988 3300005456 Bacteria 1704
112 Ga0070678_100224966 3300005456 Bacteria 1561
113 Ga0070678_100261991 3300005456 Bacteria 1454
114 Ga0070678_100265898 3300005456 Bacteria 1444
115 Ga0070678_100651725 3300005456 Bacteria 945
116 Ga0070678_100748894 3300005456 Bacteria 884
117 Ga0070662_100077066 3300005457 Bacteria 2473
118 Ga0070662_100095042 3300005457 Bacteria 2245
119 Ga0070662_100111638 3300005457 Bacteria 2083
120 Ga0070662_100201217 3300005457 Bacteria 1580
121 Ga0070662_100258012 3300005457 Bacteria 1403
122 Ga0070662_100332491 3300005457 Bacteria 1241
123 Ga0070681_10407856 3300005458 Bacteria 1271
124 Ga0068867_100154967 3300005459 Bacteria 1802
125 Ga0068867_100164247 3300005459 Bacteria 1753
126 Ga0068867_100469782 3300005459 Bacteria 1075
127 Ga0068867_100501261 3300005459 Bacteria 1043
128 Ga0070679_100018116 3300005530 Bacteria 6827
129 Ga0070684_100329341 3300005535 Bacteria 1403
130 Ga0068853_100025981 3300005539 Bacteria 4914
131 Ga0068853_100375711 3300005539 Bacteria 1326
132 Ga0068853_100562837 3300005539 Bacteria 1080
133 Ga0068853_101737417 3300005539 Bacteria 605
134 Ga0070672_100019215 3300005543 Bacteria 4957
135 Ga0070672_100151391 3300005543 Bacteria 1919
136 Ga0070672_100162753 3300005543 Bacteria 1852
137 Ga0070672_100368232 3300005543 Bacteria 1227
138 Ga0070672_100392526 3300005543 Bacteria 1188
139 Ga0070672_100407933 3300005543 Bacteria 1165
140 Ga0070672_100410635 3300005543 Bacteria 1161
141 Ga0070672_100519436 3300005543 Bacteria 1031
142 Ga0070672_100556244 3300005543 Bacteria 996
143 Ga0070672_100780982 3300005543 Bacteria 839
144 Ga0070672_100982807 3300005543 Bacteria 747
145 Ga0070686_100487228 3300005544 Bacteria 954
146 Ga0070693_100414892 3300005547 Bacteria 937
147 Ga0070693_100572334 3300005547 Bacteria 812
148 Ga0070665_100450579 3300005548 Bacteria 1296
149 Ga0070665_101050102 3300005548 Bacteria 827
150 Ga0070664_100221074 3300005564 Bacteria 1694
151 Ga0070664_100322240 3300005564 Bacteria 1400
152 Ga0070664_100416873 3300005564 Bacteria 1229
153 Ga0070664_100619488 3300005564 Bacteria 1004
154 Ga0070664_100746116 3300005564 Bacteria 913
155 Ga0070664_101300995 3300005564 Bacteria 686
156 Ga0068857_100310103 3300005577 Bacteria 1456
157 Ga0068857_101811349 3300005577 Bacteria 597
158 Ga0068854_100092291 3300005578 Bacteria 2255
159 Ga0068854_100209866 3300005578 Bacteria 1535
160 Ga0068854_100220461 3300005578 Bacteria 1500
161 Ga0068854_100837041 3300005578 Bacteria 804
162 Ga0068854_100841414 3300005578 Bacteria 803
163 Ga0068856_100109147 3300005614 Bacteria 2763
164 Ga0068856_100488314 3300005614 Bacteria 1252
165 Ga0068852_100087270 3300005616 Bacteria 2783
166 Ga0068852_100241805 3300005616 Bacteria 1725
167 Ga0068852_100437550 3300005616 Bacteria 1292
168 Ga0068852_100483055 3300005616 Bacteria 1231
169 Ga0068852_100505034 3300005616 Bacteria 1204
170 Ga0068852_100519060 3300005616 Bacteria 1188
171 Ga0068852_100534896 3300005616 Bacteria 1171
172 Ga0068852_100551135 3300005616 Bacteria 1153
173 Ga0068852_100639422 3300005616 Bacteria 1071
174 Ga0068852_101012528 3300005616 Bacteria 849
175 Ga0068859_100046490 3300005617 Bacteria 4358
176 Ga0068859_100046661 3300005617 Bacteria 4350
177 Ga0068859_100128148 3300005617 Bacteria 2608
178 Ga0068864_100008513 3300005618 Bacteria 8464
179 Ga0068864_100042618 3300005618 Bacteria 3884
180 Ga0068864_100117127 3300005618 Bacteria 2378
181 Ga0068864_100195382 3300005618 Bacteria 1856
182 Ga0068864_100462729 3300005618 Bacteria 1215
183 Ga0068866_10057369 3300005718 Bacteria 2006
184 Ga0068861_100008192 3300005719 Bacteria 7189
185 Ga0068861_100102431 3300005719 Bacteria 2279
186 Ga0068861_100355542 3300005719 Bacteria 1286
187 Ga0068851_10008630 3300005834 Bacteria 4717
188 Ga0068851_10383273 3300005834 Bacteria 824
189 Ga0068851_10397274 3300005834 Bacteria 810
190 Ga0068851_10403541 3300005834 Bacteria 804
191 Ga0068851_10518706 3300005834 Bacteria 717
192 Ga0068863_100061334 3300005841 Bacteria 3555
193 Ga0068863_100069063 3300005841 Bacteria 3341
194 Ga0068863_100085823 3300005841 Bacteria 2982
195 Ga0068863_100165928 3300005841 Bacteria 2117
196 Ga0068863_100168585 3300005841 Bacteria 2100
197 Ga0068863_100252038 3300005841 Bacteria 1705
198 Ga0068863_100353955 3300005841 Bacteria 1430
199 Ga0068863_100775325 3300005841 Bacteria 955
200 Ga0068858_100005952 3300005842 Bacteria 11911
201 Ga0068858_100105771 3300005842 Bacteria 2626
202 Ga0068858_100397076 3300005842 Bacteria 1325
203 Ga0068860_100022009 3300005843 Bacteria 6170
204 Ga0068860_100087482 3300005843 Bacteria 2966
205 Ga0068860_100272354 3300005843 Bacteria 1653
206 Ga0068862_100116018 3300005844 Bacteria 2355
207 Ga0068862_100118221 3300005844 Bacteria 2333
208 Ga0075363_100126255 3300006048 Bacteria 1432
209 Ga0075366_10045719 3300006195 Bacteria 2594
210 Ga0075366_10136159 3300006195 Bacteria 1483
211 Ga0097621_100010025 3300006237 Bacteria 6908
212 Ga0097621_100568503 3300006237 Bacteria 1033
213 Ga0097621_100670663 3300006237 Bacteria 953
214 Ga0068871_100039869 3300006358 Bacteria 3760
215 Ga0068871_100372678 3300006358 Bacteria 1267
216 Ga0068871_101154342 3300006358 Bacteria 725
217 Ga0075434_100574350 3300006871 Bacteria 1147
218 Ga0068865_100208986 3300006881 Bacteria 1519
219 Ga0068865_100231255 3300006881 Bacteria 1450
220 Ga0068865_100319340 3300006881 Bacteria 1248
221 Ga0068865_100914975 3300006881 Bacteria 764
222 Ga0097620_100046492 3300006931 Bacteria 4358
223 Ga0097620_100046660 3300006931 Bacteria 4350
224 Ga0097620_100128145 3300006931 Bacteria 2608
225 Ga0075435_100302107 3300007076 Bacteria 1369
226 Ga0105245_10134775 3300009098 Bacteria 2320
227 Ga0105245_10407287 3300009098 Bacteria 1360
228 Ga0105245_10812633 3300009098 Bacteria 973
229 Ga0105245_11866858 3300009098 Bacteria 654
230 Ga0105243_10009603 3300009148 Bacteria 7366
231 Ga0105243_12119226 3300009148 Bacteria 598
232 Ga0105241_10315512 3300009174 Bacteria 1346
233 Ga0105242_10347058 3300009176 Bacteria 1370
234 Ga0105242_10468821 3300009176 Bacteria 1191
235 Ga0105248_10003806 3300009177 Bacteria 16730
236 Ga0105248_10156192 3300009177 Bacteria 2574
237 Ga0105248_10180720 3300009177 Bacteria 2377
238 Ga0105248_10360490 3300009177 Bacteria 1637
239 Ga0105248_10929467 3300009177 Bacteria 982
240 Ga0105248_10988850 3300009177 Bacteria 950
241 Ga0105248_11053735 3300009177 Bacteria 919
242 Ga0105248_11250951 3300009177 Bacteria 839
243 Ga0105238_10124534 3300009551 Bacteria 2557
244 Ga0105249_10221738 3300009553 Bacteria 1861
245 Ga0105249_10404720 3300009553 Bacteria 1396
246 Ga0105249_10524379 3300009553 Bacteria 1232
247 Ga0105249_11731400 3300009553 Bacteria 698
248 Ga0105249_12218246 3300009553 Bacteria 622
249 Ga0105239_10763950 3300010375 Bacteria 1106
250 Ga0157317_1017408 3300012475 Bacteria 613
251 Ga0157373_10397228 3300013100 Bacteria 988
252 Ga0157371_10195403 3300013102 Bacteria 1449
253 Ga0157371_10568395 3300013102 Bacteria 841
254 Ga0157370_10866823 3300013104 Bacteria 820
255 Ga0157369_10174272 3300013105 Bacteria 2265
256 Ga0157369_10672605 3300013105 Bacteria 1067
257 Ga0157374_10010808 3300013296 Bacteria 7874
258 Ga0157374_10065997 3300013296 Bacteria 3400
259 Ga0157374_10149788 3300013296 Bacteria 2268
260 Ga0157374_10394881 3300013296 Bacteria 1379
261 Ga0157374_10452832 3300013296 Bacteria 1285
262 Ga0157374_10687153 3300013296 Bacteria 1036
263 Ga0157378_10124371 3300013297 Bacteria 2381
264 Ga0157378_10531946 3300013297 Bacteria 1178
265 Ga0157378_10628021 3300013297 Bacteria 1088
266 Ga0157378_10776047 3300013297 Bacteria 983
267 Ga0157378_11554280 3300013297 Bacteria 707
268 Ga0163162_10099396 3300013306 Bacteria 3000
269 Ga0163162_10221484 3300013306 Bacteria 2022
270 Ga0163162_10464812 3300013306 Bacteria 1397
271 Ga0163162_10557901 3300013306 Bacteria 1273
272 Ga0163162_10617317 3300013306 Bacteria 1210
273 Ga0163162_10682541 3300013306 Bacteria 1149
274 Ga0157372_10068848 3300013307 Bacteria 3980
275 Ga0157372_10118440 3300013307 Bacteria 3038
276 Ga0157375_10306821 3300013308 Bacteria 1751
277 Ga0157375_10324709 3300013308 Bacteria 1704
278 Ga0157375_10337571 3300013308 Bacteria 1672
279 Ga0157375_10361564 3300013308 Bacteria 1617
280 Ga0157375_10364444 3300013308 Bacteria 1611
281 Ga0157375_10802730 3300013308 Bacteria 1090
282 Ga0157375_11176624 3300013308 Bacteria 899
283 Ga0157375_12249580 3300013308 Bacteria 650
284 Ga0163163_10022674 3300014325 Bacteria 5950
285 Ga0163163_10349562 3300014325 Bacteria 1534
286 Ga0163163_10491259 3300014325 Bacteria 1289
287 Ga0163163_12186685 3300014325 Bacteria 612
288 Ga0157380_10108530 3300014326 Bacteria 2327
289 Ga0157380_10140611 3300014326 Bacteria 2073
290 Ga0157380_10321559 3300014326 Bacteria 1434
291 Ga0157380_10585621 3300014326 Bacteria 1101
292 Ga0157380_10745207 3300014326 Bacteria 990
293 Ga0157377_10212426 3300014745 Bacteria 1234
294 Ga0157377_10415020 3300014745 Bacteria 920
295 Ga0157379_10019349 3300014968 Bacteria 6013
296 Ga0157379_10060136 3300014968 Bacteria 3396
297 Ga0157379_10308337 3300014968 Bacteria 1444
298 Ga0157379_10372082 3300014968 Bacteria 1310
299 Ga0157379_10401852 3300014968 Bacteria 1259
300 Ga0157379_10626722 3300014968 Bacteria 1005
301 Ga0157379_10693046 3300014968 Bacteria 956
302 Ga0157379_10894479 3300014968 Bacteria 842
303 Ga0157379_10926938 3300014968 Bacteria 827
304 Ga0157376_10013890 3300014969 Bacteria 6021
305 Ga0157376_10112776 3300014969 Bacteria 2396
306 Ga0157376_10360656 3300014969 Bacteria 1394
307 Ga0157376_10621474 3300014969 Bacteria 1077
308 Ga0157376_10682098 3300014969 Bacteria 1031
309 Ga0163161_10257019 3300017792 Bacteria 1363
310 Ga0163161_10280901 3300017792 Bacteria 1306
311 Ga0207425_1000402 3300025245 Bacteria 29179
312 Ga0209129_1000038 3300025258 Bacteria 322778
313 Ga0209129_1000115 3300025258 Bacteria 141048
314 Ga0209565_1034967 3300025263 Bacteria 961
315 Ga0209673_1016403 3300025273 Bacteria 2772
316 Ga0209673_1017722 3300025273 Bacteria 2617
317 Ga0209564_1000053 3300025295 Bacteria 351452
318 Ga0209758_1000231 3300025297 Bacteria 118366
319 Ga0209758_1000262 3300025297 Bacteria 104339
320 Ga0209050_1000749 3300025298 Bacteria 46744
321 Ga0209256_1018954 3300025299 Bacteria 2212
322 Ga0209257_1059939 3300025304 Bacteria 1037
323 Ga0207697_10055567 3300025315 Bacteria 1642
324 Ga0207697_10168761 3300025315 Bacteria 957
325 Ga0207656_10213067 3300025321 Bacteria 937
326 Ga0207656_10271451 3300025321 Bacteria 835
327 Ga0207656_10638820 3300025321 Bacteria 544
328 Ga0207682_10085464 3300025893 Bacteria 1359
329 Ga0207682_10088586 3300025893 Bacteria 1338
330 Ga0207682_10166094 3300025893 Bacteria 1002
331 Ga0207682_10175536 3300025893 Bacteria 977
332 Ga0207682_10467790 3300025893 Bacteria 597
333 Ga0207642_10010461 3300025899 Bacteria 3272
334 Ga0207642_10372752 3300025899 Bacteria 847
335 Ga0207688_10070334 3300025901 Bacteria 1984
336 Ga0207688_10407215 3300025901 Bacteria 844
337 Ga0207680_10164573 3300025903 Bacteria 1490
338 Ga0207680_10224245 3300025903 Bacteria 1290
339 Ga0207680_10231643 3300025903 Bacteria 1270
340 Ga0207680_10369396 3300025903 Bacteria 1010
341 Ga0207680_10390810 3300025903 Bacteria 982
342 Ga0207680_10998449 3300025903 Bacteria 599
343 Ga0207645_10032289 3300025907 Bacteria 3365
344 Ga0207645_10039326 3300025907 Bacteria 3031
345 Ga0207643_10625134 3300025908 Bacteria 694
346 Ga0207643_10866110 3300025908 Bacteria 586
347 Ga0207705_10362182 3300025909 Bacteria 1118
348 Ga0207705_10744881 3300025909 Bacteria 761
349 Ga0207705_10975466 3300025909 Bacteria 655
350 Ga0207654_10194055 3300025911 Bacteria 1333
351 Ga0207707_10367651 3300025912 Bacteria 1238
352 Ga0207660_10320815 3300025917 Bacteria 1237
353 Ga0207662_10013575 3300025918 Bacteria 4557
354 Ga0207657_10031393 3300025919 Bacteria 4812
355 Ga0207657_10362393 3300025919 Bacteria 1143
356 Ga0207657_10531809 3300025919 Bacteria 920
357 Ga0207649_10056443 3300025920 Bacteria 2452
358 Ga0207649_10076223 3300025920 Bacteria 2157
359 Ga0207649_10230017 3300025920 Bacteria 1325
360 Ga0207649_10337010 3300025920 Bacteria 1112
361 Ga0207652_10323259 3300025921 Bacteria 1393
362 Ga0207681_10085880 3300025923 Bacteria 2234
363 Ga0207681_10210475 3300025923 Bacteria 1498
364 Ga0207681_10213886 3300025923 Bacteria 1487
365 Ga0207681_10509441 3300025923 Bacteria 986
366 Ga0207694_10057610 3300025924 Bacteria 3021
367 Ga0207694_10197220 3300025924 Bacteria 1637
368 Ga0207650_10153117 3300025925 Bacteria 1821
369 Ga0207650_10165179 3300025925 Bacteria 1756
370 Ga0207650_10173382 3300025925 Bacteria 1715
371 Ga0207650_10206708 3300025925 Bacteria 1575
372 Ga0207650_10298725 3300025925 Bacteria 1315
373 Ga0207650_10320008 3300025925 Bacteria 1270
374 Ga0207650_11233115 3300025925 Bacteria 637
375 Ga0207650_11377245 3300025925 Bacteria 600
376 Ga0207659_10001184 3300025926 Bacteria 15574
377 Ga0207659_10017442 3300025926 Bacteria 4691
378 Ga0207659_10314899 3300025926 Bacteria 1289
379 Ga0207659_10365721 3300025926 Bacteria 1200
380 Ga0207687_10123170 3300025927 Bacteria 1942
381 Ga0207687_10737518 3300025927 Bacteria 838
382 Ga0207687_11085091 3300025927 Bacteria 687
383 Ga0207644_10033838 3300025931 Bacteria 3574
384 Ga0207644_10090306 3300025931 Bacteria 2282
385 Ga0207644_10146119 3300025931 Bacteria 1825
386 Ga0207644_10152269 3300025931 Bacteria 1790
387 Ga0207644_10457340 3300025931 Bacteria 1049
388 Ga0207644_10856011 3300025931 Bacteria 761
389 Ga0207644_10878026 3300025931 Bacteria 751
390 Ga0207690_10006553 3300025932 Bacteria 6904
391 Ga0207690_10347381 3300025932 Bacteria 1172
392 Ga0207690_10427903 3300025932 Bacteria 1060
393 Ga0207690_10630543 3300025932 Bacteria 877
394 Ga0207706_10058424 3300025933 Bacteria 3397
395 Ga0207706_10115533 3300025933 Bacteria 2360
396 Ga0207706_10162444 3300025933 Bacteria 1963
397 Ga0207706_10289546 3300025933 Bacteria 1428
398 Ga0207706_10358574 3300025933 Bacteria 1267
399 Ga0207706_10453051 3300025933 Bacteria 1110
400 Ga0207686_10151287 3300025934 Bacteria 1616
401 Ga0207686_10343006 3300025934 Bacteria 1122
402 Ga0207709_10014216 3300025935 Bacteria 4393
403 Ga0207670_10108360 3300025936 Bacteria 1997
404 Ga0207670_10455913 3300025936 Bacteria 1032
405 Ga0207669_10147999 3300025937 Bacteria 1640
406 Ga0207669_10889418 3300025937 Bacteria 743
407 Ga0207704_10110925 3300025938 Bacteria 1854
408 Ga0207704_10206645 3300025938 Bacteria 1442
409 Ga0207704_10228059 3300025938 Bacteria 1383
410 Ga0207704_10851434 3300025938 Bacteria 764
411 Ga0207691_10026430 3300025940 Bacteria 5445
412 Ga0207691_10135302 3300025940 Bacteria 2174
413 Ga0207691_10144273 3300025940 Bacteria 2097
414 Ga0207691_10201257 3300025940 Bacteria 1733
415 Ga0207691_10491893 3300025940 Bacteria 1042
416 Ga0207691_10496141 3300025940 Bacteria 1037
417 Ga0207691_11005356 3300025940 Bacteria 696
418 Ga0207711_10009175 3300025941 Bacteria 8264
419 Ga0207711_10097512 3300025941 Bacteria 2596
420 Ga0207711_10175735 3300025941 Bacteria 1945
421 Ga0207711_10388698 3300025941 Bacteria 1295
422 Ga0207689_10007959 3300025942 Bacteria 9259
423 Ga0207689_10010693 3300025942 Bacteria 7894
424 Ga0207689_10039273 3300025942 Bacteria 3919
425 Ga0207661_10032563 3300025944 Bacteria 4039
426 Ga0207661_10223906 3300025944 Bacteria 1663
427 Ga0207661_10322271 3300025944 Bacteria 1389
428 Ga0207679_10063223 3300025945 Bacteria 2762
429 Ga0207679_10377870 3300025945 Bacteria 1241
430 Ga0207679_10420467 3300025945 Bacteria 1179
431 Ga0207679_10566635 3300025945 Bacteria 1020
432 Ga0207679_10616724 3300025945 Bacteria 979
433 Ga0207679_11416382 3300025945 Bacteria 638
434 Ga0207651_10049625 3300025960 Bacteria 2844
435 Ga0207651_10058241 3300025960 Bacteria 2669
436 Ga0207651_10276106 3300025960 Bacteria 1386
437 Ga0207651_10886317 3300025960 Bacteria 794
438 Ga0207712_10072126 3300025961 Bacteria 2486
439 Ga0207712_10131049 3300025961 Bacteria 1911
440 Ga0207712_10924246 3300025961 Bacteria 772
441 Ga0207668_10092139 3300025972 Bacteria 2229
442 Ga0207668_10241355 3300025972 Bacteria 1462
443 Ga0207668_10585588 3300025972 Bacteria 970
444 Ga0207668_11137448 3300025972 Bacteria 700
445 Ga0207640_10208409 3300025981 Bacteria 1487
446 Ga0207640_10281141 3300025981 Bacteria 1307
447 Ga0207640_10779120 3300025981 Bacteria 827
448 Ga0207640_11587683 3300025981 Bacteria 589
449 Ga0207658_10002960 3300025986 Bacteria 12155
450 Ga0207658_10028681 3300025986 Bacteria 3922
451 Ga0207658_10205699 3300025986 Bacteria 1646
452 Ga0207658_10383587 3300025986 Bacteria 1231
453 Ga0207658_10652967 3300025986 Bacteria 948
454 Ga0207677_10003829 3300026023 Bacteria 8003
455 Ga0207677_10042735 3300026023 Bacteria 3007
456 Ga0207677_10103602 3300026023 Bacteria 2101
457 Ga0207677_10143703 3300026023 Bacteria 1830
458 Ga0207677_10353897 3300026023 Bacteria 1231
459 Ga0207677_10634122 3300026023 Bacteria 941
460 Ga0207677_11071486 3300026023 Bacteria 734
461 Ga0207703_10006681 3300026035 Bacteria 9204
462 Ga0207703_10024397 3300026035 Bacteria 4758
463 Ga0207703_10113968 3300026035 Bacteria 2311
464 Ga0207703_10513647 3300026035 Bacteria 1126
465 Ga0207703_10576685 3300026035 Bacteria 1063
466 Ga0207639_10054802 3300026041 Bacteria 3049
467 Ga0207639_10217116 3300026041 Bacteria 1650
468 Ga0207639_10678797 3300026041 Bacteria 954
469 Ga0207639_10688371 3300026041 Bacteria 948
470 Ga0207639_10797815 3300026041 Bacteria 880
471 Ga0207678_10387092 3300026067 Bacteria 1209
472 Ga0207678_10548417 3300026067 Bacteria 1011
473 Ga0207678_10590165 3300026067 Bacteria 973
474 Ga0207678_10709351 3300026067 Bacteria 886
475 Ga0207708_10049317 3300026075 Bacteria 3205
476 Ga0207702_10071621 3300026078 Bacteria 2985
477 Ga0207702_11340156 3300026078 Bacteria 710
478 Ga0207641_10029735 3300026088 Bacteria 4518
479 Ga0207641_10048367 3300026088 Bacteria 3589
480 Ga0207641_10049347 3300026088 Bacteria 3556
481 Ga0207641_10120405 3300026088 Bacteria 2341
482 Ga0207641_10131199 3300026088 Bacteria 2250
483 Ga0207641_10466452 3300026088 Bacteria 1222
484 Ga0207641_10617097 3300026088 Bacteria 1063
485 Ga0207641_11288107 3300026088 Bacteria 731
486 Ga0207641_11439997 3300026088 Bacteria 690
487 Ga0207648_10070511 3300026089 Bacteria 3047
488 Ga0207648_10692821 3300026089 Bacteria 944
489 Ga0207648_10746339 3300026089 Bacteria 909
490 Ga0207648_12027777 3300026089 Bacteria 537
491 Ga0207676_10006607 3300026095 Bacteria 8203
492 Ga0207676_10010648 3300026095 Bacteria 6558
493 Ga0207676_10100523 3300026095 Bacteria 2396
494 Ga0207676_10216938 3300026095 Bacteria 1701
495 Ga0207676_10275218 3300026095 Bacteria 1526
496 Ga0207676_10485697 3300026095 Bacteria 1170
497 Ga0207674_10021592 3300026116 Bacteria 6931
498 Ga0207674_10245699 3300026116 Bacteria 1737
499 Ga0207674_10317421 3300026116 Bacteria 1507
500 Ga0207675_100003070 3300026118 Bacteria 16380
501 Ga0207675_100011095 3300026118 Bacteria 8443
502 Ga0207675_100632566 3300026118 Bacteria 1075
503 Ga0207675_100657468 3300026118 Bacteria 1054
504 Ga0207683_10263745 3300026121 Bacteria 1573
505 Ga0207683_10311815 3300026121 Bacteria 1440
506 Ga0207683_10320785 3300026121 Bacteria 1419
507 Ga0207683_10326365 3300026121 Bacteria 1406
508 Ga0207683_10403192 3300026121 Bacteria 1258
509 Ga0207683_10428707 3300026121 Bacteria 1218
510 Ga0207698_10008884 3300026142 Bacteria 6372
511 Ga0207698_10378411 3300026142 Bacteria 1346
512 Ga0207698_10429369 3300026142 Bacteria 1270
513 Ga0207698_10516765 3300026142 Bacteria 1165
514 Ga0207698_10659080 3300026142 Bacteria 1038
515 Ga0207698_10801235 3300026142 Bacteria 944
516 Ga0207698_10827540 3300026142 Bacteria 930
517 Ga0207698_10879562 3300026142 Bacteria 902
518 Ga0207698_10884491 3300026142 Bacteria 900
519 Ga0207698_11181795 3300026142 Bacteria 779
520 Ga0268266_10083265 3300028379 Bacteria 2792
521 Ga0268265_10026258 3300028380 Bacteria 4142
522 Ga0268265_10054936 3300028380 Bacteria 3024
523 Ga0268265_10756961 3300028380 Bacteria 943
524 Ga0268265_11058860 3300028380 Bacteria 804
525 Ga0268265_11474194 3300028380 Bacteria 684
526 Ga0268264_10036915 3300028381 Bacteria 4027
527 Ga0268264_10408349 3300028381 Bacteria 1307
528 Ga0268264_10448648 3300028381 Bacteria 1249
529 Ga0268264_10538679 3300028381 Bacteria 1143
530 Ga0307517_10000058 3300028786 Bacteria 148725
531 Ga0307517_10151639 3300028786 Bacteria 1588
532 Ga0307517_10389377 3300028786 Bacteria 742
533 Ga0307515_10009947 3300028794 Bacteria 18308
534 Ga0307515_10071466 3300028794 Bacteria 4702
535 Ga0307515_10322123 3300028794 Bacteria 1211
536 Ga0307515_10458538 3300028794 Bacteria 889
537 Ga0307513_10026886 3300031456 Bacteria 6619
538 Ga0307513_10202997 3300031456 Bacteria 1821
539 Ga0307509_10000409 3300031507 Bacteria 72273
540 Ga0307509_10000930 3300031507 Bacteria 50124
541 Ga0307509_10023636 3300031507 Bacteria 6895
542 Ga0307509_10092906 3300031507 Bacteria 3082
543 Ga0307509_10305928 3300031507 Bacteria 1335
544 Ga0307508_10002424 3300031616 Bacteria 19668
545 Ga0307514_10111948 3300031649 Bacteria 1931
546 Ga0307516_10004401 3300031730 Bacteria 17410
547 Ga0307516_10261137 3300031730 Bacteria 1422
548 Ga0307405_10016161 3300031731 Bacteria 4063
549 Ga0307406_10274982 3300031901 Bacteria 1281
550 Ga0307412_10102127 3300031911 Bacteria 2030
551 Ga0307409_100004110 3300031995 Bacteria 8103
552 Ga0307416_100021482 3300032002 Bacteria 4635
553 Ga0307415_100123549 3300032126 Bacteria 1946
554 Ga0307507_10025288 3300033179 Bacteria 6444
555 Ga0307507_10381036 3300033179 Bacteria 812
556 Ga0307510_10010505 3300033180 Bacteria 10999
557 Ga0307510_10070854 3300033180 Bacteria 3477
558 Ga0373952_0078508 3300035092 Bacteria 838
559 Ga0373932_0143714 3300035112 Bacteria 813
560 Ga0373946_0142274 3300035171 Bacteria 1113
561 Ga0373955_0034414 3300035172 Bacteria 2676
562 Ga0373924_0126872 3300035410 Bacteria 1109
563 Ga0373931_0069175 3300035691 Bacteria 1923
564 Ga0373935_0174047 3300035692 Bacteria 1474
565 Ga0373935_0260981 3300035692 Bacteria 1215
566 Ga0373933_0141869 3300035724 Bacteria 1517
567 Ga0373947_0175071 3300035725 Bacteria 1394
568 Ga0373937_0107397 3300036401 Bacteria 2595
569 Ga0373925_0062597 3300037068 Bacteria 2798
570 Ga0451793_0782838 3300041452 Bacteria 573
571 Ga0451853_0269823 3300041512 Bacteria 1054
572 Ga0439464_0023975 3300042439 Bacteria 1686
573 Ga0451577_0377957 3300042876 Bacteria 1285
574 Ga0453684_0090676 3300044712 Bacteria 3776
575 Ga0453684_0953086 3300044712 Bacteria 916
576 Ga0451576_1089105 3300045051 Bacteria 836
577 Ga0495592_0002538 3300046454 Bacteria 12885
578 Ga0495580_0281229 3300046472 Bacteria 1135
579 Ga0495580_1093656 3300046472 Bacteria 504
580 Ga0495606_0512350 3300046507 Bacteria 604
581 Ga0495608_0250470 3300046511 Bacteria 1105
582 Ga0495628_0297090 3300046516 Bacteria 1196
583 Ga0495630_0216799 3300046517 Bacteria 1461
584 Ga0495648_0145580 3300046524 Bacteria 1242
585 Ga0495586_0225828 3300046535 Bacteria 1065
586 Ga0495586_0535448 3300046535 Bacteria 676
587 Ga0495621_0231154 3300046539 Bacteria 751
588 Ga0495645_0180609 3300046543 Bacteria 1446
589 Ga0495635_0311399 3300046663 Bacteria 1055
590 Ga0495635_0396798 3300046663 Bacteria 917
591 Ga0495646_0153603 3300046680 Bacteria 1279
592 Ga0495647_0058938 3300046681 Bacteria 1510
593 Ga0495658_0245295 3300046683 Bacteria 1125
594 Ga0495658_0639497 3300046683 Bacteria 681
595 Ga0495658_0931453 3300046683 Unclassified 555
596 Ga0495624_0329336 3300046690 Bacteria 919
597 Ga0495671_0164004 3300046692 Bacteria 1081
598 Ga0495674_0464221 3300047319 Bacteria 1016
599 Ga0495680_0164157 3300047322 Bacteria 1611
600 Ga0495684_0246539 3300047471 Bacteria 1301
601 Ga0495686_0003491 3300047472 Bacteria 13585
602 Ga0495686_0346368 3300047472 Bacteria 809
603 Ga0495593_0082569 3300047673 Bacteria 1661
604 Ga0496100_0371925 3300048903 Bacteria 1084
605 Ga0496101_0420531 3300048904 Bacteria 1053
606 Ga0496101_0478178 3300048904 Bacteria 984
607 Ga0496104_0549716 3300048907 Bacteria 1065
608 Ga0496104_0569352 3300048907 Bacteria 1043
609 Ga0496105_0368818 3300048908 Bacteria 1144
610 Ga0496106_0016340 3300048909 Bacteria 5491
611 Ga0496106_0660009 3300048909 Bacteria 835
612 Ga0496107_0291183 3300048910 Bacteria 1215
613 Ga0496108_0104354 3300048911 Bacteria 2419
614 Ga0496108_0235537 3300048911 Bacteria 1592
615 Ga0496108_0487809 3300048911 Bacteria 1076
616 Ga0496109_0099806 3300048912 Bacteria 2693
617 Ga0496109_0192370 3300048912 Bacteria 1917
618 Ga0496109_0277195 3300048912 Bacteria 1580
619 Ga0496110_0799187 3300048913 Bacteria 848
620 Ga0496111_0097069 3300048914 Bacteria 2163
621 Ga0496112_0003175 3300048915 Bacteria 13504
622 Ga0496112_0367565 3300048915 Bacteria 1380
623 Ga0496113_0246737 3300048916 Bacteria 1425
624 Ga0496113_0297279 3300048916 Bacteria 1292
625 Ga0496114_1034081 3300048917 Bacteria 705
626 Ga0496115_0031643 3300048918 Bacteria 4169
627 Ga0501034_0400115 3300049571 Bacteria 1296
628 Ga0501047_0521734 3300049581 Bacteria 1014
629 nmdc:mga03683_137562_c1 3300050489 Bacteria 1096
630 nmdc:mga03n38_426144_c1 3300050490 Bacteria 734
631 nmdc:mga0k408_70321_c1 3300050493 Bacteria 2043
632 nmdc:mga0k408_86229_c1 3300050493 Bacteria 1843
633 nmdc:mga0n895_568786_c1 3300050512 Bacteria 1138
634 Ga0495601_0667648 3300053077 Bacteria 664
635 Ga0500578_0000013 3300053086 Bacteria 185921
636 Ga0500644_0060164 3300053088 Bacteria 1335
637 Ga0500644_0212323 3300053088 Bacteria 804
638 Ga0500646_0043729 3300053090 Bacteria 1269
639 Ga0500583_0462664 3300053092 Bacteria 601
640 Ga0500651_0027401 3300053093 Bacteria 3583
641 Ga0500651_0050452 3300053093 Bacteria 2611
642 Ga0500651_0456348 3300053093 Bacteria 710
643 Ga0500562_022544 3300053108 Bacteria 1642
644 Ga0500594_0000958 3300053118 Bacteria 6211
645 Ga0500621_109155 3300053126 Bacteria 1083
646 Ga0500652_004372 3300053131 Bacteria 4370
647 Ga0500559_0000011 3300053136 Bacteria 164751
648 Ga0500564_110296 3300053138 Bacteria 1208
649 Ga0500568_0046192 3300053139 Bacteria 1729
650 Ga0500604_0053443 3300053151 Bacteria 1252
651 Ga0500619_069756 3300053154 Bacteria 1167
652 Ga0500622_0000374 3300053156 Bacteria 43119
653 Ga0500622_0000703 3300053156 Bacteria 29402
654 Ga0500636_0085845 3300053177 Bacteria 1808
655 Ga0500570_080781 3300053724 Bacteria 1466
656 Ga0500587_017390 3300053739 Bacteria 922
657 2587730865 2585428057 Bacteria 6737412
658 2587734298 2585428058 Bacteria 6853932
659 2588293695 2588253510 Bacteria 6901809
660 2643969134 2643221592 Bacteria 6608788
661 2644073644 2643221611 Bacteria 6820941
662 2644141150 2643221625 Bacteria 6512927
663 2644274447 2643221648 Bacteria 6521465
664 2644304640 2643221654 Bacteria 5273570
665 Ga0163163_10901570
666 JGI25152J39213_1000777
667 JGI25150J39212_1015697
668 JGI25153J46596_10000277
669 JGI25153J46596_10000961
670 Ga0055526_1008853
671 Ga0055530_10005586
672 Ga0065165_1001001
673 Ga0070658_10098144
674 Ga0070658_10162040
675 Ga0070676_10196303
676 Ga0070676_10208875
677 Ga0070683_100102007
678 Ga0070683_100265019
679 Ga0070690_100319337
680 Ga0070670_100100868
681 Ga0070670_100159078
682 Ga0070670_100357583
683 Ga0070670_100613142
684 Ga0070670_100625558
685 Ga0070670_101292590
686 Ga0070670_101422798
687 Ga0070677_10150116
688 Ga0070677_10172517
689 Ga0070677_10197403
690 Ga0070677_10221326
691 Ga0070677_10287452
692 Ga0070677_10291610
693 Ga0070677_10372079
694 Ga0068869_100004453
695 Ga0068869_100036515
696 Ga0068869_100062005
697 Ga0070666_10034227
698 Ga0070666_10240692
699 Ga0070666_10362523
700 Ga0070666_10385977
701 Ga0070666_10430900
702 Ga0068868_100006115
703 Ga0068868_100034499
704 Ga0068868_100035642
705 Ga0068868_100358444
706 Ga0068868_100435611
707 Ga0070689_100025176
708 Ga0070687_100027094
709 Ga0070687_100039147
710 Ga0070687_100676761
711 Ga0070661_100386877
712 Ga0070661_100426780
713 Ga0070661_100454431
714 Ga0070692_10169412
715 Ga0070692_10224523
716 Ga0070668_100271138
717 Ga0070668_100283877
718 Ga0070668_100799404
719 Ga0070668_100827747
720 Ga0070669_100012472
721 Ga0070669_100138738
722 Ga0070669_100174789
723 Ga0070669_100190313
724 Ga0070669_100231939
725 Ga0070675_100008713
726 Ga0070675_100060893
727 Ga0070675_100101556
728 Ga0070675_100139921
729 Ga0070675_100596400
730 Ga0070675_100954899
731 Ga0070675_101302324
732 Ga0070671_100021946
733 Ga0070671_100042994
734 Ga0070671_100085391
735 Ga0070671_100220125
736 Ga0070671_100276584
737 Ga0070671_100392522
738 Ga0070671_100524201
739 Ga0070671_100780083
740 Ga0070671_100871769
741 Ga0070671_100997803
742 Ga0070671_101042062
743 Ga0070674_100056262
744 Ga0070674_100156781
745 Ga0070674_100306224
746 Ga0070674_100443849
747 Ga0070674_101087102
748 Ga0070673_100060104
749 Ga0070673_100134498
750 Ga0070673_100366086
751 Ga0070673_100525797
752 Ga0070673_100843883
753 Ga0070673_101615134
754 Ga0070688_100036773
755 Ga0070688_100305280
756 Ga0070659_100014599
757 Ga0070659_100091361
758 Ga0070659_100514420
759 Ga0070659_100828745
760 Ga0070659_101619918
761 Ga0070667_100084214
762 Ga0070667_100137261
763 Ga0070667_100221961
764 Ga0070667_100270118
765 Ga0070667_100463716
766 Ga0070667_100540492
767 Ga0070701_10472566
768 Ga0070700_100055061
769 Ga0070663_100265171
770 Ga0070663_100332829
771 Ga0070663_100467120
772 Ga0070663_100600619
773 Ga0070663_100789133
774 Ga0070678_100045257
775 Ga0070678_100185988
776 Ga0070678_100224966
777 Ga0070678_100261991
778 Ga0070678_100265898
779 Ga0070678_100651725
780 Ga0070678_100748894
781 Ga0070662_100077066
782 Ga0070662_100095042
783 Ga0070662_100111638
784 Ga0070662_100201217
785 Ga0070662_100258012
786 Ga0070662_100332491
787 Ga0070681_10407856
788 Ga0068867_100154967
789 Ga0068867_100164247
790 Ga0068867_100469782
791 Ga0068867_100501261
792 Ga0070679_100018116
793 Ga0070684_100329341
794 Ga0068853_100025981
795 Ga0068853_100375711
796 Ga0068853_100562837
797 Ga0068853_101737417
798 Ga0070672_100019215
799 Ga0070672_100151391
800 Ga0070672_100162753
801 Ga0070672_100368232
802 Ga0070672_100392526
803 Ga0070672_100407933
804 Ga0070672_100410635
805 Ga0070672_100519436
806 Ga0070672_100556244
807 Ga0070672_100780982
808 Ga0070672_100982807
809 Ga0070686_100487228
810 Ga0070693_100414892
811 Ga0070693_100572334
812 Ga0070665_100450579
813 Ga0070665_101050102
814 Ga0070664_100221074
815 Ga0070664_100322240
816 Ga0070664_100416873
817 Ga0070664_100619488
818 Ga0070664_100746116
819 Ga0070664_101300995
820 Ga0068857_100310103
821 Ga0068857_101811349
822 Ga0068854_100092291
823 Ga0068854_100209866
824 Ga0068854_100220461
825 Ga0068854_100837041
826 Ga0068854_100841414
827 Ga0068856_100109147
828 Ga0068856_100488314
829 Ga0068852_100087270
830 Ga0068852_100241805
831 Ga0068852_100437550
832 Ga0068852_100483055
833 Ga0068852_100505034
834 Ga0068852_100519060
835 Ga0068852_100534896
836 Ga0068852_100551135
837 Ga0068852_100639422
838 Ga0068852_101012528
839 Ga0068859_100046490
840 Ga0068859_100046661
841 Ga0068859_100128148
842 Ga0068864_100008513
843 Ga0068864_100042618
844 Ga0068864_100117127
845 Ga0068864_100195382
846 Ga0068864_100462729
847 Ga0068866_10057369
848 Ga0068861_100008192
849 Ga0068861_100102431
850 Ga0068861_100355542
851 Ga0068851_10008630
852 Ga0068851_10383273
853 Ga0068851_10397274
854 Ga0068851_10403541
855 Ga0068851_10518706
856 Ga0068863_100061334
857 Ga0068863_100069063
858 Ga0068863_100085823
859 Ga0068863_100165928
860 Ga0068863_100168585
861 Ga0068863_100252038
862 Ga0068863_100353955
863 Ga0068863_100775325
864 Ga0068858_100005952
865 Ga0068858_100105771
866 Ga0068858_100397076
867 Ga0068860_100022009
868 Ga0068860_100087482
869 Ga0068860_100272354
870 Ga0068862_100116018
871 Ga0068862_100118221
872 Ga0075363_100126255
873 Ga0075366_10045719
874 Ga0075366_10136159
875 Ga0097621_100010025
876 Ga0097621_100568503
877 Ga0097621_100670663
878 Ga0068871_100039869
879 Ga0068871_100372678
880 Ga0068871_101154342
881 Ga0075434_100574350
882 Ga0068865_100208986
883 Ga0068865_100231255
884 Ga0068865_100319340
885 Ga0068865_100914975
886 Ga0097620_100046492
887 Ga0097620_100046660
888 Ga0097620_100128145
889 Ga0075435_100302107
890 Ga0105245_10134775
891 Ga0105245_10407287
892 Ga0105245_10812633
893 Ga0105245_11866858
894 Ga0105243_10009603
895 Ga0105243_12119226
896 Ga0105241_10315512
897 Ga0105242_10347058
898 Ga0105242_10468821
899 Ga0105248_10003806
900 Ga0105248_10156192
901 Ga0105248_10180720
902 Ga0105248_10360490
903 Ga0105248_10929467
904 Ga0105248_10988850
905 Ga0105248_11053735
906 Ga0105248_11250951
907 Ga0105238_10124534
908 Ga0105249_10221738
909 Ga0105249_10404720
910 Ga0105249_10524379
911 Ga0105249_11731400
912 Ga0105249_12218246
913 Ga0105239_10763950
914 Ga0157317_1017408
915 Ga0157373_10397228
916 Ga0157371_10195403
917 Ga0157371_10568395
918 Ga0157370_10866823
919 Ga0157369_10174272
920 Ga0157369_10672605
921 Ga0157374_10010808
922 Ga0157374_10065997
923 Ga0157374_10149788
924 Ga0157374_10394881
925 Ga0157374_10452832
926 Ga0157374_10687153
927 Ga0157378_10124371
928 Ga0157378_10531946
929 Ga0157378_10628021
930 Ga0157378_10776047
931 Ga0157378_11554280
932 Ga0163162_10099396
933 Ga0163162_10221484
934 Ga0163162_10464812
935 Ga0163162_10557901
936 Ga0163162_10617317
937 Ga0163162_10682541
938 Ga0157372_10068848
939 Ga0157372_10118440
940 Ga0157375_10306821
941 Ga0157375_10324709
942 Ga0157375_10337571
943 Ga0157375_10361564
944 Ga0157375_10364444
945 Ga0157375_10802730
946 Ga0157375_11176624
947 Ga0157375_12249580
948 Ga0163163_10022674
949 Ga0163163_10349562
950 Ga0163163_10491259
951 Ga0163163_12186685
952 Ga0157380_10108530
953 Ga0157380_10140611
954 Ga0157380_10321559
955 Ga0157380_10585621
956 Ga0157380_10745207
957 Ga0157377_10212426
958 Ga0157377_10415020
959 Ga0157379_10019349
960 Ga0157379_10060136
961 Ga0157379_10308337
962 Ga0157379_10372082
963 Ga0157379_10401852
964 Ga0157379_10626722
965 Ga0157379_10693046
966 Ga0157379_10894479
967 Ga0157379_10926938
968 Ga0157376_10013890
969 Ga0157376_10112776
970 Ga0157376_10360656
971 Ga0157376_10621474
972 Ga0157376_10682098
973 Ga0163161_10257019
974 Ga0163161_10280901
975 Ga0207425_1000402
976 Ga0209129_1000038
977 Ga0209129_1000115
978 Ga0209565_1034967
979 Ga0209673_1016403
980 Ga0209673_1017722
981 Ga0209564_1000053
982 Ga0209758_1000231
983 Ga0209758_1000262
984 Ga0209050_1000749
985 Ga0209256_1018954
986 Ga0209257_1059939
987 Ga0207697_10055567
988 Ga0207697_10168761
989 Ga0207656_10213067
990 Ga0207656_10271451
991 Ga0207656_10638820
992 Ga0207682_10085464
993 Ga0207682_10088586
994 Ga0207682_10166094
995 Ga0207682_10175536
996 Ga0207682_10467790
997 Ga0207642_10010461
998 Ga0207642_10372752
999 Ga0207688_10070334
1000 Ga0207688_10407215
1001 Ga0207680_10164573
1002 Ga0207680_10224245
1003 Ga0207680_10231643
1004 Ga0207680_10369396
1005 Ga0207680_10390810
1006 Ga0207680_10998449
1007 Ga0207645_10032289
1008 Ga0207645_10039326
1009 Ga0207643_10625134
1010 Ga0207643_10866110
1011 Ga0207705_10362182
1012 Ga0207705_10744881
1013 Ga0207705_10975466
1014 Ga0207654_10194055
1015 Ga0207707_10367651
1016 Ga0207660_10320815
1017 Ga0207662_10013575
1018 Ga0207657_10031393
1019 Ga0207657_10362393
1020 Ga0207657_10531809
1021 Ga0207649_10056443
1022 Ga0207649_10076223
1023 Ga0207649_10230017
1024 Ga0207649_10337010
1025 Ga0207652_10323259
1026 Ga0207681_10085880
1027 Ga0207681_10210475
1028 Ga0207681_10213886
1029 Ga0207681_10509441
1030 Ga0207694_10057610
1031 Ga0207694_10197220
1032 Ga0207650_10153117
1033 Ga0207650_10165179
1034 Ga0207650_10173382
1035 Ga0207650_10206708
1036 Ga0207650_10298725
1037 Ga0207650_10320008
1038 Ga0207650_11233115
1039 Ga0207650_11377245
1040 Ga0207659_10001184
1041 Ga0207659_10017442
1042 Ga0207659_10314899
1043 Ga0207659_10365721
1044 Ga0207687_10123170
1045 Ga0207687_10737518
1046 Ga0207687_11085091
1047 Ga0207644_10033838
1048 Ga0207644_10090306
1049 Ga0207644_10146119
1050 Ga0207644_10152269
1051 Ga0207644_10457340
1052 Ga0207644_10856011
1053 Ga0207644_10878026
1054 Ga0207690_10006553
1055 Ga0207690_10347381
1056 Ga0207690_10427903
1057 Ga0207690_10630543
1058 Ga0207706_10058424
1059 Ga0207706_10115533
1060 Ga0207706_10162444
1061 Ga0207706_10289546
1062 Ga0207706_10358574
1063 Ga0207706_10453051
1064 Ga0207686_10151287
1065 Ga0207686_10343006
1066 Ga0207709_10014216
1067 Ga0207670_10108360
1068 Ga0207670_10455913
1069 Ga0207669_10147999
1070 Ga0207669_10889418
1071 Ga0207704_10110925
1072 Ga0207704_10206645
1073 Ga0207704_10228059
1074 Ga0207704_10851434
1075 Ga0207691_10026430
1076 Ga0207691_10135302
1077 Ga0207691_10144273
1078 Ga0207691_10201257
1079 Ga0207691_10491893
1080 Ga0207691_10496141
1081 Ga0207691_11005356
1082 Ga0207711_10009175
1083 Ga0207711_10097512
1084 Ga0207711_10175735
1085 Ga0207711_10388698
1086 Ga0207689_10007959
1087 Ga0207689_10010693
1088 Ga0207689_10039273
1089 Ga0207661_10032563
1090 Ga0207661_10223906
1091 Ga0207661_10322271
1092 Ga0207679_10063223
1093 Ga0207679_10377870
1094 Ga0207679_10420467
1095 Ga0207679_10566635
1096 Ga0207679_10616724
1097 Ga0207679_11416382
1098 Ga0207651_10049625
1099 Ga0207651_10058241
1100 Ga0207651_10276106
1101 Ga0207651_10886317
1102 Ga0207712_10072126
1103 Ga0207712_10131049
1104 Ga0207712_10924246
1105 Ga0207668_10092139
1106 Ga0207668_10241355
1107 Ga0207668_10585588
1108 Ga0207668_11137448
1109 Ga0207640_10208409
1110 Ga0207640_10281141
1111 Ga0207640_10779120
1112 Ga0207640_11587683
1113 Ga0207658_10002960
1114 Ga0207658_10028681
1115 Ga0207658_10205699
1116 Ga0207658_10383587
1117 Ga0207658_10652967
1118 Ga0207677_10003829
1119 Ga0207677_10042735
1120 Ga0207677_10103602
1121 Ga0207677_10143703
1122 Ga0207677_10353897
1123 Ga0207677_10634122
1124 Ga0207677_11071486
1125 Ga0207703_10006681
1126 Ga0207703_10024397
1127 Ga0207703_10113968
1128 Ga0207703_10513647
1129 Ga0207703_10576685
1130 Ga0207639_10054802
1131 Ga0207639_10217116
1132 Ga0207639_10678797
1133 Ga0207639_10688371
1134 Ga0207639_10797815
1135 Ga0207678_10387092
1136 Ga0207678_10548417
1137 Ga0207678_10590165
1138 Ga0207678_10709351
1139 Ga0207708_10049317
1140 Ga0207702_10071621
1141 Ga0207702_11340156
1142 Ga0207641_10029735
1143 Ga0207641_10048367
1144 Ga0207641_10049347
1145 Ga0207641_10120405
1146 Ga0207641_10131199
1147 Ga0207641_10466452
1148 Ga0207641_10617097
1149 Ga0207641_11288107
1150 Ga0207641_11439997
1151 Ga0207648_10070511
1152 Ga0207648_10692821
1153 Ga0207648_10746339
1154 Ga0207648_12027777
1155 Ga0207676_10006607
1156 Ga0207676_10010648
1157 Ga0207676_10100523
1158 Ga0207676_10216938
1159 Ga0207676_10275218
1160 Ga0207676_10485697
1161 Ga0207674_10021592
1162 Ga0207674_10245699
1163 Ga0207674_10317421
1164 Ga0207675_100003070
1165 Ga0207675_100011095
1166 Ga0207675_100632566
1167 Ga0207675_100657468
1168 Ga0207683_10263745
1169 Ga0207683_10311815
1170 Ga0207683_10320785
1171 Ga0207683_10326365
1172 Ga0207683_10403192
1173 Ga0207683_10428707
1174 Ga0207698_10008884
1175 Ga0207698_10378411
1176 Ga0207698_10429369
1177 Ga0207698_10516765
1178 Ga0207698_10659080
1179 Ga0207698_10801235
1180 Ga0207698_10827540
1181 Ga0207698_10879562
1182 Ga0207698_10884491
1183 Ga0207698_11181795
1184 Ga0268266_10083265
1185 Ga0268265_10026258
1186 Ga0268265_10054936
1187 Ga0268265_10756961
1188 Ga0268265_11058860
1189 Ga0268265_11474194
1190 Ga0268264_10036915
1191 Ga0268264_10408349
1192 Ga0268264_10448648
1193 Ga0268264_10538679
1194 Ga0307517_10000058
1195 Ga0307517_10151639
1196 Ga0307517_10389377
1197 Ga0307515_10009947
1198 Ga0307515_10071466
1199 Ga0307515_10322123
1200 Ga0307515_10458538
1201 Ga0307513_10026886
1202 Ga0307513_10202997
1203 Ga0307509_10000409
1204 Ga0307509_10000930
1205 Ga0307509_10023636
1206 Ga0307509_10092906
1207 Ga0307509_10305928
1208 Ga0307508_10002424
1209 Ga0307514_10111948
1210 Ga0307516_10004401
1211 Ga0307516_10261137
1212 Ga0307405_10016161
1213 Ga0307406_10274982
1214 Ga0307412_10102127
1215 Ga0307409_100004110
1216 Ga0307416_100021482
1217 Ga0307415_100123549
1218 Ga0307507_10025288
1219 Ga0307507_10381036
1220 Ga0307510_10010505
1221 Ga0307510_10070854
1222 Ga0373952_0078508
1223 Ga0373932_0143714
1224 Ga0373946_0142274
1225 Ga0373955_0034414
1226 Ga0373924_0126872
1227 Ga0373931_0069175
1228 Ga0373935_0174047
1229 Ga0373935_0260981
1230 Ga0373933_0141869
1231 Ga0373947_0175071
1232 Ga0373937_0107397
1233 Ga0373925_0062597
1234 Ga0451793_0782838
1235 Ga0451853_0269823
1236 Ga0439464_0023975
1237 Ga0451577_0377957
1238 Ga0453684_0090676
1239 Ga0453684_0953086
1240 Ga0451576_1089105
1241 Ga0495592_0002538
1242 Ga0495580_0281229
1243 Ga0495580_1093656
1244 Ga0495606_0512350
1245 Ga0495608_0250470
1246 Ga0495628_0297090
1247 Ga0495630_0216799
1248 Ga0495648_0145580
1249 Ga0495586_0225828
1250 Ga0495586_0535448
1251 Ga0495621_0231154
1252 Ga0495645_0180609
1253 Ga0495635_0311399
1254 Ga0495635_0396798
1255 Ga0495646_0153603
1256 Ga0495647_0058938
1257 Ga0495658_0245295
1258 Ga0495658_0639497
1259 Ga0495658_0931453
1260 Ga0495624_0329336
1261 Ga0495671_0164004
1262 Ga0495674_0464221
1263 Ga0495680_0164157
1264 Ga0495684_0246539
1265 Ga0495686_0003491
1266 Ga0495686_0346368
1267 Ga0495593_0082569
1268 Ga0496100_0371925
1269 Ga0496101_0420531
1270 Ga0496101_0478178
1271 Ga0496104_0549716
1272 Ga0496104_0569352
1273 Ga0496105_0368818
1274 Ga0496106_0016340
1275 Ga0496106_0660009
1276 Ga0496107_0291183
1277 Ga0496108_0104354
1278 Ga0496108_0235537
1279 Ga0496108_0487809
1280 Ga0496109_0099806
1281 Ga0496109_0192370
1282 Ga0496109_0277195
1283 Ga0496110_0799187
1284 Ga0496111_0097069
1285 Ga0496112_0003175
1286 Ga0496112_0367565
1287 Ga0496113_0246737
1288 Ga0496113_0297279
1289 Ga0496114_1034081
1290 Ga0496115_0031643
1291 Ga0501034_0400115
1292 Ga0501047_0521734
1293 nmdc:mga03683_137562_c1
1294 nmdc:mga03n38_426144_c1
1295 nmdc:mga0k408_70321_c1
1296 nmdc:mga0k408_86229_c1
1297 nmdc:mga0n895_568786_c1
1298 Ga0495601_0667648
1299 Ga0500578_0000013
1300 Ga0500644_0060164
1301 Ga0500644_0212323
1302 Ga0500646_0043729
1303 Ga0500583_0462664
1304 Ga0500651_0027401
1305 Ga0500651_0050452
1306 Ga0500651_0456348
1307 Ga0500562_022544
1308 Ga0500594_0000958
1309 Ga0500621_109155
1310 Ga0500652_004372
1311 Ga0500559_0000011
1312 Ga0500564_110296
1313 Ga0500568_0046192
1314 Ga0500604_0053443
1315 Ga0500619_069756
1316 Ga0500622_0000374
1317 Ga0500622_0000703
1318 Ga0500636_0085845
1319 Ga0500570_080781
1320 Ga0500587_017390
1321 2587730865
1322 2587734298
1323 2588293695
1324 2643969134
1325 2644073644
1326 2644141150
1327 2644274447
1328 2644304640

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01957

NfeD

NfeD-like C-terminal, partner-binding

68

158

0.75

Structural Annotation

Top 5 Hits

ID Description Score Start End
4n08-assembly1.cif.gz_A structure of trypanosoma brucei brucei adenosine kinase (apo) 0.9087 29 62
1un8-assembly1.cif.gz_B crystal structure of the dihydroxyacetone kinase of c. freundii (native form) 0.81 4 64
1un9-assembly1.cif.gz_B crystal structure of the dihydroxyacetone kinase from c. freundii in complex with amp-pnp and mg2+ 0.8088 4 64
3wwv-assembly1.cif.gz_A-2 c-terminal domain of stomatin operon partner protein 1510-c from pyrococcus horikoshii 0.7725 87 142
3cp0-assembly1.cif.gz_A crystal structure of the soluble domain of membrane protein implicated in regulation of membrane protease activity from corynebacterium glutamicum 0.7401 87 141
ID Description Score Start End Superfamily
af_P0AAS3_1_89_1.10.287.70 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.8684 4 75 1.10.287.70
af_P37349_1_132_3.40.50.510 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphotransferase system, mannose-type IIA component 0.8595 32 62 3.40.50.510
af_Q04013_4_135_1.50.40.10 Mainly Alpha;Alpha/alpha barrel;Mitochondrial carrier fold;Mitochondrial carrier domain 0.8361 25 65 1.50.40.10
1un8B02 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;DhaL domain 0.81 4 64 1.25.40.340
af_P0AAS3_95_152_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.8019 89 145 2.40.50.140
ID Description Score Start End GO Terms
AF-A0A847VNQ6-F1-model_v4 NfeD family protein 0.8691 76 147
AF-A0A4Q4AGD7-F1-model_v4 deleted 0.8209 78 144
AF-A0A660NGV4-F1-model_v4 NfeD-like C-terminal domain-containing protein 0.8185 76 143
AF-A0A0N0JU26-F1-model_v4 NfeD-like C-terminal domain-containing protein 0.7908 3 145 GO:0016020
AF-A0A0Q4Y0Y1-F1-model_v4 NfeD-like C-terminal domain-containing protein 0.7865 3 144 GO:0016020

Map