F473467

General Info

Members Datasets Scaffolds Average Seq Length
662 346 512 371

Family's Representative Sequence

Representative Sequence 3300009036|Ga0105244_10000031|Ga0105244_10000031160
Length 402
Sequence MEKTMSDNAGIQSTPPQEPVATKQPHNKKKSRKIALLFLTGVFVIIAIAYLIYWLLVLRHFQSTDDAYVAGNQVQIMAQVSGSVTDVNFDSTDYVKKGDTLVVLDPTDAQQAFERAKTALANSVRQTHQSIINGRQYQANVALRQTQLKQAEADLKRRVVLGSVDAIGREELQHAHDAVDTAKAQLDVAVQQYNANQAMILNTPVDKQPQVLQAAAQVRDAWLSLQRTKVVSPIDGLVSRRTVQVGQQITPGTALMAVVPANHVWVDANFKETQLANMRIGQSATVVSDMYGDDVTYKGKVVGMDMGTGGAFSLLPAQNATGNWIKVVQRLPVRIQLDDDQVAKHPLRIGLSTLVTVDTQDLNGLVLADKVRTEPLYQTTALTLDLAPVNAIIADVINANAG

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2506520007 Serratia plymuthica AS9 Isolate Rhizosphere
3 2506520008 Serratia plymuthica AS12 Isolate Unclassified
4 2508501071 Serratia proteamaculans S4 Isolate Rhizosphere
5 2511231025 Pantoea sp. YR343 Isolate Rhizosphere
6 2511231035 Pantoea sp. GM01 Isolate Rhizosphere
7 2537561728 Pectobacterium wasabiae CFBP 3304 Isolate Rhizoplane
8 2547132181 Kosakonia sacchari SP1 Isolate Stem
9 2554235234 Klebsiella michiganensis SA2 Isolate Unclassified
10 2561511199 Enterobacter sp. R4-368 Isolate Nodule
11 2585427591 Rahnella aquatilis OV744 Isolate Rhizosphere
12 2585427592 Rahnella aquatilis OV588 Isolate Rhizosphere
13 2599185169 Klebsiella quasipneumoniae NFPP35 Isolate Rhizoplane
14 2599185299 Pantoea ananatis NFR11 Isolate Rhizoplane
15 2600255254 Klebsiella quasipneumoniae NFIX15 Isolate Rhizoplane
16 2600255255 Klebsiella quasipneumoniae NFIX23 Isolate Rhizoplane
17 2600255256 Enterobacter sp. NFIX08 Isolate Rhizoplane
18 2600255257 Enterobacter sp. NFIX03 Isolate Rhizoplane
19 2600255280 Klebsiella quasipneumoniae NFIX42 Isolate Rhizoplane
20 2600255281 Klebsiella quasipneumoniae NFIX43 Isolate Rhizoplane
21 2600255287 Klebsiella quasipneumoniae NFIX11 Isolate Rhizoplane
22 2600255288 Klebsiella quasipneumoniae NFIX14 Isolate Rhizoplane
23 2600255289 Klebsiella quasipneumoniae NFIX16 Isolate Rhizoplane
24 2600255290 Klebsiella quasipneumoniae NFIX17 Isolate Rhizoplane
25 2600255291 Klebsiella quasipneumoniae NFIX19 Isolate Rhizoplane
26 2600255298 Klebsiella quasipneumoniae NFIX21 Isolate Rhizoplane
27 2600255299 Klebsiella quasipneumoniae NFIX22 Isolate Rhizoplane
28 2600255300 Klebsiella quasipneumoniae NFIX30 Isolate Rhizoplane
29 2600255301 Klebsiella quasipneumoniae NFIX33 Isolate Rhizoplane
30 2600255302 Klebsiella quasipneumoniae NFIX35 Isolate Rhizoplane
31 2600255303 Klebsiella quasipneumoniae NFIX36 Isolate Rhizoplane
32 2600255304 Klebsiella quasipneumoniae NFIX37 Isolate Rhizoplane
33 2600255305 Klebsiella quasipneumoniae NFIX41 Isolate Rhizoplane
34 2600255306 Klebsiella quasipneumoniae NFIX44 Isolate Rhizoplane
35 2600255307 Klebsiella quasipneumoniae NFIX56 Isolate Rhizoplane
36 2600255309 Klebsiella sp. NFIX53 Isolate Rhizoplane
37 2600255310 Enterobacter sp. NFIX06 Isolate Rhizoplane
38 2600255311 Enterobacter sp. NFIX04 Isolate Rhizoplane
39 2600255392 Klebsiella quasipneumoniae NFIX54 Isolate Rhizoplane
40 2602042046 Enterobacter sp. NFIX09 Isolate Rhizoplane
41 2602042047 Enterobacter sp. NFIX59 Isolate Rhizoplane
42 2602042052 Klebsiella quasipneumoniae NFIX18 Isolate Rhizoplane
43 2602042053 Klebsiella quasipneumoniae NFIX12 Isolate Rhizoplane
44 2602042066 Enterobacter sp. NFIX45 Isolate Rhizoplane
45 2602042067 Enterobacter sp. NFIX58 Isolate Rhizoplane
46 2602042103 Klebsiella quasipneumoniae NFIX29 Isolate Rhizoplane
47 2602042104 Klebsiella quasipneumoniae NFIX26 Isolate Rhizoplane
48 2602042105 Klebsiella quasipneumoniae NFIX25 Isolate Rhizoplane
49 2602042106 Klebsiella quasipneumoniae NFIX13 Isolate Rhizoplane
50 2602042109 Klebsiella aerogenes NFIX39 Isolate Rhizoplane
51 2602042110 Klebsiella quasipneumoniae NFIX40 Isolate Rhizoplane
52 2602042111 Klebsiella quasipneumoniae NFIX20 Isolate Rhizoplane
53 2603880178 Klebsiella quasipneumoniae NFIX34 Isolate Rhizoplane
54 2603880184 Klebsiella quasipneumoniae NFIX27 Isolate Rhizoplane
55 2603880202 Klebsiella quasipneumoniae NFIX38 Isolate Rhizoplane
56 2603880211 Klebsiella quasipneumoniae NFIX24 Isolate Rhizoplane
57 2608642108 Pantoea agglomerans NFPP29 Isolate Rhizoplane
58 2609459761 Enterobacter sp. NFR05 Isolate Rhizoplane
59 2636415599 Klebsiella variicola DX120E Isolate Unclassified
60 2648501693 Pantoea ananatis B1-9 Isolate Rhizosphere
61 2654587920 Serratia plymuthica HRO-C48 Isolate Rhizosphere
62 2667528172 Enterobacteriaceae bacterium NFIX31 Isolate Rhizoplane
63 2667528173 Rahnella sp. NFIX50 Isolate Rhizoplane
64 2671180115 Cedecea sp. NFIX57 Isolate Rhizoplane
65 2675903046 Klebsiella quasipneumoniae NFIX52 Isolate Rhizoplane
66 2681812866 Enterobacter asburiae NFIX55 Isolate Rhizoplane
67 2681812869 Enterobacter ludwigii NFPP41 Isolate Rhizoplane
68 2684622997 Pantoea ananatis NFIX48 Isolate Rhizoplane
69 2687453601 Serratia plymuthica 3Rp8 Isolate Unclassified
70 2706794495 Dickeya zeae ZJU1202 Isolate Unclassified
71 2711768156 Atlantibacter hermannii DDE1 Isolate Unclassified
72 2751185917 Enterobacter sp. HK169 Isolate Unclassified
73 2765235842 Enterobacter ludwigii AA4 Isolate Unclassified
74 2772190666 Serratia surfactantfaciens YD25 Isolate Unclassified
75 2775506706 Enterobacter asburiae 1216 Isolate Unclassified
76 2775507074 Klebsiella sp. D5A Isolate Unclassified
77 2791354903 Mangrovibacter phragmitis MP23 Isolate Unclassified
78 2791355010 Kosakonia pseudosacchari NN143 Isolate Unclassified
79 2791355275 Enterobacter sp. Sa187 Isolate Unclassified
80 2806310673 Serratia quinivorans NCTC 13189 Isolate Rhizosphere
81 2808606414 Pantoea sp. SJZ147 Isolate Rhizosphere
82 2811995292 Kosakonia oryzae Ola 51 Isolate Unclassified
83 2814123068 Kosakonia radicincitans GXGL-4A Isolate Rhizosphere
84 2821118458 Enterobacter asburiae 609 Isolate Unclassified
85 2823373977 Enterobacter ludwigii NCR3 Isolate Rhizosphere
86 2844425489 Enterobacter cloacae SBP-8 Isolate Rhizosphere
87 2844528606 Pantoea sp. R-72498 v. 2 Isolate Unclassified
88 2846540461 Photorhabdus luminescens HIM3 Isolate Rhizosphere
89 2847085930 Erwinia persicina B64 Isolate Bulb
90 2847797336 Pantoea ananatis NN08200 Isolate Unclassified
91 2852103415 Edaphovirga cremea DSM 105170 Isolate Rhizosphere
92 2854601825 Dickeya dianthicola SS70 Isolate Stem Tuber
93 2855195626 Pectobacterium atrosepticum SS26 Isolate Stem Tuber
94 2858466076 Pectobacterium polaris SS28 Isolate Stem Tuber
95 2865014394 Pantoea sp. R-71966 Isolate Unclassified
96 2869551831 Serratia inhibens PRI-2C Isolate Rhizosphere
97 2871272651 Pectobacterium carotovorum SS96 Isolate Stem Tuber
98 2871282230 Pectobacterium parmentieri SS90 Isolate Stem Tuber
99 2876601092 Pantoea endophytica 596 Isolate Unclassified
100 2881609920 Pantoea sp. ARC607 Isolate Rhizosphere
101 2884086401 Kluyvera sp. PO2S7 Isolate Rhizosphere
102 2888366609 Serratia sp. NGAS9 Isolate Rhizosphere
103 2888373701 Serratia rhizosphaerae KUDC3025 Isolate Rhizosphere
104 2891670763 Buttiauxella sp. B2 Isolate Rhizosphere
105 2904474040 Rahnella aquatilis 4485 Isolate Rhizosphere
106 2904504865 Serratia marcescens 1822 Isolate Unclassified
107 2904513164 Klebsiella variicola 1431 Isolate Rhizosphere
108 2908669403 Pantoea coffeiphila 1480 Isolate Rhizosphere
109 2919108558 Klebsiella sp. 1400 Isolate Rhizosphere
110 2919150387 Rahnella aceris 1817 Isolate Unclassified
111 2923634449 Enterobacter kobei SLBN-76 Isolate Rhizosphere
112 2927143783 Rahnella sp. 2050 Isolate Unclassified
113 2927833300 Enterobacter sp. SLBN-59 Isolate Rhizosphere
114 2932406140 Serratia sp. 2723 Isolate Rhizosphere
115 2935625433 Kosakonia sp. 1610 Isolate Rhizosphere
116 2937539931 Pantoea sp. LS15 Isolate Unclassified
117 2937967321 Serratia sp. YC16 Isolate Unclassified
118 2939568625 Lelliottia sp. 489 Isolate Rhizosphere
119 2939573065 Citrobacter sp. 506 Isolate Rhizosphere
120 2939577877 Serratia sp. 509 Isolate Rhizosphere
121 2939602548 Pantoea dispersa 1175 Isolate Rhizosphere
122 2939607340 Leclercia sp. 1548 Isolate Rhizosphere
123 2939617950 Kosakonia cowanii 2056 Isolate Rhizosphere
124 2939642701 Lelliottia nimipressuralis 2756 Isolate Rhizosphere
125 2945874760 Phytobacter diazotrophicus UAEU22 Isolate Rhizosphere
126 2945951305 Pantoea agglomerans W2I1 Isolate Rhizosphere
127 2969079654 Klebsiella variicola E57-7 Isolate Unclassified
128 2971820967 Klebsiella sp. MPUS7 Isolate Rhizosphere
129 2974310843 Enterobacter sp. SORGH_AS 287 Isolate Unclassified
130 2974435778 Kosakonia cowanii SORGH_AS 304 Isolate Unclassified
131 2978975091 Pantoea anthophila SORGH_AS 797 Isolate Unclassified
132 2984494565 Pantoea ananatis SORGH_AS197 Isolate Aerial Root
133 2984559226 Klebsiella variicola SORGH_AS834 Isolate Aerial Root
134 2984595703 Klebsiella variicola SORGH_AS1070 Isolate Aerial Root
135 2990261002 Pantoea ananatis SORGH_AS213 Isolate Aerial Root
136 3000376612 Enterobacteriaceae bacterium 4M9 Isolate Rhizosphere
137 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
138 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
139 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
140 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
141 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
142 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
143 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
144 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
145 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
146 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
147 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
148 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
149 3300005272 Switchgrass rhizosphere microbial communities from Buena Vista Grasslands Wildlife Area, Michigan, USA - BV2.1 v1 Metagenome Rhizosphere
150 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
151 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
152 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
153 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
154 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
155 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
156 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
157 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
158 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
159 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
160 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
161 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
162 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
163 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
164 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
165 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
166 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
167 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
168 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
169 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
170 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
171 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
172 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
173 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
174 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
175 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
176 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
177 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
178 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
179 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
180 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
181 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
182 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
183 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
184 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
185 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
186 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
187 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
188 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
189 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
190 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
191 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
192 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
193 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
194 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
195 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
196 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
197 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
198 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
199 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
200 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
201 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
202 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
203 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
204 3300015679 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.4_F08 Metagenome Unclassified
205 3300015680 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.2_H03 Metagenome Rhizosphere
206 3300015685 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 Metagenome Unclassified
207 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
208 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
209 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
210 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
211 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
212 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
213 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
214 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
215 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
216 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
217 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
218 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
219 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
220 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
232 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
235 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
237 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
238 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
239 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
240 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
241 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
242 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
243 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
244 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
245 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
246 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
247 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
248 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
249 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
250 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
251 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
252 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
253 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
254 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
255 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
256 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
257 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
258 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
259 3300044669 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2E Metagenome Unclassified
260 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
261 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
262 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
263 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
264 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
265 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
266 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
267 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
268 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
269 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
270 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
271 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
272 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
273 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
274 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
275 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
276 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
277 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
278 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
279 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
280 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
281 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
282 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
283 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
284 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
285 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
286 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
287 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
288 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
289 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
290 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
291 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
292 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
293 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
294 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
295 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
296 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
297 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
298 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
299 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
300 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
301 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
302 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
303 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
304 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
305 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
306 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
307 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
308 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
309 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
310 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
311 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
312 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
313 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
314 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
315 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
316 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
317 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
318 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
319 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
320 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
321 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
322 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
323 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
324 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
325 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
326 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
327 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
328 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
329 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
330 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
331 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
332 640753048 Serratia proteamaculans 568 Isolate Endosphere
333 8004592986 Serratia sp. S119 Isolate Unclassified
334 8015394850 Serratia sp. PGPR-27 Isolate Rhizosphere
335 8016733728 Pantoea sp. SORGH_AS 659 Isolate Unclassified
336 8018221730 Enterobacter sp. CM29 Isolate Unclassified
337 8018405270 Enterobacter sp. 198 Isolate Rhizosphere
338 8019499862 Kluyvera sp. 1366 Isolate Rhizosphere
339 8019504834 Atlantibacter hermannii 1903 Isolate Rhizosphere
340 8054844752 Dryocola boscaweniae H18W14 Isolate Rhizosphere
341 8054849141 Dryocola clanedunensis H11S18 Isolate Rhizosphere
342 8055087960 Silvania hatchlandensis H19S6 Isolate Rhizosphere
343 8055092621 Silvania confinis H4N4 Isolate Rhizosphere
344 8055097453 Leclercia tamurae H6W5 Isolate Rhizosphere
345 8055693939 Hafnia alvei A23BA Isolate Rhizosphere
346 8057304971 Scandinavium manionii H17S15 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 77.34
Metatranscriptomes 0
Isolates 22.66

Biome Distribution

Category Percentage (%)
Aerial Root 0.6
Bulb 0.15
Endosphere 4.53
Nodule 3.02
Rhizoplane 10.42
Rhizosphere 59.37
Stem 0.15
Stem Tuber 0.76
Unclassified 21

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_2321501 2162886007 Bacteria 5865
2 JGI24739J22299_10011622 3300001989 Bacteria 3248
3 JGI25162J39368_1000043 3300002737 Bacteria 173070
4 JGI25163J39215_1000011 3300002771 Bacteria 90574
5 JGI25164J39214_1000022 3300002772 Bacteria 173070
6 JGI25152J39213_1001050 3300002773 Bacteria 13121
7 rootH2_10071787 3300003320 Bacteria 6155
8 Ga0055538_1000040 3300003751 Bacteria 173070
9 Ga0055539_1000052 3300003752 Bacteria 173070
10 Ga0055533_1000063 3300003756 Bacteria 173070
11 Ga0055525_1000075 3300003759 Bacteria 173070
12 Ga0055541_1000039 3300003841 Bacteria 173070
13 Ga0058692_1000125 3300003856 Bacteria 49268
14 Ga0058692_1000448 3300003856 Bacteria 18670
15 Ga0058692_1000705 3300003856 Bacteria 13676
16 Ga0058692_1003868 3300003856 Bacteria 4541
17 Ga0058692_1006834 3300003856 Bacteria 3081
18 Ga0058692_1009163 3300003856 Bacteria 2510
19 Ga0058692_1011697 3300003856 Bacteria 2108
20 Ga0058692_1015139 3300003856 Bacteria 1747
21 Ga0058692_1019124 3300003856 Bacteria 1466
22 Ga0065703_1019106 3300005272 Bacteria 3948
23 Ga0065704_10000308 3300005289 Bacteria 43047
24 Ga0065704_10001504 3300005289 Bacteria 26158
25 Ga0065704_10001698 3300005289 Bacteria 11583
26 Ga0065704_10004714 3300005289 Bacteria 6525
27 Ga0065704_10071678 3300005289 Bacteria 10286
28 Ga0065704_10086351 3300005289 Bacteria 3108
29 Ga0070690_100007316 3300005330 Bacteria 6323
30 Ga0070666_10006968 3300005335 Bacteria 6968
31 Ga0070666_10035075 3300005335 Bacteria 3326
32 Ga0068868_100024279 3300005338 Bacteria 4598
33 Ga0070661_100184579 3300005344 Bacteria 1588
34 Ga0070668_100003543 3300005347 Bacteria 11516
35 Ga0070668_100004708 3300005347 Bacteria 10113
36 Ga0070671_100101537 3300005355 Bacteria 2413
37 Ga0070673_100143479 3300005364 Bacteria 2017
38 Ga0070659_100119821 3300005366 Bacteria 2130
39 Ga0070667_100002706 3300005367 Bacteria 15347
40 Ga0070667_100014193 3300005367 Bacteria 6580
41 Ga0070667_100145332 3300005367 Bacteria 2079
42 Ga0070667_100196185 3300005367 Bacteria 1790
43 Ga0070662_100192634 3300005457 Bacteria 1613
44 Ga0070685_10022820 3300005466 Bacteria 3417
45 Ga0068853_100088580 3300005539 Bacteria 2717
46 Ga0068853_100096356 3300005539 Bacteria 2610
47 Ga0070665_100000710 3300005548 Bacteria 44344
48 Ga0070665_100022994 3300005548 Bacteria 6276
49 Ga0070665_100028968 3300005548 Bacteria 5574
50 Ga0070665_100042441 3300005548 Bacteria 4572
51 Ga0070665_100178517 3300005548 Bacteria 2124
52 Ga0068855_100390025 3300005563 Bacteria 1528
53 Ga0068857_100000033 3300005577 Bacteria 74600
54 Ga0068857_100030834 3300005577 Bacteria 4736
55 Ga0068856_100225218 3300005614 Bacteria 1891
56 Ga0068859_100000087 3300005617 Bacteria 85514
57 Ga0068864_100090420 3300005618 Bacteria 2699
58 Ga0068851_10018630 3300005834 Bacteria 3347
59 Ga0068863_100005069 3300005841 Bacteria 12994
60 Ga0068863_100033601 3300005841 Bacteria 4886
61 Ga0068858_100001534 3300005842 Bacteria 23701
62 Ga0068860_100156345 3300005843 Bacteria 2197
63 Ga0068862_100000047 3300005844 Bacteria 151607
64 Ga0068862_100044731 3300005844 Bacteria 3777
65 Ga0081540_1001471 3300005983 Bacteria 20331
66 Ga0075364_10011152 3300006051 Bacteria 5454
67 Ga0075366_10028306 3300006195 Bacteria 3289
68 Ga0068871_100006863 3300006358 Bacteria 8105
69 Ga0068871_100077297 3300006358 Bacteria 2751
70 Ga0068865_100025957 3300006881 Bacteria 3859
71 Ga0097620_100000087 3300006931 Bacteria 85514
72 Ga0079104_1000299 3300006946 Bacteria 62926
73 Ga0079104_1000756 3300006946 Bacteria 27822
74 Ga0079104_1001057 3300006946 Bacteria 20870
75 Ga0079104_1001371 3300006946 Bacteria 16617
76 Ga0079104_1001785 3300006946 Bacteria 13429
77 Ga0079104_1003941 3300006946 Bacteria 6619
78 Ga0079104_1006187 3300006946 Bacteria 4585
79 Ga0079104_1009703 3300006946 Bacteria 3240
80 Ga0105251_10000263 3300009011 Bacteria 52344
81 Ga0105251_10001208 3300009011 Bacteria 22316
82 Ga0105251_10004539 3300009011 Bacteria 9414
83 Ga0105251_10004564 3300009011 Bacteria 9369
84 Ga0105251_10006236 3300009011 Bacteria 7645
85 Ga0105251_10009911 3300009011 Bacteria 5577
86 Ga0105251_10013994 3300009011 Bacteria 4456
87 Ga0105251_10015604 3300009011 Bacteria 4143
88 Ga0105251_10018658 3300009011 Bacteria 3682
89 Ga0105251_10037272 3300009011 Bacteria 2387
90 Ga0105251_10050811 3300009011 Bacteria 1979
91 Ga0105244_10000031 3300009036 Bacteria 177606
92 Ga0105244_10000212 3300009036 Bacteria 60003
93 Ga0105244_10000397 3300009036 Bacteria 40343
94 Ga0105244_10000493 3300009036 Bacteria 35615
95 Ga0105244_10000649 3300009036 Bacteria 30633
96 Ga0105244_10001619 3300009036 Bacteria 17850
97 Ga0105244_10002673 3300009036 Bacteria 13334
98 Ga0105244_10007593 3300009036 Bacteria 6875
99 Ga0105244_10008774 3300009036 Bacteria 6278
100 Ga0105244_10056523 3300009036 Bacteria 1986
101 Ga0105244_10098701 3300009036 Bacteria 1430
102 Ga0105250_10000048 3300009092 Bacteria 123838
103 Ga0105250_10000124 3300009092 Bacteria 66678
104 Ga0105250_10000511 3300009092 Bacteria 27137
105 Ga0105250_10000764 3300009092 Bacteria 19549
106 Ga0105250_10000978 3300009092 Bacteria 16638
107 Ga0105250_10003168 3300009092 Bacteria 7871
108 Ga0105250_10003204 3300009092 Bacteria 7824
109 Ga0105250_10004375 3300009092 Bacteria 6505
110 Ga0105250_10021764 3300009092 Bacteria 2587
111 Ga0105250_10037143 3300009092 Bacteria 1955
112 Ga0105247_10000048 3300009101 Bacteria 150745
113 Ga0105243_10003112 3300009148 Bacteria 13635
114 Ga0105243_10014196 3300009148 Bacteria 6028
115 Ga0105243_10095530 3300009148 Bacteria 2456
116 Ga0105241_10000103 3300009174 Bacteria 60683
117 Ga0105248_10005668 3300009177 Bacteria 13720
118 Ga0105237_10035339 3300009545 Bacteria 5057
119 Ga0105239_10227513 3300010375 Bacteria 2092
120 Ga0105246_10025585 3300011119 Bacteria 3848
121 Ga0157373_10000426 3300013100 Bacteria 33634
122 Ga0157373_10002539 3300013100 Bacteria 13902
123 Ga0157373_10025633 3300013100 Bacteria 4263
124 Ga0157373_10043117 3300013100 Bacteria 3223
125 Ga0157373_10047558 3300013100 Bacteria 3059
126 Ga0157373_10076984 3300013100 Bacteria 2353
127 Ga0157371_10000152 3300013102 Bacteria 101330
128 Ga0157371_10000700 3300013102 Bacteria 39419
129 Ga0157371_10001937 3300013102 Bacteria 20614
130 Ga0157371_10003412 3300013102 Bacteria 14432
131 Ga0157371_10019445 3300013102 Bacteria 5009
132 Ga0157371_10164592 3300013102 Bacteria 1584
133 Ga0157370_10001600 3300013104 Bacteria 27985
134 Ga0157370_10003691 3300013104 Bacteria 17891
135 Ga0157370_10008960 3300013104 Bacteria 10743
136 Ga0157369_10000793 3300013105 Bacteria 40463
137 Ga0157369_10010135 3300013105 Bacteria 10756
138 Ga0157374_10013925 3300013296 Bacteria 7029
139 Ga0163162_10049197 3300013306 Bacteria 4225
140 Ga0157372_10006007 3300013307 Bacteria 12896
141 Ga0157372_10007192 3300013307 Bacteria 11852
142 Ga0157372_10013311 3300013307 Bacteria 8780
143 Ga0157372_10021906 3300013307 Bacteria 6907
144 Ga0157372_10024899 3300013307 Bacteria 6504
145 Ga0157372_10073247 3300013307 Bacteria 3861
146 Ga0157375_10015908 3300013308 Bacteria 6744
147 Ga0163163_10102902 3300014325 Bacteria 2880
148 Ga0182008_10001134 3300014497 Bacteria 18339
149 Ga0182008_10054556 3300014497 Bacteria 1977
150 Ga0157379_10000391 3300014968 Bacteria 35439
151 Ga0157376_10014386 3300014969 Bacteria 5938
152 Ga0182006_1000069 3300015261 Bacteria 140097
153 Ga0182006_1007816 3300015261 Bacteria 4874
154 Ga0183366_1002 3300015679 Bacteria 791639
155 Ga0183370_1002 3300015680 Bacteria 791639
156 Ga0183369_1002 3300015685 Bacteria 791621
157 Ga0183368_1005 3300015687 Bacteria 791621
158 Ga0163161_10000005 3300017792 Bacteria 327860
159 Ga0163161_10188487 3300017792 Bacteria 1584
160 Ga0213876_10000589 3300021384 Bacteria 27049
161 Ga0209760_100017 3300025207 Bacteria 173141
162 Ga0209784_100056 3300025224 Bacteria 173480
163 Ga0209566_100071 3300025225 Bacteria 173480
164 Ga0209674_100091 3300025226 Bacteria 173480
165 Ga0209563_100089 3300025230 Bacteria 173480
166 Ga0207427_100065 3300025231 Bacteria 173452
167 Ga0209437_100115 3300025233 Bacteria 209911
168 Ga0209437_100137 3300025233 Bacteria 173480
169 Ga0209677_100051 3300025253 Bacteria 173480
170 Ga0209129_1000103 3300025258 Bacteria 161305
171 Ga0209233_1003413 3300025261 Bacteria 5604
172 Ga0207656_10010802 3300025321 Bacteria 3433
173 Ga0207696_1000004 3300025711 Bacteria 671626
174 Ga0207696_1000008 3300025711 Bacteria 568181
175 Ga0207696_1000012 3300025711 Bacteria 527363
176 Ga0207696_1000024 3300025711 Bacteria 420123
177 Ga0207696_1000035 3300025711 Bacteria 339626
178 Ga0207696_1000039 3300025711 Bacteria 324954
179 Ga0207696_1000552 3300025711 Bacteria 30153
180 Ga0207696_1000705 3300025711 Bacteria 22787
181 Ga0207696_1001228 3300025711 Bacteria 14526
182 Ga0207696_1001554 3300025711 Bacteria 12236
183 Ga0207696_1003390 3300025711 Bacteria 7288
184 Ga0207696_1020693 3300025711 Bacteria 2116
185 Ga0207655_1000020 3300025728 Bacteria 524503
186 Ga0207655_1000029 3300025728 Bacteria 432187
187 Ga0207655_1000044 3300025728 Bacteria 327511
188 Ga0207655_1000078 3300025728 Bacteria 219360
189 Ga0207655_1000088 3300025728 Bacteria 205698
190 Ga0207655_1000103 3300025728 Bacteria 185076
191 Ga0207655_1000248 3300025728 Bacteria 87779
192 Ga0207655_1001355 3300025728 Bacteria 22998
193 Ga0207655_1003025 3300025728 Bacteria 12847
194 Ga0207655_1007119 3300025728 Bacteria 7301
195 Ga0207655_1029632 3300025728 Bacteria 2559
196 Ga0207655_1032940 3300025728 Bacteria 2359
197 Ga0207713_1000001 3300025735 Bacteria 2295391
198 Ga0207713_1000086 3300025735 Bacteria 157106
199 Ga0207713_1000129 3300025735 Bacteria 116027
200 Ga0207713_1000167 3300025735 Bacteria 95979
201 Ga0207713_1000223 3300025735 Bacteria 76591
202 Ga0207713_1000333 3300025735 Bacteria 52661
203 Ga0207713_1016551 3300025735 Bacteria 3738
204 Ga0207713_1021562 3300025735 Bacteria 3085
205 Ga0207713_1037608 3300025735 Bacteria 2062
206 Ga0207710_10000026 3300025900 Bacteria 307644
207 Ga0207680_10088525 3300025903 Bacteria 1963
208 Ga0207654_10000091 3300025911 Bacteria 60737
209 Ga0207690_10119363 3300025932 Bacteria 1913
210 Ga0207709_10003078 3300025935 Bacteria 10076
211 Ga0207709_10035763 3300025935 Bacteria 2939
212 Ga0207704_10074212 3300025938 Bacteria 2170
213 Ga0207704_10084445 3300025938 Bacteria 2063
214 Ga0207691_10110672 3300025940 Bacteria 2443
215 Ga0207689_10141771 3300025942 Bacteria 1980
216 Ga0207651_10183288 3300025960 Bacteria 1663
217 Ga0207651_10185755 3300025960 Bacteria 1654
218 Ga0207668_10074847 3300025972 Bacteria 2432
219 Ga0207639_10000494 3300026041 Bacteria 27267
220 Ga0207678_10008832 3300026067 Bacteria 8871
221 Ga0207676_10050216 3300026095 Bacteria 3251
222 Ga0207674_10000576 3300026116 Bacteria 48270
223 Ga0209281_1000048 3300027111 Bacteria 322698
224 Ga0209281_1000056 3300027111 Bacteria 307619
225 Ga0209281_1000066 3300027111 Bacteria 284953
226 Ga0209281_1000193 3300027111 Bacteria 139827
227 Ga0209281_1000353 3300027111 Bacteria 75712
228 Ga0209281_1000371 3300027111 Bacteria 72619
229 Ga0209281_1000413 3300027111 Bacteria 64492
230 Ga0209281_1000531 3300027111 Bacteria 48488
231 Ga0209281_1000949 3300027111 Bacteria 23647
232 Ga0209281_1002081 3300027111 Bacteria 8960
233 Ga0209281_1002222 3300027111 Bacteria 8304
234 Ga0209371_1000013 3300027312 Bacteria 691516
235 Ga0209371_1000020 3300027312 Bacteria 556282
236 Ga0209371_1000084 3300027312 Bacteria 180842
237 Ga0209371_1000158 3300027312 Bacteria 105459
238 Ga0209371_1000464 3300027312 Bacteria 39897
239 Ga0209371_1000546 3300027312 Bacteria 35290
240 Ga0209371_1000816 3300027312 Bacteria 25683
241 Ga0209371_1001141 3300027312 Bacteria 19457
242 Ga0209371_1001203 3300027312 Bacteria 18708
243 Ga0209371_1001985 3300027312 Bacteria 12348
244 Ga0209371_1002485 3300027312 Bacteria 10238
245 Ga0209371_1002631 3300027312 Bacteria 9824
246 Ga0209371_1003060 3300027312 Bacteria 8587
247 Ga0209371_1003089 3300027312 Bacteria 8493
248 Ga0268266_10000211 3300028379 Bacteria 101045
249 Ga0268266_10066183 3300028379 Bacteria 3125
250 Ga0268266_10145398 3300028379 Bacteria 2131
251 Ga0268266_10235677 3300028379 Bacteria 1687
252 Ga0268265_10000852 3300028380 Bacteria 28635
253 Ga0268264_10008593 3300028381 Bacteria 8484
254 Ga0268264_10039123 3300028381 Bacteria 3918
255 Ga0268264_10205504 3300028381 Bacteria 1804
256 Ga0268256_1000014 3300030500 Bacteria 691435
257 Ga0268256_1000069 3300030500 Bacteria 195391
258 Ga0268256_1000075 3300030500 Bacteria 180814
259 Ga0268256_1000114 3300030500 Bacteria 117092
260 Ga0268256_1000692 3300030500 Bacteria 25266
261 Ga0268256_1000775 3300030500 Bacteria 23207
262 Ga0268256_1001028 3300030500 Bacteria 18766
263 Ga0268256_1001252 3300030500 Bacteria 15875
264 Ga0268256_1001402 3300030500 Bacteria 14622
265 Ga0268256_1001926 3300030500 Bacteria 11379
266 Ga0268256_1002776 3300030500 Bacteria 8493
267 Ga0268256_1002854 3300030500 Bacteria 8327
268 Ga0268256_1003577 3300030500 Bacteria 6938
269 Ga0268256_1013225 3300030500 Bacteria 2513
270 Ga0268256_1013541 3300030500 Bacteria 2464
271 Ga0265330_10000059 3300031235 Bacteria 97975
272 Ga0265332_10000002 3300031238 Bacteria 709510
273 Ga0265325_10014990 3300031241 Bacteria 4369
274 Ga0265314_10000012 3300031711 Bacteria 415184
275 Ga0436365_0368505 3300039437 Bacteria 454216
276 Ga0439438_000002 3300041405 Bacteria 618223
277 Ga0439438_000420 3300041405 Bacteria 19148
278 Ga0439438_001306 3300041405 Bacteria 11034
279 Ga0439447_001759 3300041407 Bacteria 7946
280 Ga0439447_019158 3300041407 Bacteria 1828
281 Ga0439447_026522 3300041407 Bacteria 1485
282 Ga0439466_0000215 3300041411 Bacteria 22660
283 Ga0451793_1326945 3300041452 Bacteria 2207
284 Ga0451800_1613912 3300041459 Bacteria 1725
285 Ga0439432_001176 3300042006 Bacteria 9909
286 Ga0439432_002522 3300042006 Bacteria 6901
287 Ga0439432_019221 3300042006 Bacteria 2277
288 Ga0439432_068484 3300042006 Bacteria 1085
289 Ga0439452_000006 3300042010 Bacteria 645083
290 Ga0439452_000013 3300042010 Bacteria 364058
291 Ga0439452_000068 3300042010 Bacteria 90768
292 Ga0439452_000094 3300042010 Bacteria 75452
293 Ga0439452_000854 3300042010 Bacteria 14108
294 Ga0439452_002086 3300042010 Bacteria 7577
295 Ga0439452_003662 3300042010 Bacteria 5328
296 Ga0439463_005677 3300042016 Bacteria 3101
297 Ga0450907_000093 3300042146 Bacteria 34548
298 Ga0450893_0006869 3300042532 Bacteria 1843
299 Ga0466981_0000036 3300044669 Bacteria 60421
300 Ga0466959_0028136 3300045049 Bacteria 4169
301 Ga0495627_000128 3300046453 Bacteria 92036
302 Ga0495591_000115 3300046458 Bacteria 92705
303 Ga0495591_000292 3300046458 Bacteria 46136
304 Ga0495591_002752 3300046458 Bacteria 9494
305 Ga0495591_008451 3300046458 Bacteria 4217
306 Ga0495638_0008382 3300046460 Bacteria 7330
307 Ga0495650_0000059 3300046471 Bacteria 296253
308 Ga0495650_0000149 3300046471 Bacteria 159524
309 Ga0495650_0000219 3300046471 Bacteria 120110
310 Ga0495650_0047018 3300046471 Bacteria 1807
311 Ga0495584_0020556 3300046491 Bacteria 3352
312 Ga0495596_0008094 3300046500 Bacteria 4694
313 Ga0495607_0014256 3300046501 Bacteria 5183
314 Ga0495606_0009468 3300046507 Bacteria 8239
315 Ga0495643_0050599 3300046522 Bacteria 2237
316 Ga0495648_0079476 3300046524 Bacteria 1872
317 Ga0495654_0000033 3300046530 Bacteria 201799
318 Ga0495654_0000055 3300046530 Bacteria 142121
319 Ga0495654_0073231 3300046530 Bacteria 1620
320 Ga0495654_0110976 3300046530 Bacteria 1251
321 Ga0495597_0002268 3300046542 Bacteria 12499
322 Ga0495625_0003280 3300046660 Bacteria 16345
323 Ga0495588_0040800 3300046674 Bacteria 2368
324 Ga0495671_0004515 3300046692 Bacteria 8305
325 Ga0495649_0009286 3300046694 Bacteria 5856
326 Ga0495589_0000040 3300046794 Bacteria 140801
327 Ga0495589_0002257 3300046794 Bacteria 10832
328 Ga0495660_0000017 3300046810 Bacteria 320655
329 Ga0495660_0000039 3300046810 Bacteria 173436
330 Ga0495660_0011225 3300046810 Bacteria 5201
331 Ga0495672_0000001 3300047320 Bacteria 1458820
332 Ga0495672_0000052 3300047320 Bacteria 236266
333 Ga0495672_0000145 3300047320 Bacteria 104177
334 Ga0495679_000090 3300047446 Bacteria 82693
335 Ga0495679_004645 3300047446 Bacteria 6261
336 Ga0495679_005908 3300047446 Bacteria 5363
337 Ga0495673_0000019 3300047469 Bacteria 554389
338 Ga0495673_0000393 3300047469 Bacteria 51301
339 Ga0495681_0057945 3300047470 Bacteria 1797
340 Ga0496101_0000179 3300048904 Bacteria 50944
341 Ga0496101_0135419 3300048904 Bacteria 1874
342 Ga0496101_0169528 3300048904 Bacteria 1677
343 Ga0496102_0004354 3300048905 Bacteria 11961
344 Ga0496103_0078459 3300048906 Bacteria 2074
345 Ga0496104_0000192 3300048907 Bacteria 55129
346 Ga0496104_0001537 3300048907 Bacteria 19911
347 Ga0496104_0002084 3300048907 Bacteria 17345
348 Ga0496105_0007028 3300048908 Bacteria 8671
349 Ga0496108_0050933 3300048911 Bacteria 3468
350 Ga0496109_0001165 3300048912 Bacteria 21871
351 Ga0496110_0000494 3300048913 Bacteria 26791
352 Ga0496111_0001864 3300048914 Bacteria 12453
353 Ga0496116_0000007 3300048919 Bacteria 795464
354 Ga0496116_0000115 3300048919 Bacteria 173811
355 Ga0496116_0000304 3300048919 Bacteria 82649
356 Ga0496116_0001642 3300048919 Bacteria 24605
357 Ga0496116_0004276 3300048919 Bacteria 13692
358 Ga0496116_0004623 3300048919 Bacteria 13041
359 Ga0496116_0024693 3300048919 Bacteria 4436
360 Ga0496116_0051512 3300048919 Bacteria 2734
361 Ga0496116_0062804 3300048919 Bacteria 2396
362 Ga0496116_0088587 3300048919 Bacteria 1890
363 Ga0496117_0000073 3300048920 Bacteria 236223
364 Ga0496117_0000422 3300048920 Bacteria 71421
365 Ga0496117_0000634 3300048920 Bacteria 56540
366 Ga0496117_0000788 3300048920 Bacteria 49652
367 Ga0496117_0001214 3300048920 Bacteria 38665
368 Ga0496117_0002272 3300048920 Bacteria 24829
369 Ga0496117_0005747 3300048920 Bacteria 12887
370 Ga0496117_0011975 3300048920 Bacteria 7706
371 Ga0496117_0037760 3300048920 Bacteria 3592
372 Ga0496117_0104096 3300048920 Bacteria 1787
373 Ga0496118_0000094 3300048921 Bacteria 166019
374 Ga0496118_0000287 3300048921 Bacteria 88069
375 Ga0496118_0000655 3300048921 Bacteria 56563
376 Ga0496118_0001069 3300048921 Bacteria 42748
377 Ga0496118_0001813 3300048921 Bacteria 30761
378 Ga0496118_0002052 3300048921 Bacteria 28436
379 Ga0496118_0002462 3300048921 Bacteria 24896
380 Ga0496118_0023282 3300048921 Bacteria 5384
381 Ga0496118_0025823 3300048921 Bacteria 5024
382 Ga0496118_0029225 3300048921 Bacteria 4626
383 Ga0496118_0052303 3300048921 Bacteria 3117
384 Ga0496118_0068498 3300048921 Bacteria 2576
385 Ga0496118_0137956 3300048921 Bacteria 1553
386 Ga0496119_0000073 3300048922 Bacteria 151806
387 Ga0496119_0000156 3300048922 Bacteria 94640
388 Ga0496119_0000212 3300048922 Bacteria 83042
389 Ga0496119_0000491 3300048922 Bacteria 53969
390 Ga0496119_0001968 3300048922 Bacteria 23367
391 Ga0496119_0002709 3300048922 Bacteria 19134
392 Ga0496119_0002738 3300048922 Bacteria 18975
393 Ga0496119_0005862 3300048922 Bacteria 11597
394 Ga0496119_0007273 3300048922 Bacteria 10014
395 Ga0496119_0016843 3300048922 Bacteria 5531
396 Ga0496119_0025937 3300048922 Bacteria 4078
397 Ga0496119_0030191 3300048922 Bacteria 3659
398 Ga0496119_0052358 3300048922 Bacteria 2500
399 Ga0496119_0065914 3300048922 Bacteria 2142
400 Ga0496120_0000035 3300048923 Bacteria 213992
401 Ga0496120_0000064 3300048923 Bacteria 169462
402 Ga0496120_0000088 3300048923 Bacteria 151806
403 Ga0496120_0001146 3300048923 Bacteria 34017
404 Ga0496120_0001258 3300048923 Bacteria 31859
405 Ga0496120_0001382 3300048923 Bacteria 29542
406 Ga0496120_0002261 3300048923 Bacteria 20045
407 Ga0496120_0002265 3300048923 Bacteria 20038
408 Ga0496120_0012300 3300048923 Bacteria 5833
409 Ga0496120_0013483 3300048923 Bacteria 5499
410 Ga0496120_0029121 3300048923 Bacteria 3373
411 Ga0496120_0033895 3300048923 Bacteria 3063
412 Ga0496121_0002645 3300048924 Bacteria 26880
413 Ga0496121_0002716 3300048924 Bacteria 26434
414 Ga0496121_0005859 3300048924 Bacteria 15570
415 Ga0496121_0007785 3300048924 Bacteria 12832
416 Ga0496121_0013763 3300048924 Bacteria 8661
417 Ga0496121_0049905 3300048924 Bacteria 3541
418 Ga0496122_0000124 3300048925 Bacteria 179666
419 Ga0496122_0000170 3300048925 Bacteria 154389
420 Ga0496122_0001525 3300048925 Bacteria 36871
421 Ga0496122_0002886 3300048925 Bacteria 23509
422 Ga0496122_0005959 3300048925 Bacteria 14271
423 Ga0496122_0036391 3300048925 Bacteria 3980
424 Ga0496122_0070613 3300048925 Bacteria 2493
425 Ga0496123_0000058 3300048926 Bacteria 226832
426 Ga0496123_0000091 3300048926 Bacteria 179666
427 Ga0496123_0000416 3300048926 Bacteria 77660
428 Ga0496123_0002615 3300048926 Bacteria 21828
429 Ga0496123_0002935 3300048926 Bacteria 19938
430 Ga0496123_0005698 3300048926 Bacteria 12416
431 Ga0496123_0009123 3300048926 Bacteria 8974
432 Ga0496123_0011926 3300048926 Bacteria 7463
433 Ga0496123_0102425 3300048926 Bacteria 1661
434 Ga0496124_0000049 3300048927 Bacteria 269753
435 Ga0496124_0000180 3300048927 Bacteria 125291
436 Ga0496124_0000464 3300048927 Bacteria 70205
437 Ga0496124_0000981 3300048927 Bacteria 45334
438 Ga0496124_0002524 3300048927 Bacteria 23772
439 Ga0496124_0003466 3300048927 Bacteria 19269
440 Ga0496124_0018727 3300048927 Bacteria 6473
441 Ga0496124_0023966 3300048927 Bacteria 5556
442 Ga0496124_0025309 3300048927 Bacteria 5377
443 Ga0496124_0059943 3300048927 Bacteria 3195
444 Ga0496125_0000303 3300048928 Bacteria 96733
445 Ga0496125_0000551 3300048928 Bacteria 64613
446 Ga0496125_0006766 3300048928 Bacteria 12315
447 Ga0496125_0013197 3300048928 Bacteria 8139
448 Ga0496125_0070854 3300048928 Bacteria 2727
449 Ga0496126_0000729 3300048929 Bacteria 59744
450 Ga0496126_0001614 3300048929 Bacteria 34151
451 Ga0496126_0010752 3300048929 Bacteria 9555
452 Ga0496126_0092240 3300048929 Bacteria 2661
453 Ga0496126_0214191 3300048929 Bacteria 1620
454 Ga0495678_041271 3300049459 Bacteria 1848
455 Ga0495682_0000011 3300049460 Bacteria 278474
456 Ga0501031_0010253 3300049568 Bacteria 6101
457 Ga0501032_0001022 3300049569 Bacteria 22469
458 Ga0501032_0013308 3300049569 Bacteria 5856
459 Ga0501033_0001687 3300049570 Bacteria 19331
460 Ga0501033_0008959 3300049570 Bacteria 7726
461 Ga0501034_0022716 3300049571 Bacteria 6389
462 Ga0501034_0037488 3300049571 Bacteria 4909
463 Ga0501034_0132286 3300049571 Bacteria 2477
464 Ga0501036_0035827 3300049572 Bacteria 4199
465 Ga0501036_0097219 3300049572 Bacteria 2489
466 Ga0501037_0000464 3300049573 Bacteria 33005
467 Ga0501037_0023969 3300049573 Bacteria 4511
468 Ga0501037_0158632 3300049573 Bacteria 1613
469 Ga0501038_0003811 3300049574 Bacteria 14020
470 Ga0501038_0014421 3300049574 Bacteria 7202
471 Ga0501039_0005391 3300049575 Bacteria 9672
472 Ga0501039_0007986 3300049575 Bacteria 8063
473 Ga0501043_0005830 3300049579 Bacteria 9907
474 Ga0501043_0009880 3300049579 Bacteria 7480
475 Ga0501043_0038426 3300049579 Bacteria 3764
476 Ga0501043_0079705 3300049579 Bacteria 2572
477 Ga0501046_0001769 3300049580 Bacteria 20634
478 Ga0501046_0032601 3300049580 Bacteria 4218
479 Ga0501046_0045796 3300049580 Bacteria 3473
480 Ga0501047_0035309 3300049581 Bacteria 4830
481 Ga0501047_0045785 3300049581 Bacteria 4229
482 Ga0501047_0192416 3300049581 Bacteria 1903
483 Ga0501048_0035543 3300049582 Bacteria 3586
484 Ga0501067_0005506 3300049583 Bacteria 7021
485 Ga0501067_0020789 3300049583 Bacteria 3631
486 Ga0501068_0018166 3300049584 Bacteria 4071
487 Ga0501068_0075200 3300049584 Bacteria 2066
488 Ga0501068_0079358 3300049584 Bacteria 2012
489 Ga0501070_0054422 3300049586 Bacteria 3318
490 Ga0501073_0009694 3300049589 Bacteria 7098
491 Ga0501073_0011730 3300049589 Bacteria 6398
492 Ga0501073_0021684 3300049589 Bacteria 4627
493 Ga0501073_0136762 3300049589 Bacteria 1698
494 Ga0501074_0018556 3300049590 Bacteria 5052
495 Ga0501074_0029572 3300049590 Bacteria 3968
496 Ga0501080_0017114 3300049742 Bacteria 6696
497 Ga0501080_0053424 3300049742 Bacteria 3761
498 Ga0501035_0019342 3300049822 Bacteria 6264
499 Ga0501035_0034037 3300049822 Bacteria 4631
500 Ga0501035_0036654 3300049822 Bacteria 4443
501 Ga0501035_0059325 3300049822 Bacteria 3407
502 Ga0501044_0012915 3300049823 Bacteria 9039
503 Ga0501044_0024715 3300049823 Bacteria 6373
504 nmdc:mga00v17_143426_c1 3300050491 Bacteria 1532
505 nmdc:mga00v17_73897_c1 3300050491 Bacteria 2118
506 nmdc:mga0k408_19554_c2 3300050493 Bacteria 1218
507 Ga0500610_0000689 3300053079 Bacteria 10469
508 Ga0500621_000005 3300053126 Bacteria 320383
509 Ga0500568_0004999 3300053139 Bacteria 6950
510 Ga0500620_048705 3300053155 Bacteria 1414
511 Ga0501082_0000268 3300060353 Bacteria 45918
512 Ga0501082_0090467 3300060353 Bacteria 2642

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049580 Ga0501046_0045796 Ga0501046_0045796_113_1321 305
2 3300060353 Ga0501082_0000268 Ga0501082_0000268_31034_32242 305
3 3300049581 Ga0501047_0192416 Ga0501047_0192416_462_1673 306
4 3300053139 Ga0500568_0004999 Ga0500568_0004999_4633_5832 308
5 3300005548 Ga0070665_100028968 Ga0070665_1000289684 309
6 3300049571 Ga0501034_0132286 Ga0501034_0132286_1100_2317 310
7 3300026067 Ga0207678_10008832 Ga0207678_100088325 314
8 3300005335 Ga0070666_10035075 Ga0070666_100350753 320
9 3300005355 Ga0070671_100101537 Ga0070671_1001015372 320
10 3300005367 Ga0070667_100145332 Ga0070667_1001453322 320
11 3300005539 Ga0068853_100096356 Ga0068853_1000963562 320
12 3300005563 Ga0068855_100390025 Ga0068855_1003900252 320
13 3300005614 Ga0068856_100225218 Ga0068856_1002252182 320
14 3300014325 Ga0163163_10102902 Ga0163163_101029022 320
15 3300025903 Ga0207680_10088525 Ga0207680_100885252 320
16 3300028381 Ga0268264_10205504 Ga0268264_102055042 320
17 3300042006 Ga0439432_068484 Ga0439432_068484_23_1003 326
18 3300046524 Ga0495648_0079476 Ga0495648_0079476_23_1003 326
19 3300048929 Ga0496126_0010752 Ga0496126_0010752_8561_9541 326
20 3300050493 nmdc:mga0k408_19554_c2 nmdc:mga0k408_19554_c2_74_1054 326
21 3300031235 Ga0265330_10000059 Ga0265330_1000005926 327
22 3300031238 Ga0265332_10000002 Ga0265332_10000002116 327
23 3300031241 Ga0265325_10014990 Ga0265325_100149904 327
24 3300031711 Ga0265314_10000012 Ga0265314_10000012269 327
25 3300005289 Ga0065704_10004714 Ga0065704_100047143 329
26 3300009092 Ga0105250_10004375 Ga0105250_100043754 329
27 3300025711 Ga0207696_1003390 Ga0207696_10033904 329
28 3300027111 Ga0209281_1000949 Ga0209281_10009493 329
29 3300048920 Ga0496117_0002272 Ga0496117_0002272_18090_19262 329
30 3300048924 Ga0496121_0002645 Ga0496121_0002645_17962_19134 329
31 3300049586 Ga0501070_0054422 Ga0501070_0054422_1763_2965 331
32 3300047469 Ga0495673_0000393 Ga0495673_0000393_22440_23615 332
33 3300049579 Ga0501043_0038426 Ga0501043_0038426_1963_3174 332
34 3300049822 Ga0501035_0034037 Ga0501035_0034037_217_1428 332
35 3300049822 Ga0501035_0036654 Ga0501035_0036654_2996_4213 332
36 3300025938 Ga0207704_10074212 Ga0207704_100742122 333
37 3300049582 Ga0501048_0035543 Ga0501048_0035543_1220_2437 333
38 3300049583 Ga0501067_0020789 Ga0501067_0020789_2162_3370 333
39 3300005364 Ga0070673_100143479 Ga0070673_1001434792 335
40 3300025960 Ga0207651_10185755 Ga0207651_101857552 335
41 3300049569 Ga0501032_0013308 Ga0501032_0013308_2063_3265 335
42 3300049570 Ga0501033_0008959 Ga0501033_0008959_3863_5065 335
43 3300049571 Ga0501034_0037488 Ga0501034_0037488_2335_3537 335
44 3300049572 Ga0501036_0035827 Ga0501036_0035827_2168_3370 335
45 3300049573 Ga0501037_0023969 Ga0501037_0023969_2482_3684 335
46 3300049574 Ga0501038_0014421 Ga0501038_0014421_2324_3526 335
47 3300049575 Ga0501039_0007986 Ga0501039_0007986_2310_3512 335
48 3300049579 Ga0501043_0009880 Ga0501043_0009880_4046_5248 335
49 3300049580 Ga0501046_0032601 Ga0501046_0032601_1645_2847 335
50 3300049581 Ga0501047_0035309 Ga0501047_0035309_2061_3263 335
51 3300049584 Ga0501068_0018166 Ga0501068_0018166_1948_3150 335
52 3300049589 Ga0501073_0011730 Ga0501073_0011730_833_2035 335
53 3300049590 Ga0501074_0029572 Ga0501074_0029572_2229_3431 335
54 3300049742 Ga0501080_0053424 Ga0501080_0053424_497_1699 335
55 3300049822 Ga0501035_0059325 Ga0501035_0059325_833_2035 335
56 3300049823 Ga0501044_0024715 Ga0501044_0024715_833_2035 335
57 3300025940 Ga0207691_10110672 Ga0207691_101106722 338
58 3300025942 Ga0207689_10141771 Ga0207689_101417712 338
59 3300026095 Ga0207676_10050216 Ga0207676_100502162 338
60 3300005548 Ga0070665_100022994 Ga0070665_1000229944 339
61 3300053155 Ga0500620_048705 Ga0500620_048705_16_1215 340
62 3300049568 Ga0501031_0010253 Ga0501031_0010253_972_2165 341
63 3300049569 Ga0501032_0001022 Ga0501032_0001022_8469_9662 341
64 3300049570 Ga0501033_0001687 Ga0501033_0001687_11908_13101 341
65 3300049571 Ga0501034_0022716 Ga0501034_0022716_4625_5818 341
66 3300049572 Ga0501036_0097219 Ga0501036_0097219_443_1636 341
67 3300049573 Ga0501037_0000464 Ga0501037_0000464_22921_24114 341
68 3300049574 Ga0501038_0003811 Ga0501038_0003811_11306_12499 341
69 3300049575 Ga0501039_0005391 Ga0501039_0005391_6085_7278 341
70 3300049579 Ga0501043_0005830 Ga0501043_0005830_4606_5799 341
71 3300049580 Ga0501046_0001769 Ga0501046_0001769_10552_11745 341
72 3300049581 Ga0501047_0045785 Ga0501047_0045785_2465_3658 341
73 3300049584 Ga0501068_0075200 Ga0501068_0075200_109_1302 341
74 3300049589 Ga0501073_0009694 Ga0501073_0009694_3706_4899 341
75 3300049742 Ga0501080_0017114 Ga0501080_0017114_4109_5302 341
76 3300049822 Ga0501035_0019342 Ga0501035_0019342_963_2156 341
77 3300049823 Ga0501044_0012915 Ga0501044_0012915_4606_5799 341
78 3300005344 Ga0070661_100184579 Ga0070661_1001845792 342
79 3300005539 Ga0068853_100088580 Ga0068853_1000885802 342
80 3300009011 Ga0105251_10000263 Ga0105251_1000026310 347
81 3300009011 Ga0105251_10004539 Ga0105251_100045396 347
82 3300009092 Ga0105250_10003168 Ga0105250_100031687 347
83 3300009101 Ga0105247_10000048 Ga0105247_10000048134 347
84 3300009174 Ga0105241_10000103 Ga0105241_1000010310 347
85 3300013100 Ga0157373_10002539 Ga0157373_100025397 347
86 3300017792 Ga0163161_10000005 Ga0163161_10000005280 347
87 3300025711 Ga0207696_1000039 Ga0207696_100003910 347
88 3300025735 Ga0207713_1000086 Ga0207713_100008610 347
89 3300025735 Ga0207713_1000333 Ga0207713_100033310 347
90 3300025900 Ga0207710_10000026 Ga0207710_1000002610 347
91 3300025911 Ga0207654_10000091 Ga0207654_1000009156 347
92 3300042006 Ga0439432_002522 Ga0439432_002522_4062_5234 347
93 3300046453 Ga0495627_000128 Ga0495627_000128_80179_81351 347
94 3300048906 Ga0496103_0078459 Ga0496103_0078459_863_2035 347
95 3300048919 Ga0496116_0000007 Ga0496116_0000007_783674_784846 347
96 3300048920 Ga0496117_0000422 Ga0496117_0000422_59631_60803 347
97 3300048921 Ga0496118_0002052 Ga0496118_0002052_5899_7071 347
98 3300048922 Ga0496119_0005862 Ga0496119_0005862_10065_11237 347
99 3300048922 Ga0496119_0052358 Ga0496119_0052358_72_1244 347
100 3300048923 Ga0496120_0002261 Ga0496120_0002261_8808_9980 347
101 3300049589 Ga0501073_0136762 Ga0501073_0136762_100_1311 347
102 3300009545 Ga0105237_10035339 Ga0105237_100353392 348
103 3300048922 Ga0496119_0007273 Ga0496119_0007273_35_1207 348
104 3300048923 Ga0496120_0002265 Ga0496120_0002265_10059_11231 348
105 3300048927 Ga0496124_0000049 Ga0496124_0000049_258523_259695 348
106 3300048920 Ga0496117_0104096 Ga0496117_0104096_721_1776 351
107 3300005272 Ga0065703_1019106 Ga0065703_10191062 352
108 3300006946 Ga0079104_1009703 Ga0079104_10097032 352
109 3300014497 Ga0182008_10001134 Ga0182008_100011347 352
110 3300027111 Ga0209281_1000413 Ga0209281_100041310 352
111 3300046530 Ga0495654_0110976 Ga0495654_0110976_45_1217 352
112 3300046794 Ga0495589_0000040 Ga0495589_0000040_128982_130154 352
113 3300005367 Ga0070667_100196185 Ga0070667_1001961852 353
114 3300006358 Ga0068871_100077297 Ga0068871_1000772972 353
115 3300009036 Ga0105244_10008774 Ga0105244_100087744 353
116 3300025728 Ga0207655_1000078 Ga0207655_1000078195 353
117 3300013307 Ga0157372_10007192 Ga0157372_100071927 354
118 3300013307 Ga0157372_10013311 Ga0157372_100133116 354
119 3300014969 Ga0157376_10014386 Ga0157376_100143862 355
120 3300006946 Ga0079104_1000756 Ga0079104_100075622 357
121 3300027111 Ga0209281_1000056 Ga0209281_1000056209 357
122 3300053079 Ga0500610_0000689 Ga0500610_0000689_3578_4768 357
123 3300003856 Ga0058692_1019124 Ga0058692_10191241 358
124 3300005617 Ga0068859_100000087 Ga0068859_10000008755 358
125 3300006931 Ga0097620_100000087 Ga0097620_10000008755 358
126 3300025233 Ga0209437_100115 Ga0209437_10011510 358
127 3300025711 Ga0207696_1020693 Ga0207696_10206932 358
128 3300025735 Ga0207713_1000001 Ga0207713_10000012222 358
129 3300027312 Ga0209371_1000158 Ga0209371_100015882 358
130 3300027312 Ga0209371_1000546 Ga0209371_100054623 358
131 3300027312 Ga0209371_1001985 Ga0209371_10019852 358
132 3300030500 Ga0268256_1000069 Ga0268256_10000699 358
133 3300030500 Ga0268256_1001252 Ga0268256_100125210 358
134 3300003856 Ga0058692_1006834 Ga0058692_10068342 359
135 3300005347 Ga0070668_100003543 Ga0070668_10000354310 359
136 3300005347 Ga0070668_100004708 Ga0070668_1000047084 359
137 3300005367 Ga0070667_100014193 Ga0070667_1000141934 359
138 3300005457 Ga0070662_100192634 Ga0070662_1001926342 359
139 3300005548 Ga0070665_100178517 Ga0070665_1001785172 359
140 3300005841 Ga0068863_100033601 Ga0068863_1000336016 359
141 3300005843 Ga0068860_100156345 Ga0068860_1001563452 359
142 3300005844 Ga0068862_100000047 Ga0068862_10000004780 359
143 3300009036 Ga0105244_10000397 Ga0105244_1000039733 359
144 3300010375 Ga0105239_10227513 Ga0105239_102275132 359
145 3300025711 Ga0207696_1001228 Ga0207696_10012283 359
146 3300025728 Ga0207655_1032940 Ga0207655_10329402 359
147 3300025972 Ga0207668_10074847 Ga0207668_100748472 359
148 3300027312 Ga0209371_1002485 Ga0209371_10024857 359
149 3300028379 Ga0268266_10066183 Ga0268266_100661832 359
150 3300028380 Ga0268265_10000852 Ga0268265_1000085217 359
151 3300028381 Ga0268264_10039123 Ga0268264_100391232 359
152 3300030500 Ga0268256_1013225 Ga0268256_10132252 359
153 3300003856 Ga0058692_1000448 Ga0058692_10004489 360
154 3300005844 Ga0068862_100044731 Ga0068862_1000447313 360
155 3300013100 Ga0157373_10043117 Ga0157373_100431171 360
156 3300013307 Ga0157372_10021906 Ga0157372_100219065 360
157 3300027312 Ga0209371_1000464 Ga0209371_100046412 360
158 3300027312 Ga0209371_1001203 Ga0209371_10012039 360
159 3300030500 Ga0268256_1001028 Ga0268256_10010289 360
160 3300041405 Ga0439438_000420 Ga0439438_000420_4183_5361 360
161 3300025728 Ga0207655_1000088 Ga0207655_1000088171 361
162 3300005577 Ga0068857_100000033 Ga0068857_10000003323 362
163 3300005834 Ga0068851_10018630 Ga0068851_100186303 362
164 3300006195 Ga0075366_10028306 Ga0075366_100283063 362
165 3300009092 Ga0105250_10037143 Ga0105250_100371431 362
166 3300009148 Ga0105243_10014196 Ga0105243_100141962 362
167 3300013100 Ga0157373_10076984 Ga0157373_100769842 362
168 3300015679 Ga0183366_1002 Ga0183366_1002148 362
169 3300015680 Ga0183370_1002 Ga0183370_1002148 362
170 3300015685 Ga0183369_1002 Ga0183369_1002148 362
171 3300015687 Ga0183368_1005 Ga0183368_1005148 362
172 3300025321 Ga0207656_10010802 Ga0207656_100108022 362
173 3300025735 Ga0207713_1021562 Ga0207713_10215622 362
174 3300025935 Ga0207709_10035763 Ga0207709_100357632 362
175 3300026116 Ga0207674_10000576 Ga0207674_1000057623 362
176 3300027111 Ga0209281_1002222 Ga0209281_10022226 362
177 3300030500 Ga0268256_1001926 Ga0268256_100192611 362
178 3300048907 Ga0496104_0000192 Ga0496104_0000192_6575_7747 362
179 3300048919 Ga0496116_0024693 Ga0496116_0024693_1057_2229 362
180 3300048920 Ga0496117_0037760 Ga0496117_0037760_1205_2377 362
181 3300048921 Ga0496118_0029225 Ga0496118_0029225_1156_2328 362
182 3300048922 Ga0496119_0030191 Ga0496119_0030191_280_1452 362
183 3300048923 Ga0496120_0029121 Ga0496120_0029121_1241_2413 362
184 3300048924 Ga0496121_0049905 Ga0496121_0049905_929_2101 362
185 3300048925 Ga0496122_0070613 Ga0496122_0070613_361_1533 362
186 3300048926 Ga0496123_0002935 Ga0496123_0002935_12290_13474 362
187 3300048929 Ga0496126_0000729 Ga0496126_0000729_11187_12359 362
188 3300049573 Ga0501037_0158632 Ga0501037_0158632_41_1258 362
189 3300049579 Ga0501043_0079705 Ga0501043_0079705_1281_2498 362
190 3300049583 Ga0501067_0005506 Ga0501067_0005506_2380_3597 362
191 3300049584 Ga0501068_0079358 Ga0501068_0079358_437_1654 362
192 3300049589 Ga0501073_0021684 Ga0501073_0021684_228_1445 362
193 3300049590 Ga0501074_0018556 Ga0501074_0018556_2556_3773 362
194 3300060353 Ga0501082_0090467 Ga0501082_0090467_326_1543 362
195 3300009036 Ga0105244_10056523 Ga0105244_100565232 363
196 3300013307 Ga0157372_10073247 Ga0157372_100732473 363
197 3300014497 Ga0182008_10054556 Ga0182008_100545562 363
198 3300015261 Ga0182006_1007816 Ga0182006_10078163 363
199 3300041407 Ga0439447_019158 Ga0439447_019158_24_1217 363
200 3300041411 Ga0439466_0000215 Ga0439466_0000215_10407_11600 363
201 3300042010 Ga0439452_003662 Ga0439452_003662_1773_2966 363
202 3300042016 Ga0439463_005677 Ga0439463_005677_337_1530 363
203 3300042146 Ga0450907_000093 Ga0450907_000093_24898_26091 363
204 3300046500 Ga0495596_0008094 Ga0495596_0008094_116_1309 363
205 3300046522 Ga0495643_0050599 Ga0495643_0050599_425_1618 363
206 3300046810 Ga0495660_0011225 Ga0495660_0011225_2972_4165 363
207 3300047320 Ga0495672_0000052 Ga0495672_0000052_10359_11552 363
208 3300047446 Ga0495679_005908 Ga0495679_005908_3831_5024 363
209 3300048920 Ga0496117_0000634 Ga0496117_0000634_44984_46177 363
210 3300048921 Ga0496118_0000655 Ga0496118_0000655_44984_46177 363
211 3300048922 Ga0496119_0000212 Ga0496119_0000212_77488_78681 363
212 3300048923 Ga0496120_0001382 Ga0496120_0001382_10570_11763 363
213 3300048924 Ga0496121_0007785 Ga0496121_0007785_8230_9423 363
214 3300048926 Ga0496123_0102425 Ga0496123_0102425_214_1407 363
215 3300048927 Ga0496124_0002524 Ga0496124_0002524_11950_13143 363
216 3300048928 Ga0496125_0006766 Ga0496125_0006766_10758_11951 363
217 3300048929 Ga0496126_0214191 Ga0496126_0214191_405_1598 363
218 3300049459 Ga0495678_041271 Ga0495678_041271_65_1258 363
219 3300050491 nmdc:mga00v17_143426_c1 nmdc:mga00v17_143426_c1_22_1215 363
220 3300009011 Ga0105251_10015604 Ga0105251_100156042 364
221 3300009011 Ga0105251_10018658 Ga0105251_100186582 364
222 3300009092 Ga0105250_10021764 Ga0105250_100217642 364
223 3300013102 Ga0157371_10164592 Ga0157371_101645921 364
224 3300013105 Ga0157369_10010135 Ga0157369_100101359 364
225 3300021384 Ga0213876_10000589 Ga0213876_1000058915 364
226 3300039437 Ga0436365_0368505 Ga0436365_0368505_13118_14290 364
227 3300048905 Ga0496102_0004354 Ga0496102_0004354_632_1825 364
228 3300048919 Ga0496116_0088587 Ga0496116_0088587_41_1234 364
229 3300048920 Ga0496117_0000073 Ga0496117_0000073_224651_225844 364
230 3300048921 Ga0496118_0000094 Ga0496118_0000094_154447_155640 364
231 3300048922 Ga0496119_0000073 Ga0496119_0000073_10457_11650 364
232 3300048923 Ga0496120_0000088 Ga0496120_0000088_140157_141350 364
233 3300048925 Ga0496122_0002886 Ga0496122_0002886_352_1524 364
234 3300048925 Ga0496122_0005959 Ga0496122_0005959_2690_3883 364
235 3300048926 Ga0496123_0000416 Ga0496123_0000416_21986_23158 364
236 3300048926 Ga0496123_0005698 Ga0496123_0005698_10567_11760 364
237 3300048927 Ga0496124_0023966 Ga0496124_0023966_657_1850 364
238 3300048927 Ga0496124_0059943 Ga0496124_0059943_323_1525 364
239 3300050491 nmdc:mga00v17_73897_c1 nmdc:mga00v17_73897_c1_702_1895 364
240 3300006946 Ga0079104_1000299 Ga0079104_100029973 365
241 3300009011 Ga0105251_10009911 Ga0105251_100099114 365
242 3300009011 Ga0105251_10037272 Ga0105251_100372722 365
243 3300009092 Ga0105250_10003204 Ga0105250_100032046 365
244 3300013100 Ga0157373_10000426 Ga0157373_1000042610 365
245 3300013102 Ga0157371_10001937 Ga0157371_100019379 365
246 3300027111 Ga0209281_1000066 Ga0209281_1000066221 365
247 3300042010 Ga0439452_002086 Ga0439452_002086_574_1749 365
248 3300048904 Ga0496101_0000179 Ga0496101_0000179_46143_47336 365
249 3300048919 Ga0496116_0051512 Ga0496116_0051512_1265_2458 365
250 3300048921 Ga0496118_0052303 Ga0496118_0052303_214_1407 365
251 3300048923 Ga0496120_0001258 Ga0496120_0001258_21526_22719 365
252 3300048926 Ga0496123_0009123 Ga0496123_0009123_6247_7440 365
253 3300003856 Ga0058692_1003868 Ga0058692_10038682 366
254 3300009036 Ga0105244_10001619 Ga0105244_100016197 366
255 3300030500 Ga0268256_1000775 Ga0268256_100077513 366
256 3300041405 Ga0439438_001306 Ga0439438_001306_6081_7268 366
257 3300041452 Ga0451793_1326945 Ga0451793_1326945_426_1616 366
258 3300041459 Ga0451800_1613912 Ga0451800_1613912_224_1414 366
259 3300048919 Ga0496116_0001642 Ga0496116_0001642_10651_11823 366
260 3300048922 Ga0496119_0002709 Ga0496119_0002709_853_2025 366
261 3300048923 Ga0496120_0000035 Ga0496120_0000035_202549_203721 366
262 3300003856 Ga0058692_1009163 Ga0058692_10091633 367
263 3300005289 Ga0065704_10071678 Ga0065704_100716783 367
264 3300005577 Ga0068857_100030834 Ga0068857_1000308345 367
265 3300025711 Ga0207696_1000035 Ga0207696_1000035328 367
266 3300025728 Ga0207655_1000248 Ga0207655_100024811 367
267 3300025735 Ga0207713_1037608 Ga0207713_10376082 367
268 3300026041 Ga0207639_10000494 Ga0207639_1000049419 367
269 3300027312 Ga0209371_1003060 Ga0209371_10030605 367
270 3300030500 Ga0268256_1002854 Ga0268256_10028545 367
271 3300048904 Ga0496101_0135419 Ga0496101_0135419_433_1620 367
272 3300048922 Ga0496119_0002738 Ga0496119_0002738_10337_11530 367
273 3300048923 Ga0496120_0001146 Ga0496120_0001146_22684_23877 367
274 3300048927 Ga0496124_0018727 Ga0496124_0018727_1984_3177 367
275 3300005289 Ga0065704_10001698 Ga0065704_100016983 368
276 3300006946 Ga0079104_1006187 Ga0079104_10061872 368
277 3300009011 Ga0105251_10050811 Ga0105251_100508112 368
278 3300009036 Ga0105244_10098701 Ga0105244_100987012 368
279 3300011119 Ga0105246_10025585 Ga0105246_100255852 368
280 3300025711 Ga0207696_1001554 Ga0207696_10015547 368
281 3300025728 Ga0207655_1000020 Ga0207655_1000020361 368
282 3300025735 Ga0207713_1016551 Ga0207713_10165513 368
283 3300027111 Ga0209281_1000193 Ga0209281_100019376 368
284 3300028379 Ga0268266_10145398 Ga0268266_101453982 368
285 3300046458 Ga0495591_000115 Ga0495591_000115_83642_84817 368
286 3300046458 Ga0495591_000292 Ga0495591_000292_11066_12259 368
287 3300046530 Ga0495654_0000033 Ga0495654_0000033_189528_190721 368
288 3300048919 Ga0496116_0004623 Ga0496116_0004623_3115_4290 368
289 3300048921 Ga0496118_0025823 Ga0496118_0025823_2779_3954 368
290 3300048922 Ga0496119_0065914 Ga0496119_0065914_761_1936 368
291 3300048924 Ga0496121_0002716 Ga0496121_0002716_7806_8981 368
292 3300048925 Ga0496122_0000170 Ga0496122_0000170_145644_146819 368
293 3300048926 Ga0496123_0000058 Ga0496123_0000058_79797_80972 368
294 3300048928 Ga0496125_0070854 Ga0496125_0070854_374_1549 368
295 3300009092 Ga0105250_10000511 Ga0105250_1000051130 369
296 3300030500 Ga0268256_1013541 Ga0268256_10135411 369
297 3300042006 Ga0439432_019221 Ga0439432_019221_671_1855 369
298 3300044669 Ga0466981_0000036 Ga0466981_0000036_48425_49597 369
299 3300048922 Ga0496119_0000491 Ga0496119_0000491_10568_11740 369
300 3300048923 Ga0496120_0000064 Ga0496120_0000064_10389_11561 369
301 3300048927 Ga0496124_0000981 Ga0496124_0000981_30553_31737 369
302 3300048928 Ga0496125_0000303 Ga0496125_0000303_89406_90590 369
303 3300001989 JGI24739J22299_10011622 JGI24739J22299_100116223 370
304 3300003320 rootH2_10071787 rootH2_100717873 370
305 3300003856 Ga0058692_1000125 Ga0058692_100012536 370
306 3300005289 Ga0065704_10086351 Ga0065704_100863512 370
307 3300005330 Ga0070690_100007316 Ga0070690_1000073162 370
308 3300005335 Ga0070666_10006968 Ga0070666_100069682 370
309 3300005366 Ga0070659_100119821 Ga0070659_1001198212 370
310 3300005548 Ga0070665_100042441 Ga0070665_1000424413 370
311 3300005618 Ga0068864_100090420 Ga0068864_1000904202 370
312 3300006358 Ga0068871_100006863 Ga0068871_1000068636 370
313 3300006946 Ga0079104_1001785 Ga0079104_100178511 370
314 3300006946 Ga0079104_1003941 Ga0079104_10039416 370
315 3300009011 Ga0105251_10001208 Ga0105251_1000120815 370
316 3300009011 Ga0105251_10013994 Ga0105251_100139942 370
317 3300009036 Ga0105244_10000493 Ga0105244_1000049310 370
318 3300009036 Ga0105244_10007593 Ga0105244_100075936 370
319 3300009092 Ga0105250_10000124 Ga0105250_1000012460 370
320 3300009148 Ga0105243_10003112 Ga0105243_1000311215 370
321 3300013100 Ga0157373_10025633 Ga0157373_100256334 370
322 3300013102 Ga0157371_10003412 Ga0157371_100034125 370
323 3300013104 Ga0157370_10001600 Ga0157370_1000160024 370
324 3300014968 Ga0157379_10000391 Ga0157379_1000039118 370
325 3300017792 Ga0163161_10188487 Ga0163161_101884872 370
326 3300025711 Ga0207696_1000008 Ga0207696_1000008102 370
327 3300025711 Ga0207696_1000012 Ga0207696_1000012437 370
328 3300025711 Ga0207696_1000024 Ga0207696_1000024319 370
329 3300025728 Ga0207655_1001355 Ga0207655_10013555 370
330 3300025728 Ga0207655_1029632 Ga0207655_10296322 370
331 3300025735 Ga0207713_1000129 Ga0207713_100012914 370
332 3300025735 Ga0207713_1000167 Ga0207713_100016781 370
333 3300025932 Ga0207690_10119363 Ga0207690_101193632 370
334 3300025935 Ga0207709_10003078 Ga0207709_100030785 370
335 3300025960 Ga0207651_10183288 Ga0207651_101832881 370
336 3300027111 Ga0209281_1000353 Ga0209281_100035367 370
337 3300027111 Ga0209281_1000371 Ga0209281_100037118 370
338 3300027312 Ga0209371_1000013 Ga0209371_100001389 370
339 3300027312 Ga0209371_1000084 Ga0209371_100008410 370
340 3300027312 Ga0209371_1002631 Ga0209371_10026317 370
341 3300027312 Ga0209371_1003089 Ga0209371_10030896 370
342 3300028379 Ga0268266_10235677 Ga0268266_102356772 370
343 3300028381 Ga0268264_10008593 Ga0268264_100085933 370
344 3300030500 Ga0268256_1000014 Ga0268256_1000014589 370
345 3300030500 Ga0268256_1000075 Ga0268256_1000075155 370
346 3300030500 Ga0268256_1001402 Ga0268256_100140212 370
347 3300030500 Ga0268256_1002776 Ga0268256_10027763 370
348 3300042006 Ga0439432_001176 Ga0439432_001176_1694_2866 370
349 3300042010 Ga0439452_000068 Ga0439452_000068_75388_76560 370
350 3300048904 Ga0496101_0169528 Ga0496101_0169528_67_1242 370
351 3300048912 Ga0496109_0001165 Ga0496109_0001165_14476_15675 370
352 3300048919 Ga0496116_0000304 Ga0496116_0000304_67803_68975 370
353 3300048920 Ga0496117_0000788 Ga0496117_0000788_13890_15062 370
354 3300048921 Ga0496118_0000287 Ga0496118_0000287_86310_87482 370
355 3300048921 Ga0496118_0137956 Ga0496118_0137956_20_1192 370
356 3300048924 Ga0496121_0013763 Ga0496121_0013763_2729_3901 370
357 3300048926 Ga0496123_0011926 Ga0496123_0011926_2624_3796 370
358 3300048927 Ga0496124_0003466 Ga0496124_0003466_18078_19250 370
359 3300048927 Ga0496124_0025309 Ga0496124_0025309_2844_4016 370
360 3300048928 Ga0496125_0013197 Ga0496125_0013197_20_1192 370
361 3300048929 Ga0496126_0092240 Ga0496126_0092240_1111_2283 370
362 3300003856 Ga0058692_1015139 Ga0058692_10151391 371
363 3300013100 Ga0157373_10047558 Ga0157373_100475582 371
364 3300013102 Ga0157371_10000700 Ga0157371_100007006 371
365 3300013307 Ga0157372_10024899 Ga0157372_100248995 371
366 3300025735 Ga0207713_1000223 Ga0207713_100022313 371
367 3300027312 Ga0209371_1001141 Ga0209371_100114117 371
368 3300030500 Ga0268256_1003577 Ga0268256_10035771 371
369 3300041405 Ga0439438_000002 Ga0439438_000002_606287_607480 371
370 3300041407 Ga0439447_001759 Ga0439447_001759_1814_3007 371
371 3300045049 Ga0466959_0028136 Ga0466959_0028136_2728_3912 372
372 3300047320 Ga0495672_0000145 Ga0495672_0000145_79480_80652 372
373 3300009092 Ga0105250_10000048 Ga0105250_1000004811 373
374 3300025711 Ga0207696_1000004 Ga0207696_100000410 373
375 3300046471 Ga0495650_0047018 Ga0495650_0047018_217_1389 373
376 3300048920 Ga0496117_0011975 Ga0496117_0011975_31_1215 373
377 3300048921 Ga0496118_0002462 Ga0496118_0002462_13934_15118 373
378 3300048922 Ga0496119_0025937 Ga0496119_0025937_2583_3755 373
379 3300048923 Ga0496120_0033895 Ga0496120_0033895_333_1505 373
380 3300002773 JGI25152J39213_1001050 JGI25152J39213_100105010 374
381 3300013102 Ga0157371_10019445 Ga0157371_100194453 374
382 3300013105 Ga0157369_10000793 Ga0157369_1000079334 374
383 3300013307 Ga0157372_10006007 Ga0157372_100060076 374
384 3300025258 Ga0209129_1000103 Ga0209129_100010311 374
385 3300042010 Ga0439452_000006 Ga0439452_000006_502873_504045 374
386 3300048919 Ga0496116_0062804 Ga0496116_0062804_690_1862 374
387 3300048921 Ga0496118_0023282 Ga0496118_0023282_3397_4569 374
388 3300048922 Ga0496119_0000156 Ga0496119_0000156_7850_9022 374
389 3300048925 Ga0496122_0036391 Ga0496122_0036391_2023_3195 374
390 3300048927 Ga0496124_0000180 Ga0496124_0000180_13148_14320 374
391 3300027312 Ga0209371_1000020 Ga0209371_1000020135 375
392 3300030500 Ga0268256_1000114 Ga0268256_1000114110 375
393 3300005983 Ga0081540_1001471 Ga0081540_10014719 376
394 3300025728 Ga0207655_1000103 Ga0207655_100010377 376
395 3300003856 Ga0058692_1011697 Ga0058692_10116972 377
396 3300046458 Ga0495591_002752 Ga0495591_002752_1587_2771 377
397 3300046460 Ga0495638_0008382 Ga0495638_0008382_5719_6903 377
398 3300046694 Ga0495649_0009286 Ga0495649_0009286_4640_5824 377
399 3300047446 Ga0495679_004645 Ga0495679_004645_4849_6033 377
400 3300006946 Ga0079104_1001371 Ga0079104_10013718 380
401 3300027111 Ga0209281_1002081 Ga0209281_10020812 380
402 3300042010 Ga0439452_000854 Ga0439452_000854_7981_9153 380
403 3300005338 Ga0068868_100024279 Ga0068868_1000242793 382
404 3300005367 Ga0070667_100002706 Ga0070667_1000027068 382
405 3300005466 Ga0070685_10022820 Ga0070685_100228202 382
406 3300005841 Ga0068863_100005069 Ga0068863_1000050698 382
407 3300005842 Ga0068858_100001534 Ga0068858_1000015345 382
408 3300006881 Ga0068865_100025957 Ga0068865_1000259573 382
409 3300009177 Ga0105248_10005668 Ga0105248_100056687 382
410 3300013296 Ga0157374_10013925 Ga0157374_100139255 382
411 3300013308 Ga0157375_10015908 Ga0157375_100159082 382
412 3300025938 Ga0207704_10084445 Ga0207704_100844452 382
413 3300048907 Ga0496104_0001537 Ga0496104_0001537_8051_9250 382
414 3300048908 Ga0496105_0007028 Ga0496105_0007028_5281_6480 382
415 3300048911 Ga0496108_0050933 Ga0496108_0050933_1938_3137 382
416 3300048913 Ga0496110_0000494 Ga0496110_0000494_14564_15763 382
417 3300048914 Ga0496111_0001864 Ga0496111_0001864_8800_9999 382
418 3300009036 Ga0105244_10002673 Ga0105244_100026739 383
419 3300009092 Ga0105250_10000978 Ga0105250_100009786 383
420 3300025711 Ga0207696_1000705 Ga0207696_100070521 383
421 3300025728 Ga0207655_1007119 Ga0207655_10071193 383
422 3300046542 Ga0495597_0002268 Ga0495597_0002268_3534_4706 383
423 3300046674 Ga0495588_0040800 Ga0495588_0040800_366_1538 383
424 3300047470 Ga0495681_0057945 Ga0495681_0057945_337_1509 383
425 iso_pu_bacteria 2904504865 2904509416 383
426 iso_pu_bacteria 2608642108 2608670337 384
427 iso_pu_bacteria 3000376612 3000377976 384
428 iso_pu_bacteria 2506520007 2506580024 385
429 iso_pu_bacteria 2506520008 2506585163 385
430 iso_pu_bacteria 2508501071 2508853824 385
431 iso_pu_bacteria 2511231025 2511378281 385
432 iso_pu_bacteria 2511231035 2511433527 385
433 iso_pu_bacteria 2537561728 2538428061 385
434 iso_pu_bacteria 2585427591 2585829104 385
435 iso_pu_bacteria 2585427592 2585833548 385
436 iso_pu_bacteria 2599185299 2599926882 385
437 iso_pu_bacteria 2648501693 2650896561 385
438 iso_pu_bacteria 2654587920 2656277070 385
439 iso_pu_bacteria 2667528173 2671110226 385
440 iso_pu_bacteria 2684622997 2686356811 385
441 iso_pu_bacteria 2687453601 2689446566 385
442 iso_pu_bacteria 2706794495 2707099506 385
443 iso_pu_bacteria 2772190666 2772440472 385
444 iso_pu_bacteria 2806310673 2807177394 385
445 iso_pu_bacteria 2808606414 2809127215 385
446 iso_pu_bacteria 2844528606 2844529428 385
447 iso_pu_bacteria 2847085930 2847086149 385
448 iso_pu_bacteria 2847797336 2847798596 385
449 iso_pu_bacteria 2852103415 2852104709 385
450 iso_pu_bacteria 2854601825 2854603889 385
451 iso_pu_bacteria 2855195626 2855196287 385
452 iso_pu_bacteria 2858466076 2858468154 385
453 iso_pu_bacteria 2865014394 2865017239 385
454 iso_pu_bacteria 2869551831 2869555918 385
455 iso_pu_bacteria 2871272651 2871274620 385
456 iso_pu_bacteria 2871282230 2871284550 385
457 iso_pu_bacteria 2876601092 2876602983 385
458 iso_pu_bacteria 2881609920 2881611680 385
459 iso_pu_bacteria 2888366609 2888370552 385
460 iso_pu_bacteria 2888373701 2888376978 385
461 iso_pu_bacteria 2904474040 2904478675 385
462 iso_pu_bacteria 2908669403 2908672802 385
463 iso_pu_bacteria 2919150387 2919154783 385
464 iso_pu_bacteria 2927143783 2927148217 385
465 iso_pu_bacteria 2932406140 2932410637 385
466 iso_pu_bacteria 2937967321 2937969049 385
467 iso_pu_bacteria 2939577877 2939582084 385
468 iso_pu_bacteria 2939602548 2939604242 385
469 iso_pu_bacteria 2945951305 2945951841 385
470 iso_pu_bacteria 2984494565 2984497925 385
471 iso_pu_bacteria 2990261002 2990265583 385
472 iso_pu_bacteria 640753048 640939295 385
473 iso_pu_bacteria 8004592986 8004594752 385
474 iso_pu_bacteria 8015394850 8015399201 385
475 iso_pu_bacteria 8016733728 8016734766 385
476 iso_pu_bacteria 8019499862 8019501757 385
477 iso_pu_bacteria 8055087960 8055088344 385
478 iso_pu_bacteria 8055092621 8055097039 385
479 iso_pu_bacteria 8055693939 8055694849 385
480 iso_pu_bacteria 2547132181 2547698090 386
481 iso_pu_bacteria 2554235234 2555258274 386
482 iso_pu_bacteria 2561511199 2562464045 386
483 iso_pu_bacteria 2599185169 2599412693 386
484 iso_pu_bacteria 2600255254 2601525807 386
485 iso_pu_bacteria 2600255255 2601528103 386
486 iso_pu_bacteria 2600255256 2601533183 386
487 iso_pu_bacteria 2600255257 2601538547 386
488 iso_pu_bacteria 2600255280 2601614937 386
489 iso_pu_bacteria 2600255281 2601620138 386
490 iso_pu_bacteria 2600255287 2601645922 386
491 iso_pu_bacteria 2600255288 2601648540 386
492 iso_pu_bacteria 2600255289 2601652992 386
493 iso_pu_bacteria 2600255290 2601658891 386
494 iso_pu_bacteria 2600255291 2601666088 386
495 iso_pu_bacteria 2600255298 2601698879 386
496 iso_pu_bacteria 2600255299 2601703957 386
497 iso_pu_bacteria 2600255300 2601705643 386
498 iso_pu_bacteria 2600255301 2601711232 386
499 iso_pu_bacteria 2600255302 2601716246 386
500 iso_pu_bacteria 2600255303 2601723891 386
501 iso_pu_bacteria 2600255304 2601726652 386
502 iso_pu_bacteria 2600255305 2601731192 386
503 iso_pu_bacteria 2600255306 2601736208 386
504 iso_pu_bacteria 2600255307 2601743559 386
505 iso_pu_bacteria 2600255309 2601754083 386
506 iso_pu_bacteria 2600255310 2601756896 386
507 iso_pu_bacteria 2600255311 2601761649 386
508 iso_pu_bacteria 2600255392 2602021291 386
509 iso_pu_bacteria 2602042046 2603641269 386
510 iso_pu_bacteria 2602042047 2603643864 386
511 iso_pu_bacteria 2602042052 2603658856 386
512 iso_pu_bacteria 2602042053 2603663644 386
513 iso_pu_bacteria 2602042066 2603700953 386
514 iso_pu_bacteria 2602042067 2603704358 386
515 iso_pu_bacteria 2602042103 2603838590 386
516 iso_pu_bacteria 2602042104 2603844156 386
517 iso_pu_bacteria 2602042105 2603848741 386
518 iso_pu_bacteria 2602042106 2603853814 386
519 iso_pu_bacteria 2602042109 2603865133 386
520 iso_pu_bacteria 2602042110 2603871866 386
521 iso_pu_bacteria 2602042111 2603879237 386
522 iso_pu_bacteria 2603880178 2606049054 386
523 iso_pu_bacteria 2603880184 2606068070 386
524 iso_pu_bacteria 2603880202 2606146732 386
525 iso_pu_bacteria 2603880211 2606176459 386
526 iso_pu_bacteria 2609459761 2609913080 386
527 iso_pu_bacteria 2636415599 2637223720 386
528 iso_pu_bacteria 2667528172 2671104160 386
529 iso_pu_bacteria 2671180115 2671586266 386
530 iso_pu_bacteria 2675903046 2676409704 386
531 iso_pu_bacteria 2681812866 2681998644 386
532 iso_pu_bacteria 2681812869 2682007720 386
533 iso_pu_bacteria 2711768156 2712472573 386
534 iso_pu_bacteria 2751185917 2753857280 386
535 iso_pu_bacteria 2765235842 2765590354 386
536 iso_pu_bacteria 2775506706 2775539901 386
537 iso_pu_bacteria 2775507074 2777020033 386
538 iso_pu_bacteria 2791354903 2791925453 386
539 iso_pu_bacteria 2791355010 2792314434 386
540 iso_pu_bacteria 2791355275 2793404398 386
541 iso_pu_bacteria 2811995292 2813727388 386
542 iso_pu_bacteria 2814123068 2814694919 386
543 iso_pu_bacteria 2821118458 2821120204 386
544 iso_pu_bacteria 2823373977 2823376016 386
545 iso_pu_bacteria 2844425489 2844428705 386
546 iso_pu_bacteria 2884086401 2884087500 386
547 iso_pu_bacteria 2891670763 2891673504 386
548 iso_pu_bacteria 2904513164 2904518085 386
549 iso_pu_bacteria 2919108558 2919114110 386
550 iso_pu_bacteria 2923634449 2923636245 386
551 iso_pu_bacteria 2927833300 2927837269 386
552 iso_pu_bacteria 2935625433 2935629052 386
553 iso_pu_bacteria 2937539931 2937543852 386
554 iso_pu_bacteria 2939568625 2939571021 386
555 iso_pu_bacteria 2939573065 2939577260 386
556 iso_pu_bacteria 2939607340 2939610100 386
557 iso_pu_bacteria 2939617950 2939621907 386
558 iso_pu_bacteria 2939642701 2939645124 386
559 iso_pu_bacteria 2945874760 2945876410 386
560 iso_pu_bacteria 2969079654 2969080751 386
561 iso_pu_bacteria 2971820967 2971822168 386
562 iso_pu_bacteria 2974310843 2974315435 386
563 iso_pu_bacteria 2974435778 2974439814 386
564 iso_pu_bacteria 2978975091 2978978377 386
565 iso_pu_bacteria 2984559226 2984563193 386
566 iso_pu_bacteria 2984595703 2984601250 386
567 iso_pu_bacteria 8018221730 8018225161 386
568 iso_pu_bacteria 8018405270 8018405450 386
569 iso_pu_bacteria 8019504834 8019509201 386
570 iso_pu_bacteria 8054844752 8054847786 386
571 iso_pu_bacteria 8054849141 8054851235 386
572 iso_pu_bacteria 8055097453 8055101011 386
573 iso_pu_bacteria 8057304971 8057305184 386
574 iso_pu_bacteria 2846540461 2846541492 388
575 3300002737 JGI25162J39368_1000043 JGI25162J39368_1000043159 389
576 3300002771 JGI25163J39215_1000011 JGI25163J39215_100001176 389
577 3300002772 JGI25164J39214_1000022 JGI25164J39214_10000229 389
578 3300003751 Ga0055538_1000040 Ga0055538_1000040159 389
579 3300003752 Ga0055539_1000052 Ga0055539_10000529 389
580 3300003756 Ga0055533_1000063 Ga0055533_1000063159 389
581 3300003759 Ga0055525_1000075 Ga0055525_10000759 389
582 3300003841 Ga0055541_1000039 Ga0055541_10000399 389
583 3300005289 Ga0065704_10001504 Ga0065704_1000150420 389
584 3300009036 Ga0105244_10000031 Ga0105244_10000031160 389
585 3300009036 Ga0105244_10000649 Ga0105244_100006499 389
586 3300009092 Ga0105250_10000764 Ga0105250_1000076411 389
587 3300013102 Ga0157371_10000152 Ga0157371_100001529 389
588 3300013104 Ga0157370_10003691 Ga0157370_1000369111 389
589 3300013306 Ga0163162_10049197 Ga0163162_100491972 389
590 3300025207 Ga0209760_100017 Ga0209760_100017159 389
591 3300025224 Ga0209784_100056 Ga0209784_1000569 389
592 3300025225 Ga0209566_100071 Ga0209566_1000719 389
593 3300025226 Ga0209674_100091 Ga0209674_100091159 389
594 3300025230 Ga0209563_100089 Ga0209563_1000899 389
595 3300025231 Ga0207427_100065 Ga0207427_100065159 389
596 3300025233 Ga0209437_100137 Ga0209437_100137159 389
597 3300025253 Ga0209677_100051 Ga0209677_100051159 389
598 3300025261 Ga0209233_1003413 Ga0209233_10034135 389
599 3300025711 Ga0207696_1000552 Ga0207696_100055219 389
600 3300025728 Ga0207655_1000029 Ga0207655_10000299 389
601 3300025728 Ga0207655_1003025 Ga0207655_100302510 389
602 3300041407 Ga0439447_026522 Ga0439447_026522_35_1207 389
603 3300042532 Ga0450893_0006869 Ga0450893_0006869_83_1258 389
604 3300046458 Ga0495591_008451 Ga0495591_008451_1596_2768 389
605 3300046471 Ga0495650_0000149 Ga0495650_0000149_148158_149330 389
606 3300046471 Ga0495650_0000219 Ga0495650_0000219_10193_11368 389
607 3300046491 Ga0495584_0020556 Ga0495584_0020556_936_2108 389
608 3300046501 Ga0495607_0014256 Ga0495607_0014256_3016_4188 389
609 3300046507 Ga0495606_0009468 Ga0495606_0009468_242_1414 389
610 3300046530 Ga0495654_0000055 Ga0495654_0000055_3258_4430 389
611 3300046692 Ga0495671_0004515 Ga0495671_0004515_3417_4589 389
612 3300046794 Ga0495589_0002257 Ga0495589_0002257_8571_9743 389
613 3300046810 Ga0495660_0000017 Ga0495660_0000017_308922_310094 389
614 3300046810 Ga0495660_0000039 Ga0495660_0000039_162046_163221 389
615 3300047320 Ga0495672_0000001 Ga0495672_0000001_1446924_1448096 389
616 3300047469 Ga0495673_0000019 Ga0495673_0000019_542736_543908 389
617 3300048907 Ga0496104_0002084 Ga0496104_0002084_7698_8873 389
618 3300048919 Ga0496116_0000115 Ga0496116_0000115_161884_163059 389
619 3300048920 Ga0496117_0005747 Ga0496117_0005747_1330_2505 389
620 3300048921 Ga0496118_0001813 Ga0496118_0001813_9061_10236 389
621 3300048921 Ga0496118_0068498 Ga0496118_0068498_1330_2505 389
622 3300048922 Ga0496119_0016843 Ga0496119_0016843_2124_3299 389
623 3300048923 Ga0496120_0013483 Ga0496120_0013483_2995_4170 389
624 3300048925 Ga0496122_0000124 Ga0496122_0000124_168237_169412 389
625 3300048926 Ga0496123_0000091 Ga0496123_0000091_10255_11430 389
626 3300048927 Ga0496124_0000464 Ga0496124_0000464_10216_11391 389
627 3300048928 Ga0496125_0000551 Ga0496125_0000551_53223_54398 389
628 3300048929 Ga0496126_0001614 Ga0496126_0001614_22769_23944 389
629 3300049460 Ga0495682_0000011 Ga0495682_0000011_10433_11605 389
630 3300053126 Ga0500621_000005 Ga0500621_000005_308326_309498 389
631 2162886007 SwRhRL2b_contig_2321501 SwRhRL2b_0883.00000940 390
632 3300003856 Ga0058692_1000705 Ga0058692_10007058 390
633 3300005289 Ga0065704_10000308 Ga0065704_1000030839 390
634 3300005548 Ga0070665_100000710 Ga0070665_10000071040 390
635 3300006051 Ga0075364_10011152 Ga0075364_100111523 390
636 3300006946 Ga0079104_1001057 Ga0079104_100105713 390
637 3300009011 Ga0105251_10004564 Ga0105251_1000456412 390
638 3300009011 Ga0105251_10006236 Ga0105251_100062362 390
639 3300009036 Ga0105244_10000212 Ga0105244_1000021261 390
640 3300009148 Ga0105243_10095530 Ga0105243_100955301 390
641 3300013104 Ga0157370_10008960 Ga0157370_100089605 390
642 3300015261 Ga0182006_1000069 Ga0182006_100006995 390
643 3300025728 Ga0207655_1000044 Ga0207655_1000044272 390
644 3300027111 Ga0209281_1000048 Ga0209281_1000048274 390
645 3300027111 Ga0209281_1000531 Ga0209281_10005311 390
646 3300027312 Ga0209371_1000816 Ga0209371_100081610 390
647 3300028379 Ga0268266_10000211 Ga0268266_1000021115 390
648 3300030500 Ga0268256_1000692 Ga0268256_100069223 390
649 3300042010 Ga0439452_000013 Ga0439452_000013_259202_260374 390
650 3300042010 Ga0439452_000094 Ga0439452_000094_8248_9420 390
651 3300046471 Ga0495650_0000059 Ga0495650_0000059_228024_229196 390
652 3300046530 Ga0495654_0073231 Ga0495654_0073231_354_1526 390
653 3300046660 Ga0495625_0003280 Ga0495625_0003280_8120_9292 390
654 3300047446 Ga0495679_000090 Ga0495679_000090_11395_12567 390
655 3300048919 Ga0496116_0004276 Ga0496116_0004276_7781_8953 390
656 3300048920 Ga0496117_0001214 Ga0496117_0001214_9440_10612 390
657 3300048921 Ga0496118_0001069 Ga0496118_0001069_8038_9210 390
658 3300048922 Ga0496119_0001968 Ga0496119_0001968_3648_4820 390
659 3300048923 Ga0496120_0012300 Ga0496120_0012300_756_1928 390
660 3300048924 Ga0496121_0005859 Ga0496121_0005859_3972_5144 390
661 3300048925 Ga0496122_0001525 Ga0496122_0001525_28168_29340 390
662 3300048926 Ga0496123_0002615 Ga0496123_0002615_13125_14297 390

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13533

Biotin_lipoyl_2

Biotin-lipoyl like

72

121

0.91

PF00529

CusB_dom_1

Cation efflux system protein CusB domain 1

39

359

0.89

PF13437

HlyD_3

HlyD family secretion protein

229

350

0.77

PF16576

HlyD_D23

Barrel-sandwich domain of CusB or HlyD membrane-fusion

67

305

0.75

Structural Annotation

Top 5 Hits

ID Description Score Start End
1cxz-assembly1.cif.gz_B crystal structure of human rhoa complexed with the effector domain of the protein kinase pkn/prk1 0.9053 117 188
3hb9-assembly1.cif.gz_B crystal structure of s. aureus pyruvate carboxylase a610t mutant 0.9003 63 93
3hb9-assembly1.cif.gz_A crystal structure of s. aureus pyruvate carboxylase a610t mutant 0.8905 63 246
8cwy-assembly1.cif.gz_H accurate computational design of genetically encoded 3d protein crystals 0.8899 115 184
8cwy-assembly1.cif.gz_L accurate computational design of genetically encoded 3d protein crystals 0.889 115 184
ID Description Score Start End Superfamily
4l8jA03 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9794 60 248 2.40.50.100
2f1mC03 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Helix hairpin bin 0.9637 117 186 1.10.287.470
2f1mD03 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Helix hairpin bin 0.9551 117 186 1.10.287.470
4tkoB02 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9535 60 247 2.40.50.100
1t5eG03 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Helix hairpin bin 0.9534 124 180 1.10.287.470
ID Description Score Start End GO Terms
AF-A0A849INA2-F1-model_v4 HlyD family efflux transporter periplasmic adaptor subunit 0.9249 11 388 GO:0016020
GO:0055085
AF-A0A849INA2-F1-model_v4 HlyD family efflux transporter periplasmic adaptor subunit 0.9202 11 388 GO:0016020
GO:0055085
AF-A0A2V4DZY5-F1-model_v4 Multidrug export protein EmrA 0.9016 1 388 GO:0016020
GO:0055085
AF-A0A7G8DH13-F1-model_v4 Efflux transporter/ RND family/ MFP subunit 0.8913 35 348 GO:0055085
AF-A0A2V4DZY5-F1-model_v4 Multidrug export protein EmrA 0.8843 1 388 GO:0016020
GO:0055085

Feature Viewer

pLDDT pTM Quality
85.73 0.7 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map