F473569

General Info

Members Datasets Scaffolds Average Seq Length
663 254 1326 244

Family's Representative Sequence

Representative Sequence 3300037068|Ga0373925_0378179|Ga0373925_0378179_62_949
Length 295
Sequence MTLAVYALRPILEISPIQKQPKARTMVYNCAQRSKSWIKSMLPFPKRGGFCMKQRRPKSMSLFCVTVVSAMFAPQPVLAELLEKTNKVGGTTVHYKIVLPSGFDPAKTYPAILAFGGGPQTMNTVDSVLNRNLRAEAEKRGYIVIAPAAPDDQLFFAEGAHIFPEFLKMIQAEYKIQDNKFHIAGPSNGGIAAFHVAAANPQYFLSVTAFPGYMWEPSTAKLQAISKMCVFMYVGENDPYMWHAEMKKEAEWLRSQGTVAHYTVEKGQPHRMETLTGANAGRLFDGFEETKKGCK

Samples

Sample ID Description Type Environment
1 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
20 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
31 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
32 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
33 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
34 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
35 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
36 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
37 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
38 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
39 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
40 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
41 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
42 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
43 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
44 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
45 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
46 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
47 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
48 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
49 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
50 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
51 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
52 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
53 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
54 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
55 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
56 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
57 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
58 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
59 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
60 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
61 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
62 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
63 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
64 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
65 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
66 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
67 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
68 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
69 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
70 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
71 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
72 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
73 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
74 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
75 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
76 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
77 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
78 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
79 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
81 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
82 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
83 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
84 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
85 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
86 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
87 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
88 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
89 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
90 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
91 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
92 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
93 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
94 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
95 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
96 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
97 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
98 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
99 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
100 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
101 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
102 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
103 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
104 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
105 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
106 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
107 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
108 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
109 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
110 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
111 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
112 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
113 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
114 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
115 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
116 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
117 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
118 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
119 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
179 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
180 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
184 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
185 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
186 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
187 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
188 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
189 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
190 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
191 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
192 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
193 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
194 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
195 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
196 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
197 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
198 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
199 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
200 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
201 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
202 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
203 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
204 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
205 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
206 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
207 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
208 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
209 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
210 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
211 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
212 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
213 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
214 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
215 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
216 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
217 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
218 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
219 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
220 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
221 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
222 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
223 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
224 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
225 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
226 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
227 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
228 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
229 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
230 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
231 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
232 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
233 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
234 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
235 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
236 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
237 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
238 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
239 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
240 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
241 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
242 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
243 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
244 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
245 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
246 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
247 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
248 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
249 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
250 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
251 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
252 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
253 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
254 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.15
Nodule 0
Rhizoplane 0.9
Rhizosphere 98.94
Stem 0
Stem Tuber 0
Unclassified 25.94

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373925_0378179 3300037068 Bacteria 1153
2 SwRhRL2b_contig_3891972 2162886007 Bacteria 1807
3 Ga0065704_10078276 3300005289 Bacteria 4470
4 Ga0065712_10067795 3300005290 Bacteria 33443
5 Ga0065715_10092882 3300005293 Bacteria 4884
6 Ga0065715_10135579 3300005293 Unclassified 1936
7 Ga0065715_10196188 3300005293 Bacteria 1386
8 Ga0065715_10373240 3300005293 Unclassified 894
9 Ga0065707_10087693 3300005295 Bacteria 4925
10 Ga0065707_10133858 3300005295 Bacteria 1874
11 Ga0065707_10143729 3300005295 Bacteria 1739
12 Ga0065707_10227917 3300005295 Bacteria 1199
13 Ga0070676_10110516 3300005328 Unclassified 1711
14 Ga0070676_10122443 3300005328 Bacteria 1634
15 Ga0070676_10209572 3300005328 Bacteria 1282
16 Ga0070683_100002476 3300005329 Bacteria 14690
17 Ga0070683_100011039 3300005329 Bacteria 7786
18 Ga0070683_100046045 3300005329 Bacteria 4028
19 Ga0070683_100103019 3300005329 Bacteria 2689
20 Ga0070683_100175931 3300005329 Unclassified 2031
21 Ga0070683_100350879 3300005329 Bacteria 1405
22 Ga0070690_100032958 3300005330 Bacteria 3239
23 Ga0070690_100084143 3300005330 Unclassified 2085
24 Ga0070670_100024879 3300005331 Bacteria 5151
25 Ga0070677_10049851 3300005333 Unclassified 1688
26 Ga0070677_10060727 3300005333 Unclassified 1558
27 Ga0068869_100025000 3300005334 Bacteria 4142
28 Ga0068869_100084768 3300005334 Bacteria 2372
29 Ga0068869_100285591 3300005334 Bacteria 1328
30 Ga0070666_10041191 3300005335 Bacteria 3085
31 Ga0070666_10074407 3300005335 Bacteria 2315
32 Ga0070680_100083871 3300005336 Unclassified 2632
33 Ga0070680_100149293 3300005336 Bacteria 1962
34 Ga0070680_100374718 3300005336 Bacteria 1211
35 Ga0070682_100058421 3300005337 Bacteria 2432
36 Ga0068868_100013507 3300005338 Bacteria 5988
37 Ga0068868_100023374 3300005338 Bacteria 4678
38 Ga0068868_100082600 3300005338 Bacteria 2577
39 Ga0068868_100099687 3300005338 Bacteria 2350
40 Ga0068868_100192847 3300005338 Bacteria 1695
41 Ga0068868_100387900 3300005338 Bacteria 1203
42 Ga0070660_100089315 3300005339 Bacteria 2428
43 Ga0070689_100003003 3300005340 Bacteria 11097
44 Ga0070691_10001714 3300005341 Bacteria 9500
45 Ga0070687_100055684 3300005343 Bacteria 2066
46 Ga0070661_100029633 3300005344 Bacteria 3951
47 Ga0070668_100229455 3300005347 Unclassified 1534
48 Ga0070669_100004016 3300005353 Bacteria 10639
49 Ga0070669_100008142 3300005353 Bacteria 7488
50 Ga0070675_100003632 3300005354 Bacteria 11731
51 Ga0070675_100005942 3300005354 Bacteria 9351
52 Ga0070675_100014592 3300005354 Bacteria 6195
53 Ga0070675_100019982 3300005354 Bacteria 5344
54 Ga0070675_100225421 3300005354 Bacteria 1633
55 Ga0070675_100358035 3300005354 Bacteria 1295
56 Ga0070671_100010149 3300005355 Bacteria 7564
57 Ga0070671_100028898 3300005355 Bacteria 4569
58 Ga0070674_100004234 3300005356 Bacteria 8156
59 Ga0070674_100050501 3300005356 Bacteria 2863
60 Ga0070674_100601652 3300005356 Unclassified 929
61 Ga0070673_100010484 3300005364 Bacteria 6275
62 Ga0070673_100035890 3300005364 Unclassified 3764
63 Ga0070673_100044698 3300005364 Unclassified 3431
64 Ga0070673_100138099 3300005364 Bacteria 2054
65 Ga0070688_100003719 3300005365 Bacteria 7892
66 Ga0070688_100051458 3300005365 Bacteria 2570
67 Ga0070688_100056892 3300005365 Bacteria 2457
68 Ga0070667_100050380 3300005367 Unclassified 3509
69 Ga0070667_100081343 3300005367 Bacteria 2772
70 Ga0070667_100552863 3300005367 Bacteria 1058
71 Ga0070714_100005312 3300005435 Bacteria 9819
72 Ga0070714_100121932 3300005435 Bacteria 2320
73 Ga0070713_100012216 3300005436 Bacteria 6290
74 Ga0070713_100016384 3300005436 Bacteria 5573
75 Ga0070713_100080363 3300005436 Bacteria 2780
76 Ga0070713_100474522 3300005436 Bacteria 1178
77 Ga0070713_100633165 3300005436 Unclassified 1018
78 Ga0070710_10241085 3300005437 Bacteria 1158
79 Ga0070710_10304600 3300005437 Unclassified 1041
80 Ga0070701_10002192 3300005438 Bacteria 7452
81 Ga0070701_10020279 3300005438 Unclassified 3154
82 Ga0070705_100057765 3300005440 Bacteria 2290
83 Ga0070705_100165953 3300005440 Unclassified 1481
84 Ga0070700_100004859 3300005441 Bacteria 7061
85 Ga0070700_100031095 3300005441 Bacteria 3196
86 Ga0070700_100036250 3300005441 Unclassified 2990
87 Ga0070694_100016173 3300005444 Bacteria 4695
88 Ga0070694_100232314 3300005444 Bacteria 1388
89 Ga0070708_100322209 3300005445 Bacteria 1456
90 Ga0070708_100513655 3300005445 Unclassified 1130
91 Ga0070678_100069400 3300005456 Bacteria 2631
92 Ga0070662_100006520 3300005457 Bacteria 7527
93 Ga0070662_100042219 3300005457 Bacteria 3257
94 Ga0070681_10032033 3300005458 Bacteria 5277
95 Ga0070681_10067889 3300005458 Bacteria 3533
96 Ga0070681_10093031 3300005458 Unclassified 2963
97 Ga0070681_10302573 3300005458 Bacteria 1509
98 Ga0068867_100044969 3300005459 Unclassified 3236
99 Ga0068867_100063372 3300005459 Bacteria 2747
100 Ga0068867_100112540 3300005459 Unclassified 2093
101 Ga0068867_100205132 3300005459 Bacteria 1580
102 Ga0068867_100351410 3300005459 Archaea 1230
103 Ga0070685_10019934 3300005466 Bacteria 3625
104 Ga0070707_100001353 3300005468 Bacteria 24080
105 Ga0070707_100050556 3300005468 Bacteria 3984
106 Ga0070698_100565752 3300005471 Bacteria 1076
107 Ga0070699_100003817 3300005518 Bacteria 13317
108 Ga0070699_100033494 3300005518 Bacteria 4439
109 Ga0070699_100054052 3300005518 Bacteria 3476
110 Ga0070699_100637995 3300005518 Unclassified 972
111 Ga0070679_100031324 3300005530 Bacteria 5253
112 Ga0070679_100153966 3300005530 Bacteria 2275
113 Ga0070679_100551146 3300005530 Unclassified 1097
114 Ga0070684_100016589 3300005535 Bacteria 6022
115 Ga0070684_100036298 3300005535 Bacteria 4223
116 Ga0070684_100083856 3300005535 Bacteria 2825
117 Ga0070684_100148370 3300005535 Unclassified 2123
118 Ga0070684_100169016 3300005535 Unclassified 1986
119 Ga0070684_100190463 3300005535 Bacteria 1866
120 Ga0070684_100432629 3300005535 Bacteria 1215
121 Ga0070697_100150709 3300005536 Unclassified 1960
122 Ga0070697_100354341 3300005536 Bacteria 1268
123 Ga0070697_100469295 3300005536 Unclassified 1098
124 Ga0068853_100728318 3300005539 Unclassified 947
125 Ga0070672_100012178 3300005543 Bacteria 6026
126 Ga0070672_100023354 3300005543 Bacteria 4557
127 Ga0070672_100084355 3300005543 Bacteria 2551
128 Ga0070672_100291080 3300005543 Bacteria 1383
129 Ga0070672_100469070 3300005543 Bacteria 1086
130 Ga0070686_100006531 3300005544 Bacteria 6489
131 Ga0070686_100208301 3300005544 Bacteria 1406
132 Ga0070695_100116491 3300005545 Bacteria 1822
133 Ga0070695_100445471 3300005545 Unclassified 991
134 Ga0070696_100025777 3300005546 Bacteria 3999
135 Ga0070696_100038794 3300005546 Bacteria 3289
136 Ga0070693_100146472 3300005547 Bacteria 1492
137 Ga0070665_100111620 3300005548 Unclassified 2736
138 Ga0070665_100253205 3300005548 Bacteria 1762
139 Ga0070704_100000453 3300005549 Bacteria 19337
140 Ga0070704_100224840 3300005549 Bacteria 1528
141 Ga0068855_100008621 3300005563 Bacteria 12322
142 Ga0068855_100089866 3300005563 Bacteria 3545
143 Ga0068855_100569021 3300005563 Unclassified 1225
144 Ga0070664_100068474 3300005564 Unclassified 3035
145 Ga0070664_100136750 3300005564 Bacteria 2155
146 Ga0070664_100457059 3300005564 Bacteria 1173
147 Ga0070664_100494021 3300005564 Unclassified 1127
148 Ga0068857_100005636 3300005577 Bacteria 10704
149 Ga0068857_100031492 3300005577 Bacteria 4687
150 Ga0068857_100037825 3300005577 Unclassified 4275
151 Ga0068857_100081188 3300005577 Unclassified 2895
152 Ga0068857_100132496 3300005577 Bacteria 2249
153 Ga0068857_100182862 3300005577 Unclassified 1908
154 Ga0068857_100212940 3300005577 Unclassified 1763
155 Ga0068854_100056449 3300005578 Bacteria 2830
156 Ga0068856_100024645 3300005614 Bacteria 5858
157 Ga0068856_100043171 3300005614 Bacteria 4436
158 Ga0068856_100175793 3300005614 Bacteria 2153
159 Ga0070702_100230289 3300005615 Unclassified 1245
160 Ga0068852_100016849 3300005616 Bacteria 5713
161 Ga0068852_100467016 3300005616 Bacteria 1252
162 Ga0068852_100492001 3300005616 Bacteria 1220
163 Ga0068852_100830996 3300005616 Unclassified 939
164 Ga0068859_100044997 3300005617 Bacteria 4435
165 Ga0068859_100262066 3300005617 Unclassified 1820
166 Ga0068859_100264635 3300005617 Bacteria 1811
167 Ga0068859_100664477 3300005617 Bacteria 1134
168 Ga0068859_101198753 3300005617 Unclassified 836
169 Ga0068864_100036836 3300005618 Bacteria 4171
170 Ga0068864_100045456 3300005618 Bacteria 3767
171 Ga0068864_100051489 3300005618 Unclassified 3547
172 Ga0068864_100328983 3300005618 Unclassified 1437
173 Ga0068866_10069067 3300005718 Unclassified 1860
174 Ga0068866_10263085 3300005718 Bacteria 1061
175 Ga0068861_100001711 3300005719 Bacteria 14093
176 Ga0068861_100052740 3300005719 Bacteria 3092
177 Ga0068870_10093938 3300005840 Bacteria 1683
178 Ga0068870_10109321 3300005840 Unclassified 1576
179 Ga0068870_10173654 3300005840 Bacteria 1288
180 Ga0068863_100012855 3300005841 Bacteria 8073
181 Ga0068863_100063786 3300005841 Unclassified 3484
182 Ga0068863_100067629 3300005841 Bacteria 3380
183 Ga0068863_100580284 3300005841 Bacteria 1109
184 Ga0068863_100591065 3300005841 Unclassified 1098
185 Ga0068858_100003578 3300005842 Bacteria 15374
186 Ga0068858_100043682 3300005842 Bacteria 4156
187 Ga0068858_100069221 3300005842 Bacteria 3271
188 Ga0068858_100069332 3300005842 Bacteria 3268
189 Ga0068858_100097512 3300005842 Bacteria 2740
190 Ga0068860_100006489 3300005843 Bacteria 11746
191 Ga0068860_100021003 3300005843 Bacteria 6326
192 Ga0068860_100082598 3300005843 Bacteria 3055
193 Ga0068860_100087471 3300005843 Bacteria 2966
194 Ga0068860_100393935 3300005843 Unclassified 1369
195 Ga0068860_100398108 3300005843 Bacteria 1362
196 Ga0068862_100012152 3300005844 Bacteria 7117
197 Ga0068862_100051982 3300005844 Bacteria 3505
198 Ga0068862_100102999 3300005844 Bacteria 2499
199 Ga0081455_10017549 3300005937 Bacteria 6855
200 Ga0081540_1113207 3300005983 Bacteria 1142
201 Ga0081539_10052487 3300005985 Unclassified 2289
202 Ga0070717_10728767 3300006028 Bacteria 901
203 Ga0075432_10103893 3300006058 Bacteria 1052
204 Ga0070716_100314372 3300006173 Bacteria 1095
205 Ga0097621_100003135 3300006237 Bacteria 11342
206 Ga0097621_100005650 3300006237 Bacteria 8824
207 Ga0097621_100028956 3300006237 Unclassified 4371
208 Ga0097621_100060686 3300006237 Bacteria 3100
209 Ga0097621_100195497 3300006237 Bacteria 1753
210 Ga0097621_100221688 3300006237 Unclassified 1648
211 Ga0097621_100423757 3300006237 Unclassified 1195
212 Ga0068871_100003184 3300006358 Bacteria 11274
213 Ga0068871_100010786 3300006358 Bacteria 6686
214 Ga0068871_100018757 3300006358 Bacteria 5268
215 Ga0068871_100066322 3300006358 Bacteria 2958
216 Ga0068871_100127531 3300006358 Bacteria 2155
217 Ga0068871_100275747 3300006358 Unclassified 1470
218 Ga0068871_100326685 3300006358 Bacteria 1352
219 Ga0068871_100357570 3300006358 Bacteria 1293
220 Ga0068871_100387318 3300006358 Unclassified 1243
221 Ga0068871_100454489 3300006358 Unclassified 1148
222 Ga0068871_100490550 3300006358 Unclassified 1106
223 Ga0068871_100771063 3300006358 Unclassified 885
224 Ga0075428_100076603 3300006844 Bacteria 3652
225 Ga0075428_100126791 3300006844 Bacteria 2777
226 Ga0075428_100131073 3300006844 Bacteria 2727
227 Ga0075428_100205345 3300006844 Bacteria 2129
228 Ga0075428_100278102 3300006844 Unclassified 1801
229 Ga0075428_100742142 3300006844 Bacteria 1045
230 Ga0075428_100976493 3300006844 Bacteria 897
231 Ga0075430_100007435 3300006846 Bacteria 9249
232 Ga0075430_100234387 3300006846 Bacteria 1522
233 Ga0075431_100005172 3300006847 Bacteria 12846
234 Ga0075431_100124932 3300006847 Unclassified 2655
235 Ga0075431_100181564 3300006847 Bacteria 2159
236 Ga0075433_10007809 3300006852 Bacteria 8507
237 Ga0075433_10012161 3300006852 Bacteria 6939
238 Ga0075433_10020516 3300006852 Bacteria 5528
239 Ga0075433_10056967 3300006852 Unclassified 3415
240 Ga0075433_10380541 3300006852 Unclassified 1246
241 Ga0075434_100018018 3300006871 Bacteria 6813
242 Ga0075434_100026119 3300006871 Bacteria 5720
243 Ga0075434_100034400 3300006871 Bacteria 5004
244 Ga0075434_100071297 3300006871 Bacteria 3466
245 Ga0075434_100200923 3300006871 Bacteria 2013
246 Ga0075434_100290817 3300006871 Bacteria 1654
247 Ga0075434_100333975 3300006871 Bacteria 1536
248 Ga0075434_101063437 3300006871 Bacteria 823
249 Ga0075429_100406480 3300006880 Unclassified 1192
250 Ga0068865_100059087 3300006881 Bacteria 2681
251 Ga0068865_100139809 3300006881 Bacteria 1824
252 Ga0075436_100177982 3300006914 Bacteria 1503
253 Ga0097620_100044996 3300006931 Bacteria 4435
254 Ga0097620_100262047 3300006931 Unclassified 1820
255 Ga0097620_100264661 3300006931 Bacteria 1811
256 Ga0097620_100664481 3300006931 Bacteria 1134
257 Ga0097620_101198584 3300006931 Unclassified 836
258 Ga0075435_100007325 3300007076 Bacteria 7857
259 Ga0075435_100070017 3300007076 Unclassified 2862
260 Ga0075435_100085646 3300007076 Bacteria 2594
261 Ga0075435_100093765 3300007076 Bacteria 2481
262 Ga0075435_100142136 3300007076 Bacteria 2014
263 Ga0075435_100686458 3300007076 Unclassified 890
264 Ga0105240_10003031 3300009093 Bacteria 26427
265 Ga0105240_10125364 3300009093 Unclassified 3087
266 Ga0105240_10216624 3300009093 Bacteria 2233
267 Ga0105240_10497166 3300009093 Bacteria 1357
268 Ga0111539_10073740 3300009094 Bacteria 4023
269 Ga0111539_10098718 3300009094 Bacteria 3430
270 Ga0111539_10140052 3300009094 Unclassified 2832
271 Ga0111539_10227452 3300009094 Bacteria 2172
272 Ga0111539_10240918 3300009094 Bacteria 2106
273 Ga0105245_10000522 3300009098 Bacteria 35144
274 Ga0105245_10002357 3300009098 Bacteria 17076
275 Ga0105245_10127242 3300009098 Bacteria 2386
276 Ga0105245_10345626 3300009098 Bacteria 1472
277 Ga0105247_10212227 3300009101 Bacteria 1306
278 Ga0105247_10511043 3300009101 Unclassified 877
279 Ga0114129_10002091 3300009147 Bacteria 27446
280 Ga0114129_10031730 3300009147 Bacteria 7468
281 Ga0114129_10043423 3300009147 Bacteria 6324
282 Ga0114129_10229061 3300009147 Bacteria 2503
283 Ga0105243_10016949 3300009148 Bacteria 5509
284 Ga0105243_10020825 3300009148 Unclassified 4976
285 Ga0105243_10036215 3300009148 Bacteria 3829
286 Ga0105243_10560215 3300009148 Bacteria 1093
287 Ga0105241_10014125 3300009174 Bacteria 5851
288 Ga0105241_10014912 3300009174 Bacteria 5689
289 Ga0105241_10035621 3300009174 Bacteria 3743
290 Ga0105241_10093468 3300009174 Bacteria 2376
291 Ga0105241_10115792 3300009174 Bacteria 2152
292 Ga0105241_10205457 3300009174 Bacteria 1648
293 Ga0105242_10003963 3300009176 Bacteria 11503
294 Ga0105242_10016706 3300009176 Bacteria 5709
295 Ga0105242_10046672 3300009176 Bacteria 3515
296 Ga0105242_10064829 3300009176 Unclassified 3012
297 Ga0105248_10033663 3300009177 Bacteria 5725
298 Ga0105248_10069361 3300009177 Bacteria 3958
299 Ga0105248_10126342 3300009177 Unclassified 2885
300 Ga0105248_10130004 3300009177 Bacteria 2841
301 Ga0105237_10006001 3300009545 Bacteria 13596
302 Ga0105237_10015607 3300009545 Bacteria 7899
303 Ga0105237_10085709 3300009545 Unclassified 3140
304 Ga0105237_10385722 3300009545 Bacteria 1406
305 Ga0105238_10004837 3300009551 Bacteria 13326
306 Ga0105238_10026176 3300009551 Bacteria 5944
307 Ga0105238_10082135 3300009551 Bacteria 3212
308 Ga0105238_10092707 3300009551 Unclassified 3009
309 Ga0105238_10295619 3300009551 Unclassified 1603
310 Ga0105249_10005083 3300009553 Bacteria 11334
311 Ga0105249_10006308 3300009553 Bacteria 10304
312 Ga0105239_10034607 3300010375 Bacteria 5548
313 Ga0105239_10086717 3300010375 Bacteria 3451
314 Ga0105246_10010593 3300011119 Bacteria 5710
315 Ga0105246_10020968 3300011119 Bacteria 4197
316 Ga0105246_10226739 3300011119 Bacteria 1468
317 Ga0105246_10573086 3300011119 Unclassified 971
318 Ga0157371_10160111 3300013102 Unclassified 1607
319 Ga0157370_10001003 3300013104 Bacteria 35617
320 Ga0157369_10046352 3300013105 Bacteria 4724
321 Ga0157369_10737618 3300013105 Unclassified 1014
322 Ga0157374_10007761 3300013296 Bacteria 9157
323 Ga0157374_10016696 3300013296 Bacteria 6457
324 Ga0157374_10392501 3300013296 Bacteria 1383
325 Ga0157378_10000308 3300013297 Bacteria 47674
326 Ga0157378_10102653 3300013297 Unclassified 2612
327 Ga0157378_10583127 3300013297 Bacteria 1127
328 Ga0163162_10005356 3300013306 Bacteria 12384
329 Ga0163162_10045260 3300013306 Bacteria 4409
330 Ga0163162_10794916 3300013306 Bacteria 1064
331 Ga0157372_10123045 3300013307 Unclassified 2981
332 Ga0157372_10180348 3300013307 Bacteria 2444
333 Ga0157372_11286958 3300013307 Unclassified 844
334 Ga0157375_10048466 3300013308 Bacteria 4156
335 Ga0157375_10087567 3300013308 Bacteria 3167
336 Ga0157375_10093982 3300013308 Bacteria 3066
337 Ga0157375_10098367 3300013308 Bacteria 3002
338 Ga0157375_10146896 3300013308 Bacteria 2489
339 Ga0157375_10228474 3300013308 Bacteria 2020
340 Ga0157375_10578377 3300013308 Unclassified 1284
341 Ga0157375_10869644 3300013308 Unclassified 1047
342 Ga0163163_10027839 3300014325 Bacteria 5419
343 Ga0163163_10126589 3300014325 Bacteria 2593
344 Ga0163163_10176853 3300014325 Bacteria 2181
345 Ga0163163_10298943 3300014325 Bacteria 1662
346 Ga0163163_11026717 3300014325 Bacteria 888
347 Ga0157380_10003989 3300014326 Bacteria 10190
348 Ga0157380_10042135 3300014326 Bacteria 3567
349 Ga0157380_10099214 3300014326 Bacteria 2421
350 Ga0157377_10010541 3300014745 Bacteria 4575
351 Ga0157377_10024414 3300014745 Bacteria 3213
352 Ga0157377_10081859 3300014745 Unclassified 1889
353 Ga0157379_10006670 3300014968 Bacteria 9968
354 Ga0157379_10032191 3300014968 Bacteria 4674
355 Ga0157376_10001709 3300014969 Bacteria 14610
356 Ga0157376_10115097 3300014969 Unclassified 2374
357 Ga0157376_10179125 3300014969 Bacteria 1936
358 Ga0157376_10206334 3300014969 Bacteria 1811
359 Ga0157376_10281963 3300014969 Bacteria 1565
360 Ga0157376_10296015 3300014969 Bacteria 1530
361 Ga0163161_10017284 3300017792 Bacteria 5047
362 Ga0163161_10067712 3300017792 Bacteria 2608
363 Ga0207697_10015050 3300025315 Bacteria 3201
364 Ga0207697_10149617 3300025315 Bacteria 1015
365 Ga0207682_10000758 3300025893 Bacteria 14885
366 Ga0207682_10017136 3300025893 Bacteria 2829
367 Ga0207682_10018370 3300025893 Bacteria 2734
368 Ga0207642_10034298 3300025899 Bacteria 2157
369 Ga0207710_10085068 3300025900 Bacteria 1472
370 Ga0207688_10007164 3300025901 Bacteria 6064
371 Ga0207688_10163731 3300025901 Bacteria 1320
372 Ga0207680_10038020 3300025903 Bacteria 2783
373 Ga0207680_10179624 3300025903 Unclassified 1430
374 Ga0207647_10069543 3300025904 Bacteria 2128
375 Ga0207647_10083275 3300025904 Bacteria 1916
376 Ga0207699_10053358 3300025906 Bacteria 2396
377 Ga0207699_10362374 3300025906 Bacteria 1025
378 Ga0207645_10002951 3300025907 Bacteria 13132
379 Ga0207645_10006720 3300025907 Bacteria 8222
380 Ga0207645_10033331 3300025907 Bacteria 3310
381 Ga0207645_10131864 3300025907 Bacteria 1626
382 Ga0207643_10005628 3300025908 Bacteria 6698
383 Ga0207643_10092160 3300025908 Unclassified 1768
384 Ga0207643_10101888 3300025908 Bacteria 1684
385 Ga0207705_10146531 3300025909 Archaea 1767
386 Ga0207684_10506319 3300025910 Bacteria 1035
387 Ga0207654_10006828 3300025911 Bacteria 5744
388 Ga0207707_10000564 3300025912 Bacteria 37587
389 Ga0207707_10022852 3300025912 Bacteria 5469
390 Ga0207707_10045671 3300025912 Bacteria 3816
391 Ga0207707_10074994 3300025912 Unclassified 2951
392 Ga0207707_10093766 3300025912 Unclassified 2622
393 Ga0207707_10253373 3300025912 Bacteria 1529
394 Ga0207695_10000793 3300025913 Bacteria 59366
395 Ga0207695_10016144 3300025913 Bacteria 8759
396 Ga0207695_10072623 3300025913 Bacteria 3509
397 Ga0207695_10169648 3300025913 Unclassified 2108
398 Ga0207695_10191532 3300025913 Bacteria 1962
399 Ga0207695_10594380 3300025913 Bacteria 988
400 Ga0207671_10016156 3300025914 Bacteria 5813
401 Ga0207671_10050605 3300025914 Bacteria 3076
402 Ga0207671_10636665 3300025914 Unclassified 849
403 Ga0207663_10118225 3300025916 Bacteria 1810
404 Ga0207660_10013032 3300025917 Bacteria 5444
405 Ga0207660_10356006 3300025917 Bacteria 1174
406 Ga0207662_10010218 3300025918 Bacteria 5176
407 Ga0207657_10053100 3300025919 Unclassified 3513
408 Ga0207649_10225634 3300025920 Unclassified 1337
409 Ga0207652_10519669 3300025921 Bacteria 1071
410 Ga0207646_10016332 3300025922 Bacteria 6968
411 Ga0207646_10079256 3300025922 Bacteria 2936
412 Ga0207646_10088931 3300025922 Bacteria 2764
413 Ga0207681_10008657 3300025923 Bacteria 6213
414 Ga0207681_10024229 3300025923 Bacteria 3893
415 Ga0207681_10097171 3300025923 Bacteria 2116
416 Ga0207694_10001504 3300025924 Bacteria 19893
417 Ga0207694_10019825 3300025924 Bacteria 5087
418 Ga0207694_10064318 3300025924 Unclassified 2859
419 Ga0207650_10027495 3300025925 Unclassified 4073
420 Ga0207650_10093929 3300025925 Bacteria 2296
421 Ga0207659_10002587 3300025926 Bacteria 10780
422 Ga0207659_10003616 3300025926 Bacteria 9315
423 Ga0207659_10007129 3300025926 Bacteria 6859
424 Ga0207659_10015657 3300025926 Bacteria 4921
425 Ga0207659_10020727 3300025926 Bacteria 4351
426 Ga0207659_10271119 3300025926 Bacteria 1384
427 Ga0207659_10505891 3300025926 Bacteria 1023
428 Ga0207687_10001267 3300025927 Bacteria 17279
429 Ga0207687_10308048 3300025927 Bacteria 1278
430 Ga0207700_10002440 3300025928 Bacteria 10672
431 Ga0207700_10014798 3300025928 Bacteria 5123
432 Ga0207700_10144174 3300025928 Bacteria 1961
433 Ga0207700_10411826 3300025928 Bacteria 1186
434 Ga0207700_10639340 3300025928 Unclassified 948
435 Ga0207664_10420428 3300025929 Bacteria 1190
436 Ga0207644_10022567 3300025931 Unclassified 4302
437 Ga0207690_10154390 3300025932 Bacteria 1705
438 Ga0207690_10209796 3300025932 Unclassified 1484
439 Ga0207706_10001586 3300025933 Bacteria 22578
440 Ga0207686_10002311 3300025934 Bacteria 10439
441 Ga0207686_10077249 3300025934 Bacteria 2161
442 Ga0207686_10130622 3300025934 Bacteria 1722
443 Ga0207686_10251152 3300025934 Unclassified 1292
444 Ga0207686_10546666 3300025934 Unclassified 905
445 Ga0207709_10028736 3300025935 Bacteria 3217
446 Ga0207670_10001199 3300025936 Bacteria 13718
447 Ga0207670_10017048 3300025936 Bacteria 4382
448 Ga0207670_10027230 3300025936 Bacteria 3612
449 Ga0207669_10000600 3300025937 Bacteria 15644
450 Ga0207669_10084952 3300025937 Bacteria 2041
451 Ga0207704_10039150 3300025938 Bacteria 2757
452 Ga0207704_10053911 3300025938 Bacteria 2448
453 Ga0207691_10001139 3300025940 Bacteria 26381
454 Ga0207691_10043384 3300025940 Unclassified 4145
455 Ga0207691_10100194 3300025940 Bacteria 2586
456 Ga0207691_10106164 3300025940 Unclassified 2502
457 Ga0207691_10125045 3300025940 Bacteria 2276
458 Ga0207711_10076467 3300025941 Unclassified 2915
459 Ga0207711_10100362 3300025941 Bacteria 2560
460 Ga0207711_10241024 3300025941 Bacteria 1658
461 Ga0207711_10323094 3300025941 Bacteria 1426
462 Ga0207711_10505422 3300025941 Bacteria 1126
463 Ga0207689_10002234 3300025942 Bacteria 18142
464 Ga0207689_10006551 3300025942 Bacteria 10273
465 Ga0207689_10071776 3300025942 Unclassified 2844
466 Ga0207689_10214538 3300025942 Unclassified 1590
467 Ga0207689_10231624 3300025942 Unclassified 1527
468 Ga0207689_10297551 3300025942 Bacteria 1337
469 Ga0207689_10362448 3300025942 Bacteria 1205
470 Ga0207661_10038446 3300025944 Bacteria 3750
471 Ga0207661_10100843 3300025944 Bacteria 2424
472 Ga0207661_10330245 3300025944 Unclassified 1372
473 Ga0207679_10051660 3300025945 Unclassified 3010
474 Ga0207679_10166046 3300025945 Unclassified 1812
475 Ga0207679_10569880 3300025945 Bacteria 1018
476 Ga0207667_10000797 3300025949 Bacteria 40904
477 Ga0207667_10005369 3300025949 Bacteria 15622
478 Ga0207667_10464322 3300025949 Unclassified 1286
479 Ga0207651_10112887 3300025960 Unclassified 2043
480 Ga0207651_10184992 3300025960 Unclassified 1656
481 Ga0207651_10207641 3300025960 Unclassified 1574
482 Ga0207651_10281593 3300025960 Unclassified 1374
483 Ga0207712_10048370 3300025961 Unclassified 2958
484 Ga0207712_10057006 3300025961 Unclassified 2754
485 Ga0207658_10024067 3300025986 Bacteria 4256
486 Ga0207677_10009102 3300026023 Bacteria 5574
487 Ga0207677_10027156 3300026023 Bacteria 3601
488 Ga0207677_10055241 3300026023 Bacteria 2714
489 Ga0207677_10067455 3300026023 Bacteria 2507
490 Ga0207677_10155965 3300026023 Unclassified 1768
491 Ga0207703_10018838 3300026035 Bacteria 5391
492 Ga0207703_10069181 3300026035 Unclassified 2910
493 Ga0207703_10153614 3300026035 Bacteria 2009
494 Ga0207703_10244284 3300026035 Unclassified 1615
495 Ga0207703_10334921 3300026035 Unclassified 1389
496 Ga0207639_10574008 3300026041 Bacteria 1038
497 Ga0207708_10009974 3300026075 Bacteria 7055
498 Ga0207708_10012074 3300026075 Bacteria 6438
499 Ga0207708_10046543 3300026075 Bacteria 3303
500 Ga0207708_10373026 3300026075 Unclassified 1175
501 Ga0207702_10066106 3300026078 Bacteria 3098
502 Ga0207641_10047039 3300026088 Bacteria 3637
503 Ga0207641_10070476 3300026088 Bacteria 3004
504 Ga0207641_10110521 3300026088 Unclassified 2436
505 Ga0207641_10522837 3300026088 Unclassified 1154
506 Ga0207648_10001866 3300026089 Bacteria 23037
507 Ga0207648_10003676 3300026089 Bacteria 16051
508 Ga0207648_10006656 3300026089 Bacteria 11469
509 Ga0207648_10071712 3300026089 Unclassified 3019
510 Ga0207648_10310122 3300026089 Bacteria 1416
511 Ga0207676_10023128 3300026095 Bacteria 4580
512 Ga0207676_10178203 3300026095 Bacteria 1859
513 Ga0207674_10000698 3300026116 Bacteria 43696
514 Ga0207674_10001356 3300026116 Bacteria 31674
515 Ga0207674_10026521 3300026116 Bacteria 6150
516 Ga0207674_10031000 3300026116 Bacteria 5620
517 Ga0207674_10156845 3300026116 Bacteria 2231
518 Ga0207674_10470416 3300026116 Bacteria 1215
519 Ga0207674_10645809 3300026116 Unclassified 1022
520 Ga0207675_100001335 3300026118 Bacteria 24751
521 Ga0207675_100008414 3300026118 Bacteria 9724
522 Ga0207675_100390365 3300026118 Unclassified 1370
523 Ga0207675_100835616 3300026118 Unclassified 935
524 Ga0207683_10240243 3300026121 Unclassified 1652
525 Ga0207683_10277716 3300026121 Bacteria 1531
526 Ga0207698_10022312 3300026142 Unclassified 4396
527 Ga0207698_10269530 3300026142 Bacteria 1569
528 Ga0207698_10462627 3300026142 Bacteria 1227
529 Ga0209973_1020586 3300027252 Unclassified 872
530 Ga0207428_10006519 3300027907 Bacteria 10769
531 Ga0207428_10021966 3300027907 Bacteria 5392
532 Ga0207428_10262128 3300027907 Bacteria 1287
533 Ga0207428_10456345 3300027907 Unclassified 931
534 Ga0268266_10733048 3300028379 Unclassified 953
535 Ga0268265_10000421 3300028380 Bacteria 45504
536 Ga0268265_10568807 3300028380 Bacteria 1078
537 Ga0268264_10012808 3300028381 Bacteria 6902
538 Ga0268264_10028842 3300028381 Bacteria 4543
539 Ga0268264_10039387 3300028381 Bacteria 3905
540 Ga0268264_10085208 3300028381 Bacteria 2712
541 Ga0268264_10146826 3300028381 Bacteria 2110
542 Ga0268264_10379478 3300028381 Bacteria 1353
543 Ga0268264_10984317 3300028381 Unclassified 849
544 Ga0265318_10026965 3300028577 Bacteria 2261
545 Ga0265338_10273942 3300028800 Unclassified 1236
546 Ga0265332_10006977 3300031238 Bacteria 5118
547 Ga0265328_10184433 3300031239 Bacteria 790
548 Ga0265340_10020933 3300031247 Bacteria 3355
549 Ga0265339_10121821 3300031249 Unclassified 1340
550 Ga0265316_10256439 3300031344 Unclassified 1283
551 Ga0265314_10004078 3300031711 Bacteria 13782
552 Ga0373940_0010864 3300035088 Unclassified 2151
553 Ga0373954_0135261 3300035118 Bacteria 1201
554 Ga0373955_0030057 3300035172 Bacteria 2832
555 Ga0373961_0078253 3300035241 Bacteria 1036
556 Ga0373962_0022941 3300035242 Bacteria 1659
557 Ga0373935_0033145 3300035692 Bacteria 3214
558 Ga0373935_0053701 3300035692 Bacteria 2564
559 Ga0373927_0118035 3300035695 Bacteria 1731
560 Ga0373927_0210496 3300035695 Bacteria 1277
561 Ga0373933_0011803 3300035724 Bacteria 4825
562 Ga0373947_0151089 3300035725 Unclassified 1496
563 Ga0373937_0008651 3300036401 Bacteria 8845
564 Ga0373937_0140539 3300036401 Unclassified 2259
565 Ga0373937_0151950 3300036401 Bacteria 2169
566 Ga0373937_0292607 3300036401 Unclassified 1539
567 Ga0373937_0788388 3300036401 Bacteria 898
568 Ga0373925_0004763 3300037068 Bacteria 10221
569 Ga0373925_0098066 3300037068 Bacteria 2249
570 Ga0373925_0398413 3300037068 Unclassified 1122
571 Ga0373925_0478559 3300037068 Bacteria 1021
572 Ga0451807_0072095 3300041486 Bacteria 1041
573 Ga0451807_0099004 3300041486 Bacteria 1093
574 Ga0451577_0254490 3300042876 Bacteria 1590
575 Ga0451577_0613119 3300042876 Unclassified 987
576 Ga0451576_0019367 3300045051 Bacteria 7428
577 Ga0451576_0083242 3300045051 Bacteria 3329
578 Ga0451576_0136236 3300045051 Unclassified 2560
579 Ga0495592_0017809 3300046454 Bacteria 5400
580 Ga0495603_0023406 3300046455 Unclassified 3738
581 Ga0495629_0113376 3300046459 Bacteria 1890
582 Ga0495651_0422795 3300046462 Bacteria 866
583 Ga0495580_0078740 3300046472 Bacteria 2299
584 Ga0495580_0104118 3300046472 Bacteria 1972
585 Ga0495580_0178950 3300046472 Bacteria 1464
586 Ga0495580_0440765 3300046472 Unclassified 875
587 Ga0495582_0032670 3300046473 Unclassified 2861
588 Ga0495585_0185850 3300046492 Bacteria 1066
589 Ga0495594_0334512 3300046499 Unclassified 862
590 Ga0495628_0470425 3300046516 Unclassified 911
591 Ga0495630_0349975 3300046517 Bacteria 1131
592 Ga0495666_0062839 3300046526 Unclassified 1773
593 Ga0495652_0035898 3300046529 Bacteria 4313
594 Ga0495665_0039871 3300046531 Bacteria 2501
595 Ga0495640_0109477 3300046533 Unclassified 1806
596 Ga0495586_0047360 3300046535 Bacteria 2321
597 Ga0495586_0116654 3300046535 Unclassified 1489
598 Ga0495586_0172408 3300046535 Bacteria 1223
599 Ga0495587_0000607 3300046536 Bacteria 24372
600 Ga0495645_0423911 3300046543 Unclassified 844
601 Ga0495656_0194293 3300046615 Bacteria 1004
602 Ga0495659_0090120 3300046664 Bacteria 1176
603 Ga0495599_0128525 3300046678 Bacteria 1574
604 Ga0495658_0056826 3300046683 Bacteria 2233
605 Ga0495658_0110290 3300046683 Bacteria 1654
606 Ga0495613_0008922 3300046689 Bacteria 7440
607 Ga0495613_0094925 3300046689 Bacteria 2158
608 Ga0495670_0032669 3300046691 Bacteria 2589
609 Ga0495581_0174589 3300047315 Bacteria 1257
610 Ga0495674_0162521 3300047319 Bacteria 1868
611 Ga0495680_0137570 3300047322 Bacteria 1790
612 Ga0495684_0326903 3300047471 Bacteria 1095
613 Ga0496102_0349929 3300048905 Bacteria 1391
614 Ga0496109_0092656 3300048912 Bacteria 2795
615 Ga0496114_0184077 3300048917 Bacteria 1825
616 Ga0496115_0213386 3300048918 Bacteria 1594
617 Ga0501039_0018246 3300049575 Bacteria 5385
618 Ga0501042_0061698 3300049578 Unclassified 2678
619 Ga0501047_0200284 3300049581 Unclassified 1858
620 Ga0501071_0463831 3300049587 Unclassified 970
621 Ga0501072_0160510 3300049588 Unclassified 1793
622 Ga0501076_0193837 3300049592 Unclassified 1658
623 Ga0501079_0046816 3300049741 Bacteria 3337
624 Ga0501081_0014740 3300049743 Bacteria 5157
625 Ga0501045_0283106 3300049824 Unclassified 1234
626 nmdc:mga04h51_99856_c1 3300050495 Unclassified 1056
627 nmdc:mga05p37_250191_c1 3300050507 Bacteria 2126
628 nmdc:mga05p37_398811_c1 3300050507 Unclassified 1607
629 nmdc:mga05p37_415973_c1 3300050507 Unclassified 1566
630 nmdc:mga05p37_483863_c1 3300050507 Bacteria 1425
631 nmdc:mga05p37_64961_c1 3300050507 Unclassified 4491
632 nmdc:mga05p37_664318_c1 3300050507 Bacteria 1164
633 nmdc:mga05p37_98398_c1 3300050507 Bacteria 3603
634 nmdc:mga09592_330902_c1 3300050508 Unclassified 1319
635 nmdc:mga0qj67_11897_c1 3300050509 Bacteria 5525
636 nmdc:mga06r32_102893_c1 3300050510 Unclassified 2804
637 nmdc:mga06r32_104455_c1 3300050510 Bacteria 2782
638 nmdc:mga06r32_14528_c1 3300050510 Bacteria 7146
639 nmdc:mga08y16_17366_c1 3300050511 Bacteria 7576
640 nmdc:mga08y16_21733_c1 3300050511 Bacteria 6773
641 nmdc:mga08y16_22770_c1 3300050511 Bacteria 6613
642 nmdc:mga08y16_2574_c1 3300050511 Bacteria 18657
643 nmdc:mga08y16_30217_c1 3300050511 Bacteria 5703
644 nmdc:mga0n895_115107_c1 3300050512 Unclassified 2707
645 nmdc:mga0n895_142321_c1 3300050512 Unclassified 2427
646 nmdc:mga0n895_196772_c1 3300050512 Bacteria 2047
647 nmdc:mga0n895_231722_c1 3300050512 Bacteria 1874
648 nmdc:mga0n895_23630_c1 3300050512 Bacteria 5781
649 nmdc:mga0n895_24054_c1 3300050512 Bacteria 5735
650 nmdc:mga0n895_325610_c1 3300050512 Bacteria 1557
651 nmdc:mga0n895_55296_c1 3300050512 Bacteria 3906
652 nmdc:mga0n895_90359_c1 3300050512 Unclassified 3064
653 nmdc:mga0rr50_26580_c1 3300050513 Bacteria 4040
654 nmdc:mga0rr50_295232_c1 3300050513 Bacteria 1355
655 nmdc:mga0rr50_4186_c1 3300050513 Bacteria 8439
656 nmdc:mga08x19_236033_c1 3300050514 Bacteria 1259
657 nmdc:mga0a205_171263_c1 3300050515 Bacteria 2067
658 nmdc:mga0a205_33748_c1 3300050515 Unclassified 4907
659 nmdc:mga0a205_4137_c1 3300050515 Bacteria 1837
660 nmdc:mga0a205_54892_c1 3300050515 Unclassified 3847
661 nmdc:mga0a205_65731_c1 3300050515 Bacteria 3505
662 nmdc:mga0a205_810799_c1 3300050515 Unclassified 784
663 Ga0501082_0050642 3300060353 Unclassified 3581
664 Ga0373925_0378179
665 SwRhRL2b_contig_3891972
666 Ga0065704_10078276
667 Ga0065712_10067795
668 Ga0065715_10092882
669 Ga0065715_10135579
670 Ga0065715_10196188
671 Ga0065715_10373240
672 Ga0065707_10087693
673 Ga0065707_10133858
674 Ga0065707_10143729
675 Ga0065707_10227917
676 Ga0070676_10110516
677 Ga0070676_10122443
678 Ga0070676_10209572
679 Ga0070683_100002476
680 Ga0070683_100011039
681 Ga0070683_100046045
682 Ga0070683_100103019
683 Ga0070683_100175931
684 Ga0070683_100350879
685 Ga0070690_100032958
686 Ga0070690_100084143
687 Ga0070670_100024879
688 Ga0070677_10049851
689 Ga0070677_10060727
690 Ga0068869_100025000
691 Ga0068869_100084768
692 Ga0068869_100285591
693 Ga0070666_10041191
694 Ga0070666_10074407
695 Ga0070680_100083871
696 Ga0070680_100149293
697 Ga0070680_100374718
698 Ga0070682_100058421
699 Ga0068868_100013507
700 Ga0068868_100023374
701 Ga0068868_100082600
702 Ga0068868_100099687
703 Ga0068868_100192847
704 Ga0068868_100387900
705 Ga0070660_100089315
706 Ga0070689_100003003
707 Ga0070691_10001714
708 Ga0070687_100055684
709 Ga0070661_100029633
710 Ga0070668_100229455
711 Ga0070669_100004016
712 Ga0070669_100008142
713 Ga0070675_100003632
714 Ga0070675_100005942
715 Ga0070675_100014592
716 Ga0070675_100019982
717 Ga0070675_100225421
718 Ga0070675_100358035
719 Ga0070671_100010149
720 Ga0070671_100028898
721 Ga0070674_100004234
722 Ga0070674_100050501
723 Ga0070674_100601652
724 Ga0070673_100010484
725 Ga0070673_100035890
726 Ga0070673_100044698
727 Ga0070673_100138099
728 Ga0070688_100003719
729 Ga0070688_100051458
730 Ga0070688_100056892
731 Ga0070667_100050380
732 Ga0070667_100081343
733 Ga0070667_100552863
734 Ga0070714_100005312
735 Ga0070714_100121932
736 Ga0070713_100012216
737 Ga0070713_100016384
738 Ga0070713_100080363
739 Ga0070713_100474522
740 Ga0070713_100633165
741 Ga0070710_10241085
742 Ga0070710_10304600
743 Ga0070701_10002192
744 Ga0070701_10020279
745 Ga0070705_100057765
746 Ga0070705_100165953
747 Ga0070700_100004859
748 Ga0070700_100031095
749 Ga0070700_100036250
750 Ga0070694_100016173
751 Ga0070694_100232314
752 Ga0070708_100322209
753 Ga0070708_100513655
754 Ga0070678_100069400
755 Ga0070662_100006520
756 Ga0070662_100042219
757 Ga0070681_10032033
758 Ga0070681_10067889
759 Ga0070681_10093031
760 Ga0070681_10302573
761 Ga0068867_100044969
762 Ga0068867_100063372
763 Ga0068867_100112540
764 Ga0068867_100205132
765 Ga0068867_100351410
766 Ga0070685_10019934
767 Ga0070707_100001353
768 Ga0070707_100050556
769 Ga0070698_100565752
770 Ga0070699_100003817
771 Ga0070699_100033494
772 Ga0070699_100054052
773 Ga0070699_100637995
774 Ga0070679_100031324
775 Ga0070679_100153966
776 Ga0070679_100551146
777 Ga0070684_100016589
778 Ga0070684_100036298
779 Ga0070684_100083856
780 Ga0070684_100148370
781 Ga0070684_100169016
782 Ga0070684_100190463
783 Ga0070684_100432629
784 Ga0070697_100150709
785 Ga0070697_100354341
786 Ga0070697_100469295
787 Ga0068853_100728318
788 Ga0070672_100012178
789 Ga0070672_100023354
790 Ga0070672_100084355
791 Ga0070672_100291080
792 Ga0070672_100469070
793 Ga0070686_100006531
794 Ga0070686_100208301
795 Ga0070695_100116491
796 Ga0070695_100445471
797 Ga0070696_100025777
798 Ga0070696_100038794
799 Ga0070693_100146472
800 Ga0070665_100111620
801 Ga0070665_100253205
802 Ga0070704_100000453
803 Ga0070704_100224840
804 Ga0068855_100008621
805 Ga0068855_100089866
806 Ga0068855_100569021
807 Ga0070664_100068474
808 Ga0070664_100136750
809 Ga0070664_100457059
810 Ga0070664_100494021
811 Ga0068857_100005636
812 Ga0068857_100031492
813 Ga0068857_100037825
814 Ga0068857_100081188
815 Ga0068857_100132496
816 Ga0068857_100182862
817 Ga0068857_100212940
818 Ga0068854_100056449
819 Ga0068856_100024645
820 Ga0068856_100043171
821 Ga0068856_100175793
822 Ga0070702_100230289
823 Ga0068852_100016849
824 Ga0068852_100467016
825 Ga0068852_100492001
826 Ga0068852_100830996
827 Ga0068859_100044997
828 Ga0068859_100262066
829 Ga0068859_100264635
830 Ga0068859_100664477
831 Ga0068859_101198753
832 Ga0068864_100036836
833 Ga0068864_100045456
834 Ga0068864_100051489
835 Ga0068864_100328983
836 Ga0068866_10069067
837 Ga0068866_10263085
838 Ga0068861_100001711
839 Ga0068861_100052740
840 Ga0068870_10093938
841 Ga0068870_10109321
842 Ga0068870_10173654
843 Ga0068863_100012855
844 Ga0068863_100063786
845 Ga0068863_100067629
846 Ga0068863_100580284
847 Ga0068863_100591065
848 Ga0068858_100003578
849 Ga0068858_100043682
850 Ga0068858_100069221
851 Ga0068858_100069332
852 Ga0068858_100097512
853 Ga0068860_100006489
854 Ga0068860_100021003
855 Ga0068860_100082598
856 Ga0068860_100087471
857 Ga0068860_100393935
858 Ga0068860_100398108
859 Ga0068862_100012152
860 Ga0068862_100051982
861 Ga0068862_100102999
862 Ga0081455_10017549
863 Ga0081540_1113207
864 Ga0081539_10052487
865 Ga0070717_10728767
866 Ga0075432_10103893
867 Ga0070716_100314372
868 Ga0097621_100003135
869 Ga0097621_100005650
870 Ga0097621_100028956
871 Ga0097621_100060686
872 Ga0097621_100195497
873 Ga0097621_100221688
874 Ga0097621_100423757
875 Ga0068871_100003184
876 Ga0068871_100010786
877 Ga0068871_100018757
878 Ga0068871_100066322
879 Ga0068871_100127531
880 Ga0068871_100275747
881 Ga0068871_100326685
882 Ga0068871_100357570
883 Ga0068871_100387318
884 Ga0068871_100454489
885 Ga0068871_100490550
886 Ga0068871_100771063
887 Ga0075428_100076603
888 Ga0075428_100126791
889 Ga0075428_100131073
890 Ga0075428_100205345
891 Ga0075428_100278102
892 Ga0075428_100742142
893 Ga0075428_100976493
894 Ga0075430_100007435
895 Ga0075430_100234387
896 Ga0075431_100005172
897 Ga0075431_100124932
898 Ga0075431_100181564
899 Ga0075433_10007809
900 Ga0075433_10012161
901 Ga0075433_10020516
902 Ga0075433_10056967
903 Ga0075433_10380541
904 Ga0075434_100018018
905 Ga0075434_100026119
906 Ga0075434_100034400
907 Ga0075434_100071297
908 Ga0075434_100200923
909 Ga0075434_100290817
910 Ga0075434_100333975
911 Ga0075434_101063437
912 Ga0075429_100406480
913 Ga0068865_100059087
914 Ga0068865_100139809
915 Ga0075436_100177982
916 Ga0097620_100044996
917 Ga0097620_100262047
918 Ga0097620_100264661
919 Ga0097620_100664481
920 Ga0097620_101198584
921 Ga0075435_100007325
922 Ga0075435_100070017
923 Ga0075435_100085646
924 Ga0075435_100093765
925 Ga0075435_100142136
926 Ga0075435_100686458
927 Ga0105240_10003031
928 Ga0105240_10125364
929 Ga0105240_10216624
930 Ga0105240_10497166
931 Ga0111539_10073740
932 Ga0111539_10098718
933 Ga0111539_10140052
934 Ga0111539_10227452
935 Ga0111539_10240918
936 Ga0105245_10000522
937 Ga0105245_10002357
938 Ga0105245_10127242
939 Ga0105245_10345626
940 Ga0105247_10212227
941 Ga0105247_10511043
942 Ga0114129_10002091
943 Ga0114129_10031730
944 Ga0114129_10043423
945 Ga0114129_10229061
946 Ga0105243_10016949
947 Ga0105243_10020825
948 Ga0105243_10036215
949 Ga0105243_10560215
950 Ga0105241_10014125
951 Ga0105241_10014912
952 Ga0105241_10035621
953 Ga0105241_10093468
954 Ga0105241_10115792
955 Ga0105241_10205457
956 Ga0105242_10003963
957 Ga0105242_10016706
958 Ga0105242_10046672
959 Ga0105242_10064829
960 Ga0105248_10033663
961 Ga0105248_10069361
962 Ga0105248_10126342
963 Ga0105248_10130004
964 Ga0105237_10006001
965 Ga0105237_10015607
966 Ga0105237_10085709
967 Ga0105237_10385722
968 Ga0105238_10004837
969 Ga0105238_10026176
970 Ga0105238_10082135
971 Ga0105238_10092707
972 Ga0105238_10295619
973 Ga0105249_10005083
974 Ga0105249_10006308
975 Ga0105239_10034607
976 Ga0105239_10086717
977 Ga0105246_10010593
978 Ga0105246_10020968
979 Ga0105246_10226739
980 Ga0105246_10573086
981 Ga0157371_10160111
982 Ga0157370_10001003
983 Ga0157369_10046352
984 Ga0157369_10737618
985 Ga0157374_10007761
986 Ga0157374_10016696
987 Ga0157374_10392501
988 Ga0157378_10000308
989 Ga0157378_10102653
990 Ga0157378_10583127
991 Ga0163162_10005356
992 Ga0163162_10045260
993 Ga0163162_10794916
994 Ga0157372_10123045
995 Ga0157372_10180348
996 Ga0157372_11286958
997 Ga0157375_10048466
998 Ga0157375_10087567
999 Ga0157375_10093982
1000 Ga0157375_10098367
1001 Ga0157375_10146896
1002 Ga0157375_10228474
1003 Ga0157375_10578377
1004 Ga0157375_10869644
1005 Ga0163163_10027839
1006 Ga0163163_10126589
1007 Ga0163163_10176853
1008 Ga0163163_10298943
1009 Ga0163163_11026717
1010 Ga0157380_10003989
1011 Ga0157380_10042135
1012 Ga0157380_10099214
1013 Ga0157377_10010541
1014 Ga0157377_10024414
1015 Ga0157377_10081859
1016 Ga0157379_10006670
1017 Ga0157379_10032191
1018 Ga0157376_10001709
1019 Ga0157376_10115097
1020 Ga0157376_10179125
1021 Ga0157376_10206334
1022 Ga0157376_10281963
1023 Ga0157376_10296015
1024 Ga0163161_10017284
1025 Ga0163161_10067712
1026 Ga0207697_10015050
1027 Ga0207697_10149617
1028 Ga0207682_10000758
1029 Ga0207682_10017136
1030 Ga0207682_10018370
1031 Ga0207642_10034298
1032 Ga0207710_10085068
1033 Ga0207688_10007164
1034 Ga0207688_10163731
1035 Ga0207680_10038020
1036 Ga0207680_10179624
1037 Ga0207647_10069543
1038 Ga0207647_10083275
1039 Ga0207699_10053358
1040 Ga0207699_10362374
1041 Ga0207645_10002951
1042 Ga0207645_10006720
1043 Ga0207645_10033331
1044 Ga0207645_10131864
1045 Ga0207643_10005628
1046 Ga0207643_10092160
1047 Ga0207643_10101888
1048 Ga0207705_10146531
1049 Ga0207684_10506319
1050 Ga0207654_10006828
1051 Ga0207707_10000564
1052 Ga0207707_10022852
1053 Ga0207707_10045671
1054 Ga0207707_10074994
1055 Ga0207707_10093766
1056 Ga0207707_10253373
1057 Ga0207695_10000793
1058 Ga0207695_10016144
1059 Ga0207695_10072623
1060 Ga0207695_10169648
1061 Ga0207695_10191532
1062 Ga0207695_10594380
1063 Ga0207671_10016156
1064 Ga0207671_10050605
1065 Ga0207671_10636665
1066 Ga0207663_10118225
1067 Ga0207660_10013032
1068 Ga0207660_10356006
1069 Ga0207662_10010218
1070 Ga0207657_10053100
1071 Ga0207649_10225634
1072 Ga0207652_10519669
1073 Ga0207646_10016332
1074 Ga0207646_10079256
1075 Ga0207646_10088931
1076 Ga0207681_10008657
1077 Ga0207681_10024229
1078 Ga0207681_10097171
1079 Ga0207694_10001504
1080 Ga0207694_10019825
1081 Ga0207694_10064318
1082 Ga0207650_10027495
1083 Ga0207650_10093929
1084 Ga0207659_10002587
1085 Ga0207659_10003616
1086 Ga0207659_10007129
1087 Ga0207659_10015657
1088 Ga0207659_10020727
1089 Ga0207659_10271119
1090 Ga0207659_10505891
1091 Ga0207687_10001267
1092 Ga0207687_10308048
1093 Ga0207700_10002440
1094 Ga0207700_10014798
1095 Ga0207700_10144174
1096 Ga0207700_10411826
1097 Ga0207700_10639340
1098 Ga0207664_10420428
1099 Ga0207644_10022567
1100 Ga0207690_10154390
1101 Ga0207690_10209796
1102 Ga0207706_10001586
1103 Ga0207686_10002311
1104 Ga0207686_10077249
1105 Ga0207686_10130622
1106 Ga0207686_10251152
1107 Ga0207686_10546666
1108 Ga0207709_10028736
1109 Ga0207670_10001199
1110 Ga0207670_10017048
1111 Ga0207670_10027230
1112 Ga0207669_10000600
1113 Ga0207669_10084952
1114 Ga0207704_10039150
1115 Ga0207704_10053911
1116 Ga0207691_10001139
1117 Ga0207691_10043384
1118 Ga0207691_10100194
1119 Ga0207691_10106164
1120 Ga0207691_10125045
1121 Ga0207711_10076467
1122 Ga0207711_10100362
1123 Ga0207711_10241024
1124 Ga0207711_10323094
1125 Ga0207711_10505422
1126 Ga0207689_10002234
1127 Ga0207689_10006551
1128 Ga0207689_10071776
1129 Ga0207689_10214538
1130 Ga0207689_10231624
1131 Ga0207689_10297551
1132 Ga0207689_10362448
1133 Ga0207661_10038446
1134 Ga0207661_10100843
1135 Ga0207661_10330245
1136 Ga0207679_10051660
1137 Ga0207679_10166046
1138 Ga0207679_10569880
1139 Ga0207667_10000797
1140 Ga0207667_10005369
1141 Ga0207667_10464322
1142 Ga0207651_10112887
1143 Ga0207651_10184992
1144 Ga0207651_10207641
1145 Ga0207651_10281593
1146 Ga0207712_10048370
1147 Ga0207712_10057006
1148 Ga0207658_10024067
1149 Ga0207677_10009102
1150 Ga0207677_10027156
1151 Ga0207677_10055241
1152 Ga0207677_10067455
1153 Ga0207677_10155965
1154 Ga0207703_10018838
1155 Ga0207703_10069181
1156 Ga0207703_10153614
1157 Ga0207703_10244284
1158 Ga0207703_10334921
1159 Ga0207639_10574008
1160 Ga0207708_10009974
1161 Ga0207708_10012074
1162 Ga0207708_10046543
1163 Ga0207708_10373026
1164 Ga0207702_10066106
1165 Ga0207641_10047039
1166 Ga0207641_10070476
1167 Ga0207641_10110521
1168 Ga0207641_10522837
1169 Ga0207648_10001866
1170 Ga0207648_10003676
1171 Ga0207648_10006656
1172 Ga0207648_10071712
1173 Ga0207648_10310122
1174 Ga0207676_10023128
1175 Ga0207676_10178203
1176 Ga0207674_10000698
1177 Ga0207674_10001356
1178 Ga0207674_10026521
1179 Ga0207674_10031000
1180 Ga0207674_10156845
1181 Ga0207674_10470416
1182 Ga0207674_10645809
1183 Ga0207675_100001335
1184 Ga0207675_100008414
1185 Ga0207675_100390365
1186 Ga0207675_100835616
1187 Ga0207683_10240243
1188 Ga0207683_10277716
1189 Ga0207698_10022312
1190 Ga0207698_10269530
1191 Ga0207698_10462627
1192 Ga0209973_1020586
1193 Ga0207428_10006519
1194 Ga0207428_10021966
1195 Ga0207428_10262128
1196 Ga0207428_10456345
1197 Ga0268266_10733048
1198 Ga0268265_10000421
1199 Ga0268265_10568807
1200 Ga0268264_10012808
1201 Ga0268264_10028842
1202 Ga0268264_10039387
1203 Ga0268264_10085208
1204 Ga0268264_10146826
1205 Ga0268264_10379478
1206 Ga0268264_10984317
1207 Ga0265318_10026965
1208 Ga0265338_10273942
1209 Ga0265332_10006977
1210 Ga0265328_10184433
1211 Ga0265340_10020933
1212 Ga0265339_10121821
1213 Ga0265316_10256439
1214 Ga0265314_10004078
1215 Ga0373940_0010864
1216 Ga0373954_0135261
1217 Ga0373955_0030057
1218 Ga0373961_0078253
1219 Ga0373962_0022941
1220 Ga0373935_0033145
1221 Ga0373935_0053701
1222 Ga0373927_0118035
1223 Ga0373927_0210496
1224 Ga0373933_0011803
1225 Ga0373947_0151089
1226 Ga0373937_0008651
1227 Ga0373937_0140539
1228 Ga0373937_0151950
1229 Ga0373937_0292607
1230 Ga0373937_0788388
1231 Ga0373925_0004763
1232 Ga0373925_0098066
1233 Ga0373925_0398413
1234 Ga0373925_0478559
1235 Ga0451807_0072095
1236 Ga0451807_0099004
1237 Ga0451577_0254490
1238 Ga0451577_0613119
1239 Ga0451576_0019367
1240 Ga0451576_0083242
1241 Ga0451576_0136236
1242 Ga0495592_0017809
1243 Ga0495603_0023406
1244 Ga0495629_0113376
1245 Ga0495651_0422795
1246 Ga0495580_0078740
1247 Ga0495580_0104118
1248 Ga0495580_0178950
1249 Ga0495580_0440765
1250 Ga0495582_0032670
1251 Ga0495585_0185850
1252 Ga0495594_0334512
1253 Ga0495628_0470425
1254 Ga0495630_0349975
1255 Ga0495666_0062839
1256 Ga0495652_0035898
1257 Ga0495665_0039871
1258 Ga0495640_0109477
1259 Ga0495586_0047360
1260 Ga0495586_0116654
1261 Ga0495586_0172408
1262 Ga0495587_0000607
1263 Ga0495645_0423911
1264 Ga0495656_0194293
1265 Ga0495659_0090120
1266 Ga0495599_0128525
1267 Ga0495658_0056826
1268 Ga0495658_0110290
1269 Ga0495613_0008922
1270 Ga0495613_0094925
1271 Ga0495670_0032669
1272 Ga0495581_0174589
1273 Ga0495674_0162521
1274 Ga0495680_0137570
1275 Ga0495684_0326903
1276 Ga0496102_0349929
1277 Ga0496109_0092656
1278 Ga0496114_0184077
1279 Ga0496115_0213386
1280 Ga0501039_0018246
1281 Ga0501042_0061698
1282 Ga0501047_0200284
1283 Ga0501071_0463831
1284 Ga0501072_0160510
1285 Ga0501076_0193837
1286 Ga0501079_0046816
1287 Ga0501081_0014740
1288 Ga0501045_0283106
1289 nmdc:mga04h51_99856_c1
1290 nmdc:mga05p37_250191_c1
1291 nmdc:mga05p37_398811_c1
1292 nmdc:mga05p37_415973_c1
1293 nmdc:mga05p37_483863_c1
1294 nmdc:mga05p37_64961_c1
1295 nmdc:mga05p37_664318_c1
1296 nmdc:mga05p37_98398_c1
1297 nmdc:mga09592_330902_c1
1298 nmdc:mga0qj67_11897_c1
1299 nmdc:mga06r32_102893_c1
1300 nmdc:mga06r32_104455_c1
1301 nmdc:mga06r32_14528_c1
1302 nmdc:mga08y16_17366_c1
1303 nmdc:mga08y16_21733_c1
1304 nmdc:mga08y16_22770_c1
1305 nmdc:mga08y16_2574_c1
1306 nmdc:mga08y16_30217_c1
1307 nmdc:mga0n895_115107_c1
1308 nmdc:mga0n895_142321_c1
1309 nmdc:mga0n895_196772_c1
1310 nmdc:mga0n895_231722_c1
1311 nmdc:mga0n895_23630_c1
1312 nmdc:mga0n895_24054_c1
1313 nmdc:mga0n895_325610_c1
1314 nmdc:mga0n895_55296_c1
1315 nmdc:mga0n895_90359_c1
1316 nmdc:mga0rr50_26580_c1
1317 nmdc:mga0rr50_295232_c1
1318 nmdc:mga0rr50_4186_c1
1319 nmdc:mga08x19_236033_c1
1320 nmdc:mga0a205_171263_c1
1321 nmdc:mga0a205_33748_c1
1322 nmdc:mga0a205_4137_c1
1323 nmdc:mga0a205_54892_c1
1324 nmdc:mga0a205_65731_c1
1325 nmdc:mga0a205_810799_c1
1326 Ga0501082_0050642

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00756

Esterase

Putative esterase

159

282

0.76

Structural Annotation

Top 5 Hits

ID Description Score Start End
3wyd-assembly1.cif.gz_B c-terminal esterase domain of lc-est1 0.8011 41 242
3wyd-assembly1.cif.gz_B c-terminal esterase domain of lc-est1 0.7936 41 242
4bag-assembly2.cif.gz_B feruloyl esterase domain of xyny from clostridium thermocellum after exposure to 266nm uv laser 0.7901 22 216
1wb4-assembly1.cif.gz_A s954a mutant of the feruloyl esterase module from clostridium thermocellum complexed with sinapinate 0.7882 22 216
5l8s-assembly2.cif.gz_D the crystal structure of a cold-adapted acylaminoacyl peptidase reveals a novel quaternary architecture based on the arm-exchange mechanism 0.758 25 238
ID Description Score Start End Superfamily
3wydB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8011 41 242 3.40.50.1820
3wydB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.7936 41 242 3.40.50.1820
af_Q2FY80_39_164_3.30.450.20 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;PAS domain 0.7883 23 45 3.30.450.20
af_Q58295_1156_1318_3.10.28.10 Alpha Beta;Roll;Endonuclease I-creI;Homing endonucleases 0.7872 27 45 3.10.28.10
af_Q4D7E5_2_201_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.7767 21 150 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A2V8M566-F1-model_v4 Esterase 0.9988 125 242
AF-A0A2V8DPD6-F1-model_v4 Dienelactone hydrolase domain-containing protein 0.9916 76 241
AF-A0A2V8HYG4-F1-model_v4 Alpha/beta hydrolase 0.9891 20 241 GO:0016747
AF-A0A7Y4SQZ4-F1-model_v4 Alpha/beta hydrolase 0.9869 20 243
AF-A0A7Y4TES9-F1-model_v4 Esterase 0.9866 20 241 GO:0016747

Map