F473459
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 662 | 326 | 1324 | 151 |
Family's Representative Sequence
| Representative Sequence | 3300005436|Ga0070713_100670012|Ga0070713_1006700122 |
| Length | 179 |
| Sequence | MRLPRIRLRYHQIADVSAHIFETEPDVFTPKPIGFIRSPFSDTKSIPKGLGVRHDEEGILEILPEFEAGLTDVEGFSHLFVIWAFDRSEGYELFGRSPTDDRPHGVFATRSPRRPNPIALTVVELLGRDGRNLHVRGLDMLDGTPILDIKPYMSSIPAEKLRRGWLAEAEARTQNHPPR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 2 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 3 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 4 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 7 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 10 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 12 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 13 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 14 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 17 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 24 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 38 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 39 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 45 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 46 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 48 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 54 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 56 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 57 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 59 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 60 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 61 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 62 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 63 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 64 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 65 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 66 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 67 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 68 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 69 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 71 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 72 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 73 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 75 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 76 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 77 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 78 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 79 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 80 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 81 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 82 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 83 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 85 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 86 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 116 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 117 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 177 | 3300028017 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 | Metagenome | Rhizosphere |
| 178 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 182 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 183 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 184 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 185 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 186 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 187 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 188 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 189 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 190 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 191 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 192 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 193 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 194 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 195 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 196 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 197 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 198 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 199 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 200 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 201 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 202 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 203 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 204 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 205 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 206 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 207 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 208 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 209 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 210 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 211 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 212 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 213 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 214 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 215 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 216 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 217 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 218 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 219 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 220 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 221 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 222 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 223 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 224 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 225 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 226 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 227 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 228 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 229 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 230 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 231 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 232 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 233 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 234 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 235 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 236 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 237 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 238 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 239 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 240 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 241 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 242 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 243 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 244 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 245 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 246 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 247 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 248 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 249 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 250 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 251 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 252 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 253 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 289 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 290 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 291 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 292 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 293 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 294 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 295 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 296 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 297 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 298 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 299 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 300 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 301 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 302 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 303 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 304 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 305 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 306 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 307 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 308 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 309 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 310 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 311 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 312 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 313 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 314 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 315 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 316 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 317 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 318 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 319 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 320 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 321 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 322 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 323 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 325 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 326 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.55 |
| Metatranscriptomes | 0.45 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 3.02 |
| Rhizosphere | 96.37 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 30.82 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070713_100670012 | 3300005436 | Bacteria | 989 |
| 2 | rootH2_10085532 | 3300003320 | Bacteria | 3074 |
| 3 | Ga0065715_10246450 | 3300005293 | Bacteria | 1182 |
| 4 | Ga0070676_10034643 | 3300005328 | Bacteria | 2899 |
| 5 | Ga0070676_10744994 | 3300005328 | Bacteria | 719 |
| 6 | Ga0070676_11078056 | 3300005328 | Unclassified | 606 |
| 7 | Ga0070683_100097847 | 3300005329 | Bacteria | 2761 |
| 8 | Ga0070683_100655116 | 3300005329 | Unclassified | 1005 |
| 9 | Ga0070690_100128125 | 3300005330 | Bacteria | 1711 |
| 10 | Ga0070690_100248171 | 3300005330 | Unclassified | 1258 |
| 11 | Ga0070690_100358922 | 3300005330 | Bacteria | 1060 |
| 12 | Ga0070690_100816328 | 3300005330 | Bacteria | 724 |
| 13 | Ga0070670_100060133 | 3300005331 | Bacteria | 3262 |
| 14 | Ga0070677_10238268 | 3300005333 | Bacteria | 897 |
| 15 | Ga0068869_100005467 | 3300005334 | Bacteria | 7995 |
| 16 | Ga0068869_100093110 | 3300005334 | Unclassified | 2270 |
| 17 | Ga0068869_100476627 | 3300005334 | Bacteria | 1038 |
| 18 | Ga0068869_100921282 | 3300005334 | Bacteria | 757 |
| 19 | Ga0068869_101255585 | 3300005334 | Bacteria | 652 |
| 20 | Ga0070666_10085837 | 3300005335 | Unclassified | 2156 |
| 21 | Ga0070680_100496259 | 3300005336 | Bacteria | 1044 |
| 22 | Ga0068868_100066043 | 3300005338 | Unclassified | 2875 |
| 23 | Ga0068868_100124237 | 3300005338 | Bacteria | 2107 |
| 24 | Ga0070689_100427196 | 3300005340 | Bacteria | 1124 |
| 25 | Ga0070689_100429499 | 3300005340 | Unclassified | 1121 |
| 26 | Ga0070687_100049971 | 3300005343 | Unclassified | 2158 |
| 27 | Ga0070661_100166120 | 3300005344 | Unclassified | 1674 |
| 28 | Ga0070692_10431158 | 3300005345 | Bacteria | 839 |
| 29 | Ga0070668_100022053 | 3300005347 | Bacteria | 4814 |
| 30 | Ga0070668_100615775 | 3300005347 | Bacteria | 951 |
| 31 | Ga0070669_100057581 | 3300005353 | Unclassified | 2852 |
| 32 | Ga0070669_101250220 | 3300005353 | Unclassified | 642 |
| 33 | Ga0070669_101687282 | 3300005353 | Unclassified | 552 |
| 34 | Ga0070675_100497006 | 3300005354 | Bacteria | 1099 |
| 35 | Ga0070671_100276857 | 3300005355 | Unclassified | 1427 |
| 36 | Ga0070674_101309702 | 3300005356 | Bacteria | 646 |
| 37 | Ga0070673_100059045 | 3300005364 | Bacteria | 3035 |
| 38 | Ga0070673_100908188 | 3300005364 | Bacteria | 817 |
| 39 | Ga0070688_101682743 | 3300005365 | Unclassified | 519 |
| 40 | Ga0070659_100475802 | 3300005366 | Unclassified | 1062 |
| 41 | Ga0070667_100125513 | 3300005367 | Unclassified | 2236 |
| 42 | Ga0070667_100493239 | 3300005367 | Bacteria | 1122 |
| 43 | Ga0070703_10002836 | 3300005406 | Bacteria | 4965 |
| 44 | Ga0070709_10000250 | 3300005434 | Bacteria | 34637 |
| 45 | Ga0070709_10059174 | 3300005434 | Bacteria | 2432 |
| 46 | Ga0070709_10145679 | 3300005434 | Unclassified | 1632 |
| 47 | Ga0070714_100107984 | 3300005435 | Bacteria | 2460 |
| 48 | Ga0070713_100060680 | 3300005436 | Bacteria | 3162 |
| 49 | Ga0070713_100075720 | 3300005436 | Bacteria | 2855 |
| 50 | Ga0070713_100091430 | 3300005436 | Bacteria | 2618 |
| 51 | Ga0070713_100099400 | 3300005436 | Bacteria | 2517 |
| 52 | Ga0070713_100144595 | 3300005436 | Bacteria | 2110 |
| 53 | Ga0070713_100208276 | 3300005436 | Bacteria | 1769 |
| 54 | Ga0070710_10546526 | 3300005437 | Unclassified | 799 |
| 55 | Ga0070701_10963597 | 3300005438 | Bacteria | 593 |
| 56 | Ga0070711_100000033 | 3300005439 | Bacteria | 96416 |
| 57 | Ga0070711_100052104 | 3300005439 | Bacteria | 2815 |
| 58 | Ga0070711_100364898 | 3300005439 | Unclassified | 1164 |
| 59 | Ga0070711_100742404 | 3300005439 | Unclassified | 829 |
| 60 | Ga0070711_100756111 | 3300005439 | Unclassified | 822 |
| 61 | Ga0070694_100083845 | 3300005444 | Bacteria | 2222 |
| 62 | Ga0070694_100176160 | 3300005444 | Bacteria | 1579 |
| 63 | Ga0070708_100041728 | 3300005445 | Bacteria | 4024 |
| 64 | Ga0070708_100042781 | 3300005445 | Unclassified | 3978 |
| 65 | Ga0070708_100073053 | 3300005445 | Unclassified | 3091 |
| 66 | Ga0070708_100145805 | 3300005445 | Unclassified | 2199 |
| 67 | Ga0070708_100412548 | 3300005445 | Bacteria | 1274 |
| 68 | Ga0070708_100424049 | 3300005445 | Bacteria | 1255 |
| 69 | Ga0070663_100305995 | 3300005455 | Unclassified | 1274 |
| 70 | Ga0070678_100015221 | 3300005456 | Bacteria | 4882 |
| 71 | Ga0070662_100026776 | 3300005457 | Bacteria | 3996 |
| 72 | Ga0070662_100293232 | 3300005457 | Bacteria | 1319 |
| 73 | Ga0070681_10437735 | 3300005458 | Bacteria | 1219 |
| 74 | Ga0070681_11228005 | 3300005458 | Unclassified | 672 |
| 75 | Ga0068867_100103336 | 3300005459 | Unclassified | 2179 |
| 76 | Ga0068867_100138685 | 3300005459 | Bacteria | 1899 |
| 77 | Ga0068867_101546141 | 3300005459 | Bacteria | 619 |
| 78 | Ga0070685_10095715 | 3300005466 | Bacteria | 1805 |
| 79 | Ga0070685_10890084 | 3300005466 | Unclassified | 662 |
| 80 | Ga0070706_100070491 | 3300005467 | Bacteria | 3232 |
| 81 | Ga0070706_100330166 | 3300005467 | Unclassified | 1422 |
| 82 | Ga0070706_100509565 | 3300005467 | Bacteria | 1119 |
| 83 | Ga0070707_100084854 | 3300005468 | Bacteria | 3060 |
| 84 | Ga0070707_100291674 | 3300005468 | Bacteria | 1585 |
| 85 | Ga0070707_101081909 | 3300005468 | Unclassified | 768 |
| 86 | Ga0070698_101887279 | 3300005471 | Bacteria | 550 |
| 87 | Ga0070699_100029893 | 3300005518 | Bacteria | 4700 |
| 88 | Ga0070699_100732803 | 3300005518 | Bacteria | 904 |
| 89 | Ga0070699_101438865 | 3300005518 | Bacteria | 632 |
| 90 | Ga0070679_100032076 | 3300005530 | Bacteria | 5195 |
| 91 | Ga0070679_100808449 | 3300005530 | Unclassified | 881 |
| 92 | Ga0070679_100819995 | 3300005530 | Bacteria | 873 |
| 93 | Ga0068853_100434148 | 3300005539 | Bacteria | 1233 |
| 94 | Ga0068853_100765974 | 3300005539 | Bacteria | 923 |
| 95 | Ga0068853_101486141 | 3300005539 | Unclassified | 656 |
| 96 | Ga0070672_100014202 | 3300005543 | Bacteria | 5636 |
| 97 | Ga0070672_100241340 | 3300005543 | Unclassified | 1520 |
| 98 | Ga0070686_101585218 | 3300005544 | Unclassified | 554 |
| 99 | Ga0070695_100169161 | 3300005545 | Unclassified | 1541 |
| 100 | Ga0070695_100643904 | 3300005545 | Bacteria | 836 |
| 101 | Ga0070696_100296932 | 3300005546 | Bacteria | 1236 |
| 102 | Ga0070693_100124956 | 3300005547 | Bacteria | 1600 |
| 103 | Ga0070665_100015116 | 3300005548 | Bacteria | 7749 |
| 104 | Ga0070665_100039108 | 3300005548 | Bacteria | 4770 |
| 105 | Ga0070665_100040315 | 3300005548 | Bacteria | 4694 |
| 106 | Ga0070665_100275766 | 3300005548 | Unclassified | 1683 |
| 107 | Ga0070665_100792590 | 3300005548 | Bacteria | 961 |
| 108 | Ga0070665_101513776 | 3300005548 | Bacteria | 679 |
| 109 | Ga0070665_101573026 | 3300005548 | Bacteria | 665 |
| 110 | Ga0070704_100040716 | 3300005549 | Bacteria | 3201 |
| 111 | Ga0070704_100222732 | 3300005549 | Bacteria | 1534 |
| 112 | Ga0068855_100254763 | 3300005563 | Unclassified | 1957 |
| 113 | Ga0068855_100540726 | 3300005563 | Bacteria | 1262 |
| 114 | Ga0068855_102505832 | 3300005563 | Unclassified | 513 |
| 115 | Ga0070664_100040984 | 3300005564 | Unclassified | 3906 |
| 116 | Ga0068854_100052824 | 3300005578 | Bacteria | 2916 |
| 117 | Ga0068854_100080198 | 3300005578 | Unclassified | 2408 |
| 118 | Ga0068854_100136990 | 3300005578 | Bacteria | 1875 |
| 119 | Ga0068856_100199121 | 3300005614 | Unclassified | 2017 |
| 120 | Ga0070702_100479422 | 3300005615 | Unclassified | 909 |
| 121 | Ga0068852_100477501 | 3300005616 | Unclassified | 1238 |
| 122 | Ga0068859_100009935 | 3300005617 | Bacteria | 9602 |
| 123 | Ga0068859_100112478 | 3300005617 | Unclassified | 2786 |
| 124 | Ga0068859_100179501 | 3300005617 | Unclassified | 2200 |
| 125 | Ga0068859_100661523 | 3300005617 | Bacteria | 1136 |
| 126 | Ga0068864_100018082 | 3300005618 | Bacteria | 5883 |
| 127 | Ga0068864_100084274 | 3300005618 | Bacteria | 2792 |
| 128 | Ga0068861_100081493 | 3300005719 | Bacteria | 2534 |
| 129 | Ga0068861_100089962 | 3300005719 | Bacteria | 2420 |
| 130 | Ga0068861_100166290 | 3300005719 | Bacteria | 1824 |
| 131 | Ga0068861_100370937 | 3300005719 | Unclassified | 1261 |
| 132 | Ga0068851_10069941 | 3300005834 | Bacteria | 1814 |
| 133 | Ga0068851_10287614 | 3300005834 | Unclassified | 942 |
| 134 | Ga0068870_10386987 | 3300005840 | Bacteria | 907 |
| 135 | Ga0068863_100042774 | 3300005841 | Bacteria | 4304 |
| 136 | Ga0068863_100063715 | 3300005841 | Bacteria | 3487 |
| 137 | Ga0068863_100537283 | 3300005841 | Bacteria | 1153 |
| 138 | Ga0068863_100641902 | 3300005841 | Bacteria | 1052 |
| 139 | Ga0068858_100001405 | 3300005842 | Bacteria | 24749 |
| 140 | Ga0068858_100066618 | 3300005842 | Bacteria | 3334 |
| 141 | Ga0068858_100098885 | 3300005842 | Bacteria | 2720 |
| 142 | Ga0068858_100614211 | 3300005842 | Bacteria | 1055 |
| 143 | Ga0068860_100193650 | 3300005843 | Bacteria | 1968 |
| 144 | Ga0068860_100222464 | 3300005843 | Bacteria | 1833 |
| 145 | Ga0068860_100405805 | 3300005843 | Unclassified | 1349 |
| 146 | Ga0068860_100839712 | 3300005843 | Bacteria | 933 |
| 147 | Ga0068860_101526656 | 3300005843 | Bacteria | 690 |
| 148 | Ga0068862_100059209 | 3300005844 | Bacteria | 3289 |
| 149 | Ga0081538_10008982 | 3300005981 | Bacteria | 8397 |
| 150 | Ga0070717_10428636 | 3300006028 | Unclassified | 1190 |
| 151 | Ga0070717_10450964 | 3300006028 | Unclassified | 1159 |
| 152 | Ga0070715_10649950 | 3300006163 | Unclassified | 624 |
| 153 | Ga0070716_100277021 | 3300006173 | Bacteria | 1156 |
| 154 | Ga0070716_101440392 | 3300006173 | Bacteria | 561 |
| 155 | Ga0070712_100057634 | 3300006175 | Bacteria | 2730 |
| 156 | Ga0070712_100187696 | 3300006175 | Unclassified | 1615 |
| 157 | Ga0070712_100216073 | 3300006175 | Bacteria | 1515 |
| 158 | Ga0070712_100487773 | 3300006175 | Unclassified | 1031 |
| 159 | Ga0070712_101498772 | 3300006175 | Unclassified | 589 |
| 160 | Ga0097621_100122815 | 3300006237 | Bacteria | 2204 |
| 161 | Ga0097621_100733565 | 3300006237 | Unclassified | 911 |
| 162 | Ga0068871_100110392 | 3300006358 | Bacteria | 2313 |
| 163 | Ga0068871_100117993 | 3300006358 | Unclassified | 2238 |
| 164 | Ga0068871_100151757 | 3300006358 | Bacteria | 1976 |
| 165 | Ga0068871_100316773 | 3300006358 | Bacteria | 1372 |
| 166 | Ga0075428_100008720 | 3300006844 | Bacteria | 11251 |
| 167 | Ga0075428_100093108 | 3300006844 | Bacteria | 3285 |
| 168 | Ga0075428_101184426 | 3300006844 | Bacteria | 806 |
| 169 | Ga0075430_100539449 | 3300006846 | Bacteria | 962 |
| 170 | Ga0075431_100705185 | 3300006847 | Bacteria | 987 |
| 171 | Ga0075433_10068656 | 3300006852 | Bacteria | 3112 |
| 172 | Ga0075433_10225145 | 3300006852 | Bacteria | 1666 |
| 173 | Ga0075433_10262857 | 3300006852 | Unclassified | 1530 |
| 174 | Ga0075434_100000744 | 3300006871 | Bacteria | 25604 |
| 175 | Ga0075434_100166897 | 3300006871 | Unclassified | 2221 |
| 176 | Ga0075434_100334109 | 3300006871 | Unclassified | 1536 |
| 177 | Ga0075434_100352794 | 3300006871 | Bacteria | 1492 |
| 178 | Ga0075429_100325105 | 3300006880 | Bacteria | 1346 |
| 179 | Ga0075429_100548435 | 3300006880 | Bacteria | 1013 |
| 180 | Ga0075429_100869179 | 3300006880 | Bacteria | 789 |
| 181 | Ga0068865_100054547 | 3300006881 | Bacteria | 2778 |
| 182 | Ga0068865_100058065 | 3300006881 | Bacteria | 2702 |
| 183 | Ga0075436_100002464 | 3300006914 | Bacteria | 12739 |
| 184 | Ga0075436_100007793 | 3300006914 | Bacteria | 7324 |
| 185 | Ga0075436_100232278 | 3300006914 | Bacteria | 1310 |
| 186 | Ga0075436_100239158 | 3300006914 | Bacteria | 1291 |
| 187 | Ga0075436_100488597 | 3300006914 | Bacteria | 900 |
| 188 | Ga0075436_100680117 | 3300006914 | Bacteria | 761 |
| 189 | Ga0097620_100009935 | 3300006931 | Bacteria | 9602 |
| 190 | Ga0097620_100112483 | 3300006931 | Unclassified | 2786 |
| 191 | Ga0097620_100179499 | 3300006931 | Unclassified | 2200 |
| 192 | Ga0097620_100661584 | 3300006931 | Bacteria | 1136 |
| 193 | Ga0075435_100000431 | 3300007076 | Bacteria | 25670 |
| 194 | Ga0075435_101051670 | 3300007076 | Unclassified | 711 |
| 195 | Ga0099795_10381207 | 3300007788 | Unclassified | 637 |
| 196 | Ga0105251_10405448 | 3300009011 | Unclassified | 627 |
| 197 | Ga0105240_10026251 | 3300009093 | Bacteria | 7640 |
| 198 | Ga0105240_10045482 | 3300009093 | Bacteria | 5568 |
| 199 | Ga0105240_10060972 | 3300009093 | Unclassified | 4702 |
| 200 | Ga0105240_10064011 | 3300009093 | Unclassified | 4571 |
| 201 | Ga0105240_10102031 | 3300009093 | Bacteria | 3487 |
| 202 | Ga0105240_10105507 | 3300009093 | Bacteria | 3421 |
| 203 | Ga0105240_10136719 | 3300009093 | Bacteria | 2934 |
| 204 | Ga0105240_10197925 | 3300009093 | Bacteria | 2357 |
| 205 | Ga0105240_10560609 | 3300009093 | Unclassified | 1263 |
| 206 | Ga0105240_10727859 | 3300009093 | Bacteria | 1080 |
| 207 | Ga0111539_10120674 | 3300009094 | Bacteria | 3072 |
| 208 | Ga0111539_10127899 | 3300009094 | Bacteria | 2975 |
| 209 | Ga0111539_11037600 | 3300009094 | Bacteria | 953 |
| 210 | Ga0105245_10470286 | 3300009098 | Unclassified | 1269 |
| 211 | Ga0105247_10061933 | 3300009101 | Bacteria | 2320 |
| 212 | Ga0105247_10071727 | 3300009101 | Bacteria | 2167 |
| 213 | Ga0105247_10361665 | 3300009101 | Unclassified | 1024 |
| 214 | Ga0114129_10007878 | 3300009147 | Bacteria | 15157 |
| 215 | Ga0114129_10025007 | 3300009147 | Bacteria | 8465 |
| 216 | Ga0114129_10033701 | 3300009147 | Bacteria | 7236 |
| 217 | Ga0114129_10099732 | 3300009147 | Bacteria | 4019 |
| 218 | Ga0114129_10212585 | 3300009147 | Unclassified | 2614 |
| 219 | Ga0105243_10393433 | 3300009148 | Unclassified | 1285 |
| 220 | Ga0105243_10761067 | 3300009148 | Unclassified | 950 |
| 221 | Ga0105241_10280405 | 3300009174 | Unclassified | 1423 |
| 222 | Ga0105241_10698597 | 3300009174 | Unclassified | 926 |
| 223 | Ga0105241_10841808 | 3300009174 | Unclassified | 848 |
| 224 | Ga0105241_11412639 | 3300009174 | Bacteria | 667 |
| 225 | Ga0105242_10249910 | 3300009176 | Bacteria | 1597 |
| 226 | Ga0105248_10227467 | 3300009177 | Unclassified | 2100 |
| 227 | Ga0105248_10262955 | 3300009177 | Unclassified | 1942 |
| 228 | Ga0105248_10351173 | 3300009177 | Bacteria | 1660 |
| 229 | Ga0105237_10258360 | 3300009545 | Unclassified | 1744 |
| 230 | Ga0105237_10348530 | 3300009545 | Bacteria | 1485 |
| 231 | Ga0105237_10515342 | 3300009545 | Unclassified | 1202 |
| 232 | Ga0105238_10193154 | 3300009551 | Unclassified | 2011 |
| 233 | Ga0105249_10654019 | 3300009553 | Bacteria | 1109 |
| 234 | Ga0105239_10351505 | 3300010375 | Unclassified | 1664 |
| 235 | Ga0105246_10011856 | 3300011119 | Bacteria | 5421 |
| 236 | Ga0105246_10348653 | 3300011119 | Bacteria | 1212 |
| 237 | Ga0105246_11508314 | 3300011119 | Unclassified | 632 |
| 238 | Ga0157373_10131399 | 3300013100 | Bacteria | 1761 |
| 239 | Ga0157373_10515492 | 3300013100 | Unclassified | 865 |
| 240 | Ga0157370_10187656 | 3300013104 | Bacteria | 1919 |
| 241 | Ga0157369_10032326 | 3300013105 | Bacteria | 5755 |
| 242 | Ga0157369_10394915 | 3300013105 | Bacteria | 1435 |
| 243 | Ga0157369_10715344 | 3300013105 | Bacteria | 1031 |
| 244 | Ga0157369_10728378 | 3300013105 | Bacteria | 1021 |
| 245 | Ga0157369_10965625 | 3300013105 | Unclassified | 873 |
| 246 | Ga0157369_11102128 | 3300013105 | Bacteria | 811 |
| 247 | Ga0157369_12518417 | 3300013105 | Bacteria | 521 |
| 248 | Ga0157374_10000012 | 3300013296 | Bacteria | 462353 |
| 249 | Ga0157374_10008262 | 3300013296 | Bacteria | 8886 |
| 250 | Ga0157374_10101058 | 3300013296 | Bacteria | 2765 |
| 251 | Ga0157378_10045451 | 3300013297 | Unclassified | 3902 |
| 252 | Ga0157378_10075246 | 3300013297 | Bacteria | 3039 |
| 253 | Ga0157378_10370536 | 3300013297 | Unclassified | 1404 |
| 254 | Ga0163162_10039775 | 3300013306 | Bacteria | 4700 |
| 255 | Ga0157372_10042968 | 3300013307 | Bacteria | 5002 |
| 256 | Ga0157372_10170903 | 3300013307 | Bacteria | 2515 |
| 257 | Ga0157372_10221865 | 3300013307 | Bacteria | 2191 |
| 258 | Ga0157372_10619390 | 3300013307 | Bacteria | 1261 |
| 259 | Ga0157375_10027800 | 3300013308 | Bacteria | 5292 |
| 260 | Ga0157375_10125011 | 3300013308 | Bacteria | 2686 |
| 261 | Ga0157375_10178203 | 3300013308 | Unclassified | 2276 |
| 262 | Ga0157375_12148333 | 3300013308 | Bacteria | 665 |
| 263 | Ga0163163_10194094 | 3300014325 | Bacteria | 2078 |
| 264 | Ga0163163_11108886 | 3300014325 | Bacteria | 854 |
| 265 | Ga0163163_12076414 | 3300014325 | Bacteria | 628 |
| 266 | Ga0157380_10003291 | 3300014326 | Bacteria | 11079 |
| 267 | Ga0157380_10380409 | 3300014326 | Bacteria | 1332 |
| 268 | Ga0157380_10473235 | 3300014326 | Bacteria | 1209 |
| 269 | Ga0157377_10000002 | 3300014745 | Bacteria | 473827 |
| 270 | Ga0157377_10037084 | 3300014745 | Bacteria | 2685 |
| 271 | Ga0157379_10045284 | 3300014968 | Bacteria | 3927 |
| 272 | Ga0157379_10165911 | 3300014968 | Unclassified | 1993 |
| 273 | Ga0157379_10237593 | 3300014968 | Bacteria | 1652 |
| 274 | Ga0157379_10534938 | 3300014968 | Bacteria | 1089 |
| 275 | Ga0157376_10004945 | 3300014969 | Bacteria | 9295 |
| 276 | Ga0157376_10282425 | 3300014969 | Unclassified | 1564 |
| 277 | Ga0157376_10330733 | 3300014969 | Unclassified | 1452 |
| 278 | Ga0157376_10534881 | 3300014969 | Bacteria | 1157 |
| 279 | Ga0163161_10109075 | 3300017792 | Unclassified | 2067 |
| 280 | Ga0206356_11700659 | 3300020070 | Unclassified | 1703 |
| 281 | Ga0154015_1668427 | 3300020610 | Unclassified | 1057 |
| 282 | Ga0207697_10198669 | 3300025315 | Bacteria | 882 |
| 283 | Ga0207656_10224591 | 3300025321 | Unclassified | 914 |
| 284 | Ga0207653_10100187 | 3300025885 | Unclassified | 1024 |
| 285 | Ga0207710_10042921 | 3300025900 | Unclassified | 2010 |
| 286 | Ga0207680_10077430 | 3300025903 | Unclassified | 2080 |
| 287 | Ga0207647_10012485 | 3300025904 | Bacteria | 5912 |
| 288 | Ga0207647_10029739 | 3300025904 | Bacteria | 3530 |
| 289 | Ga0207685_10209262 | 3300025905 | Bacteria | 921 |
| 290 | Ga0207699_10000211 | 3300025906 | Bacteria | 34696 |
| 291 | Ga0207699_10389236 | 3300025906 | Unclassified | 991 |
| 292 | Ga0207699_10837128 | 3300025906 | Unclassified | 677 |
| 293 | Ga0207645_10023188 | 3300025907 | Unclassified | 4034 |
| 294 | Ga0207645_10603606 | 3300025907 | Unclassified | 745 |
| 295 | Ga0207643_10147042 | 3300025908 | Unclassified | 1410 |
| 296 | Ga0207684_10033929 | 3300025910 | Bacteria | 4340 |
| 297 | Ga0207684_10422153 | 3300025910 | Unclassified | 1146 |
| 298 | Ga0207684_10440598 | 3300025910 | Bacteria | 1119 |
| 299 | Ga0207654_10647805 | 3300025911 | Unclassified | 756 |
| 300 | Ga0207654_10716541 | 3300025911 | Unclassified | 719 |
| 301 | Ga0207707_10183980 | 3300025912 | Unclassified | 1823 |
| 302 | Ga0207707_10618513 | 3300025912 | Bacteria | 915 |
| 303 | Ga0207707_10849887 | 3300025912 | Unclassified | 757 |
| 304 | Ga0207695_10004762 | 3300025913 | Bacteria | 18353 |
| 305 | Ga0207695_10013190 | 3300025913 | Bacteria | 9862 |
| 306 | Ga0207695_10171806 | 3300025913 | Bacteria | 2093 |
| 307 | Ga0207695_10292793 | 3300025913 | Unclassified | 1520 |
| 308 | Ga0207695_10300996 | 3300025913 | Unclassified | 1495 |
| 309 | Ga0207695_11154471 | 3300025913 | Bacteria | 655 |
| 310 | Ga0207695_11175183 | 3300025913 | Unclassified | 647 |
| 311 | Ga0207671_10155543 | 3300025914 | Unclassified | 1768 |
| 312 | Ga0207671_11483705 | 3300025914 | Unclassified | 524 |
| 313 | Ga0207693_10275503 | 3300025915 | Bacteria | 1318 |
| 314 | Ga0207663_10000026 | 3300025916 | Bacteria | 109142 |
| 315 | Ga0207663_10185054 | 3300025916 | Bacteria | 1491 |
| 316 | Ga0207660_10033655 | 3300025917 | Bacteria | 3547 |
| 317 | Ga0207660_10175225 | 3300025917 | Unclassified | 1662 |
| 318 | Ga0207662_10303789 | 3300025918 | Unclassified | 1061 |
| 319 | Ga0207657_10725535 | 3300025919 | Bacteria | 771 |
| 320 | Ga0207652_10013216 | 3300025921 | Bacteria | 6685 |
| 321 | Ga0207652_10509954 | 3300025921 | Unclassified | 1082 |
| 322 | Ga0207646_10147315 | 3300025922 | Bacteria | 2122 |
| 323 | Ga0207646_10248548 | 3300025922 | Bacteria | 1606 |
| 324 | Ga0207681_10041686 | 3300025923 | Unclassified | 3062 |
| 325 | Ga0207681_10107477 | 3300025923 | Bacteria | 2024 |
| 326 | Ga0207694_10041708 | 3300025924 | Bacteria | 3537 |
| 327 | Ga0207694_10396121 | 3300025924 | Unclassified | 1148 |
| 328 | Ga0207650_10721931 | 3300025925 | Bacteria | 842 |
| 329 | Ga0207650_11807293 | 3300025925 | Unclassified | 517 |
| 330 | Ga0207659_10369415 | 3300025926 | Bacteria | 1194 |
| 331 | Ga0207687_10303974 | 3300025927 | Unclassified | 1286 |
| 332 | Ga0207687_10345468 | 3300025927 | Bacteria | 1211 |
| 333 | Ga0207700_10010649 | 3300025928 | Bacteria | 5816 |
| 334 | Ga0207700_10072072 | 3300025928 | Bacteria | 2663 |
| 335 | Ga0207700_10155491 | 3300025928 | Unclassified | 1894 |
| 336 | Ga0207700_10252992 | 3300025928 | Unclassified | 1506 |
| 337 | Ga0207700_10281862 | 3300025928 | Bacteria | 1430 |
| 338 | Ga0207700_11393785 | 3300025928 | Unclassified | 623 |
| 339 | Ga0207664_10072541 | 3300025929 | Unclassified | 2776 |
| 340 | Ga0207664_10093662 | 3300025929 | Bacteria | 2468 |
| 341 | Ga0207664_10478985 | 3300025929 | Bacteria | 1113 |
| 342 | Ga0207644_10122462 | 3300025931 | Bacteria | 1982 |
| 343 | Ga0207690_11818500 | 3300025932 | Unclassified | 509 |
| 344 | Ga0207706_10015660 | 3300025933 | Bacteria | 6852 |
| 345 | Ga0207706_10026970 | 3300025933 | Bacteria | 5139 |
| 346 | Ga0207706_10099176 | 3300025933 | Unclassified | 2563 |
| 347 | Ga0207686_10207706 | 3300025934 | Bacteria | 1406 |
| 348 | Ga0207670_10200755 | 3300025936 | Bacteria | 1515 |
| 349 | Ga0207670_10547877 | 3300025936 | Unclassified | 945 |
| 350 | Ga0207670_11652365 | 3300025936 | Unclassified | 545 |
| 351 | Ga0207669_10184530 | 3300025937 | Bacteria | 1499 |
| 352 | Ga0207704_10015609 | 3300025938 | Bacteria | 3876 |
| 353 | Ga0207704_10043693 | 3300025938 | Bacteria | 2648 |
| 354 | Ga0207665_10027600 | 3300025939 | Bacteria | 3750 |
| 355 | Ga0207665_10033120 | 3300025939 | Bacteria | 3424 |
| 356 | Ga0207665_10257559 | 3300025939 | Unclassified | 1291 |
| 357 | Ga0207665_10363618 | 3300025939 | Bacteria | 1095 |
| 358 | Ga0207691_10021009 | 3300025940 | Bacteria | 6170 |
| 359 | Ga0207691_10394681 | 3300025940 | Bacteria | 1180 |
| 360 | Ga0207711_10081570 | 3300025941 | Bacteria | 2826 |
| 361 | Ga0207711_10238087 | 3300025941 | Unclassified | 1668 |
| 362 | Ga0207711_10345333 | 3300025941 | Unclassified | 1378 |
| 363 | Ga0207689_10000308 | 3300025942 | Bacteria | 44966 |
| 364 | Ga0207689_10130099 | 3300025942 | Unclassified | 2071 |
| 365 | Ga0207689_10456336 | 3300025942 | Bacteria | 1068 |
| 366 | Ga0207689_10571830 | 3300025942 | Bacteria | 950 |
| 367 | Ga0207661_10152928 | 3300025944 | Bacteria | 1996 |
| 368 | Ga0207661_11180320 | 3300025944 | Bacteria | 704 |
| 369 | Ga0207661_11506382 | 3300025944 | Unclassified | 616 |
| 370 | Ga0207679_10120291 | 3300025945 | Unclassified | 2089 |
| 371 | Ga0207679_10431106 | 3300025945 | Unclassified | 1165 |
| 372 | Ga0207667_10030353 | 3300025949 | Bacteria | 5849 |
| 373 | Ga0207667_10259613 | 3300025949 | Bacteria | 1776 |
| 374 | Ga0207667_10346702 | 3300025949 | Unclassified | 1515 |
| 375 | Ga0207667_10750867 | 3300025949 | Unclassified | 975 |
| 376 | Ga0207651_10013432 | 3300025960 | Bacteria | 4688 |
| 377 | Ga0207651_10225860 | 3300025960 | Bacteria | 1517 |
| 378 | Ga0207668_10085732 | 3300025972 | Unclassified | 2299 |
| 379 | Ga0207640_10039857 | 3300025981 | Bacteria | 2977 |
| 380 | Ga0207640_10101791 | 3300025981 | Unclassified | 2016 |
| 381 | Ga0207658_10093908 | 3300025986 | Bacteria | 2333 |
| 382 | Ga0207658_10681497 | 3300025986 | Unclassified | 928 |
| 383 | Ga0207677_10101266 | 3300026023 | Bacteria | 2120 |
| 384 | Ga0207677_10123900 | 3300026023 | Unclassified | 1949 |
| 385 | Ga0207703_10006087 | 3300026035 | Bacteria | 9648 |
| 386 | Ga0207703_10048250 | 3300026035 | Bacteria | 3436 |
| 387 | Ga0207703_10794365 | 3300026035 | Bacteria | 903 |
| 388 | Ga0207639_10000198 | 3300026041 | Bacteria | 45415 |
| 389 | Ga0207639_10279489 | 3300026041 | Unclassified | 1468 |
| 390 | Ga0207678_10314968 | 3300026067 | Unclassified | 1346 |
| 391 | Ga0207708_10090653 | 3300026075 | Bacteria | 2356 |
| 392 | Ga0207702_10186310 | 3300026078 | Bacteria | 1914 |
| 393 | Ga0207702_11705649 | 3300026078 | Unclassified | 623 |
| 394 | Ga0207641_10097525 | 3300026088 | Unclassified | 2584 |
| 395 | Ga0207641_10107912 | 3300026088 | Bacteria | 2463 |
| 396 | Ga0207676_10068233 | 3300026095 | Bacteria | 2843 |
| 397 | Ga0207676_10167398 | 3300026095 | Unclassified | 1911 |
| 398 | Ga0207676_10170094 | 3300026095 | Unclassified | 1897 |
| 399 | Ga0207676_10845891 | 3300026095 | Unclassified | 895 |
| 400 | Ga0207674_10025813 | 3300026116 | Bacteria | 6256 |
| 401 | Ga0207675_100014971 | 3300026118 | Bacteria | 7240 |
| 402 | Ga0207675_100042947 | 3300026118 | Bacteria | 4222 |
| 403 | Ga0207675_100374076 | 3300026118 | Bacteria | 1400 |
| 404 | Ga0207675_100501553 | 3300026118 | Unclassified | 1208 |
| 405 | Ga0207683_10060072 | 3300026121 | Bacteria | 3341 |
| 406 | Ga0207698_10255236 | 3300026142 | Unclassified | 1607 |
| 407 | Ga0207428_10138588 | 3300027907 | Unclassified | 1859 |
| 408 | Ga0207428_10315247 | 3300027907 | Bacteria | 1156 |
| 409 | Ga0265356_1008887 | 3300028017 | Bacteria | 1139 |
| 410 | Ga0268266_10035593 | 3300028379 | Bacteria | 4236 |
| 411 | Ga0268266_10444988 | 3300028379 | Unclassified | 1231 |
| 412 | Ga0268266_10488170 | 3300028379 | Bacteria | 1175 |
| 413 | Ga0268266_10667359 | 3300028379 | Bacteria | 1001 |
| 414 | Ga0268266_10843147 | 3300028379 | Unclassified | 886 |
| 415 | Ga0268266_11232852 | 3300028379 | Unclassified | 723 |
| 416 | Ga0268265_10113151 | 3300028380 | Bacteria | 2220 |
| 417 | Ga0268265_10863871 | 3300028380 | Bacteria | 886 |
| 418 | Ga0268265_11186773 | 3300028380 | Bacteria | 760 |
| 419 | Ga0268264_10210802 | 3300028381 | Bacteria | 1783 |
| 420 | Ga0268264_10223276 | 3300028381 | Unclassified | 1735 |
| 421 | Ga0268264_10820555 | 3300028381 | Unclassified | 930 |
| 422 | Ga0268264_10947168 | 3300028381 | Bacteria | 866 |
| 423 | Ga0265338_10006484 | 3300028800 | Bacteria | 14897 |
| 424 | Ga0265338_10089618 | 3300028800 | Bacteria | 2548 |
| 425 | Ga0265760_10113914 | 3300031090 | Unclassified | 863 |
| 426 | Ga0265330_10112514 | 3300031235 | Bacteria | 1162 |
| 427 | Ga0265325_10047989 | 3300031241 | Bacteria | 2209 |
| 428 | Ga0265325_10188485 | 3300031241 | Bacteria | 957 |
| 429 | Ga0265340_10040969 | 3300031247 | Bacteria | 2279 |
| 430 | Ga0265339_10099346 | 3300031249 | Bacteria | 1517 |
| 431 | Ga0265316_10059409 | 3300031344 | Bacteria | 2974 |
| 432 | Ga0265316_10080713 | 3300031344 | Unclassified | 2494 |
| 433 | Ga0265316_10247826 | 3300031344 | Bacteria | 1309 |
| 434 | Ga0307408_100202123 | 3300031548 | Unclassified | 1609 |
| 435 | Ga0265313_10105974 | 3300031595 | Bacteria | 1241 |
| 436 | Ga0265314_10020092 | 3300031711 | Bacteria | 5160 |
| 437 | Ga0265314_10134700 | 3300031711 | Bacteria | 1536 |
| 438 | Ga0265314_10219832 | 3300031711 | Bacteria | 1109 |
| 439 | Ga0265314_10412493 | 3300031711 | Unclassified | 728 |
| 440 | Ga0265342_10337516 | 3300031712 | Bacteria | 787 |
| 441 | Ga0265342_10383575 | 3300031712 | Unclassified | 728 |
| 442 | Ga0307405_10000794 | 3300031731 | Bacteria | 12385 |
| 443 | Ga0307413_10084306 | 3300031824 | Bacteria | 2048 |
| 444 | Ga0307413_10142999 | 3300031824 | Bacteria | 1655 |
| 445 | Ga0307410_10002116 | 3300031852 | Bacteria | 9431 |
| 446 | Ga0307406_10010890 | 3300031901 | Bacteria | 5143 |
| 447 | Ga0307407_10000504 | 3300031903 | Bacteria | 12027 |
| 448 | Ga0307407_10510195 | 3300031903 | Bacteria | 883 |
| 449 | Ga0307412_10175023 | 3300031911 | Bacteria | 1608 |
| 450 | Ga0307412_10331464 | 3300031911 | Unclassified | 1215 |
| 451 | Ga0307416_100001240 | 3300032002 | Bacteria | 13769 |
| 452 | Ga0307416_100129070 | 3300032002 | Unclassified | 2271 |
| 453 | Ga0307416_100197712 | 3300032002 | Bacteria | 1904 |
| 454 | Ga0307411_10021573 | 3300032005 | Bacteria | 3772 |
| 455 | Ga0307415_100003916 | 3300032126 | Bacteria | 7652 |
| 456 | Ga0373930_0063950 | 3300034816 | Bacteria | 825 |
| 457 | Ga0373948_0003131 | 3300034817 | Bacteria | 2516 |
| 458 | Ga0373950_0003702 | 3300034818 | Bacteria | 2204 |
| 459 | Ga0373958_0002058 | 3300034819 | Bacteria | 2778 |
| 460 | Ga0373959_0013334 | 3300034820 | Bacteria | 1480 |
| 461 | Ga0373938_0016504 | 3300034957 | Bacteria | 1443 |
| 462 | Ga0373928_0001597 | 3300035084 | Bacteria | 4392 |
| 463 | Ga0373929_0002095 | 3300035085 | Bacteria | 3711 |
| 464 | Ga0373929_0182090 | 3300035085 | Bacteria | 580 |
| 465 | Ga0373934_0015403 | 3300035086 | Bacteria | 2901 |
| 466 | Ga0373940_0023768 | 3300035088 | Bacteria | 1584 |
| 467 | Ga0373944_0185520 | 3300035089 | Unclassified | 748 |
| 468 | Ga0373949_0001119 | 3300035090 | Bacteria | 8112 |
| 469 | Ga0373951_0003335 | 3300035091 | Unclassified | 3929 |
| 470 | Ga0373952_0000824 | 3300035092 | Bacteria | 5596 |
| 471 | Ga0373923_0072403 | 3300035111 | Bacteria | 1482 |
| 472 | Ga0373932_0028199 | 3300035112 | Bacteria | 1541 |
| 473 | Ga0373939_0207860 | 3300035114 | Bacteria | 743 |
| 474 | Ga0373941_0133142 | 3300035115 | Bacteria | 897 |
| 475 | Ga0373953_0250776 | 3300035117 | Bacteria | 769 |
| 476 | Ga0373954_0113812 | 3300035118 | Bacteria | 1310 |
| 477 | Ga0373956_0019511 | 3300035119 | Bacteria | 2876 |
| 478 | Ga0373957_0408871 | 3300035120 | Bacteria | 584 |
| 479 | Ga0373960_0015485 | 3300035121 | Bacteria | 1947 |
| 480 | Ga0373943_0016974 | 3300035170 | Bacteria | 3329 |
| 481 | Ga0373955_0017707 | 3300035172 | Bacteria | 3530 |
| 482 | Ga0373942_0001341 | 3300035207 | Bacteria | 6382 |
| 483 | Ga0373961_0001024 | 3300035241 | Bacteria | 9104 |
| 484 | Ga0373924_0118171 | 3300035410 | Bacteria | 1149 |
| 485 | Ga0373924_0180050 | 3300035410 | Bacteria | 930 |
| 486 | Ga0373924_0443110 | 3300035410 | Unclassified | 582 |
| 487 | Ga0373931_0000743 | 3300035691 | Bacteria | 13596 |
| 488 | Ga0373935_0169702 | 3300035692 | Bacteria | 1492 |
| 489 | Ga0373935_0385657 | 3300035692 | Unclassified | 1004 |
| 490 | Ga0373927_0213098 | 3300035695 | Bacteria | 1269 |
| 491 | Ga0373933_0000227 | 3300035724 | Bacteria | 37466 |
| 492 | Ga0373937_0000065 | 3300036401 | Bacteria | 95014 |
| 493 | Ga0373937_0000240 | 3300036401 | Bacteria | 53719 |
| 494 | Ga0373937_0073624 | 3300036401 | Bacteria | 3152 |
| 495 | Ga0373937_0080566 | 3300036401 | Bacteria | 3011 |
| 496 | Ga0373937_0494486 | 3300036401 | Unclassified | 1162 |
| 497 | Ga0373937_0533271 | 3300036401 | Archaea | 1115 |
| 498 | Ga0373937_0618579 | 3300036401 | Bacteria | 1028 |
| 499 | Ga0316582_0214856 | 3300036647 | Bacteria | 1314 |
| 500 | Ga0373925_0823969 | 3300037068 | Bacteria | 765 |
| 501 | Ga0395898_0288429 | 3300037466 | Bacteria | 1566 |
| 502 | Ga0436363_1580473 | 3300039450 | Unclassified | 941 |
| 503 | Ga0451839_1409582 | 3300041496 | Bacteria | 1165 |
| 504 | Ga0439442_061777 | 3300042002 | Bacteria | 794 |
| 505 | Ga0439446_0025782 | 3300042156 | Bacteria | 1681 |
| 506 | Ga0439434_0204629 | 3300042435 | Bacteria | 666 |
| 507 | Ga0451577_0009200 | 3300042876 | Bacteria | 9529 |
| 508 | Ga0451577_0202180 | 3300042876 | Bacteria | 1793 |
| 509 | Ga0451577_0314276 | 3300042876 | Bacteria | 1420 |
| 510 | Ga0453683_0054565 | 3300044673 | Bacteria | 2501 |
| 511 | Ga0453683_0058054 | 3300044673 | Bacteria | 2421 |
| 512 | Ga0466966_0061664 | 3300044684 | Bacteria | 2365 |
| 513 | Ga0466961_0508882 | 3300044693 | Bacteria | 727 |
| 514 | Ga0466964_0115555 | 3300044706 | Bacteria | 1202 |
| 515 | Ga0466964_0214641 | 3300044706 | Bacteria | 931 |
| 516 | Ga0453684_2093754 | 3300044712 | Bacteria | 568 |
| 517 | Ga0453684_2109735 | 3300044712 | Bacteria | 565 |
| 518 | Ga0466968_0626345 | 3300044735 | Bacteria | 545 |
| 519 | Ga0466959_0175345 | 3300045049 | Bacteria | 1502 |
| 520 | Ga0451576_0084276 | 3300045051 | Bacteria | 3306 |
| 521 | Ga0451576_0975231 | 3300045051 | Bacteria | 888 |
| 522 | Ga0451576_2575743 | 3300045051 | Unclassified | 519 |
| 523 | Ga0466958_0130164 | 3300045836 | Bacteria | 1580 |
| 524 | Ga0466958_0176987 | 3300045836 | Unclassified | 1353 |
| 525 | Ga0466967_0530756 | 3300045976 | Bacteria | 1157 |
| 526 | Ga0495592_0206755 | 3300046454 | Unclassified | 1321 |
| 527 | Ga0495592_0434296 | 3300046454 | Unclassified | 826 |
| 528 | Ga0495629_0036066 | 3300046459 | Bacteria | 3493 |
| 529 | Ga0495651_0029623 | 3300046462 | Bacteria | 4268 |
| 530 | Ga0495651_0030099 | 3300046462 | Bacteria | 4233 |
| 531 | Ga0495651_0453127 | 3300046462 | Bacteria | 829 |
| 532 | Ga0495653_0140511 | 3300046463 | Bacteria | 1699 |
| 533 | Ga0495580_0038917 | 3300046472 | Bacteria | 3403 |
| 534 | Ga0495580_0046887 | 3300046472 | Bacteria | 3065 |
| 535 | Ga0495582_0276532 | 3300046473 | Bacteria | 964 |
| 536 | Ga0495639_0651158 | 3300046475 | Archaea | 543 |
| 537 | Ga0495662_0356904 | 3300046476 | Unclassified | 718 |
| 538 | Ga0495664_0037436 | 3300046477 | Bacteria | 2863 |
| 539 | Ga0495608_0043841 | 3300046511 | Unclassified | 2988 |
| 540 | Ga0495608_0422703 | 3300046511 | Bacteria | 813 |
| 541 | Ga0495628_0015190 | 3300046516 | Bacteria | 6432 |
| 542 | Ga0495628_0322861 | 3300046516 | Bacteria | 1139 |
| 543 | Ga0495630_0160549 | 3300046517 | Bacteria | 1711 |
| 544 | Ga0495652_0046377 | 3300046529 | Bacteria | 3732 |
| 545 | Ga0495652_0115882 | 3300046529 | Bacteria | 2146 |
| 546 | Ga0495652_0371922 | 3300046529 | Bacteria | 1018 |
| 547 | Ga0495665_0696559 | 3300046531 | Unclassified | 504 |
| 548 | Ga0495640_0370970 | 3300046533 | Bacteria | 881 |
| 549 | Ga0495586_0203285 | 3300046535 | Unclassified | 1123 |
| 550 | Ga0495587_0000047 | 3300046536 | Bacteria | 105516 |
| 551 | Ga0495587_0355398 | 3300046536 | Unclassified | 816 |
| 552 | Ga0495587_0371368 | 3300046536 | Bacteria | 796 |
| 553 | Ga0495645_0014141 | 3300046543 | Bacteria | 5657 |
| 554 | Ga0495645_0111346 | 3300046543 | Unclassified | 1936 |
| 555 | Ga0495634_0416594 | 3300046642 | Unclassified | 796 |
| 556 | Ga0495635_0080516 | 3300046663 | Bacteria | 2229 |
| 557 | Ga0495657_0595393 | 3300046675 | Unclassified | 640 |
| 558 | Ga0495599_0003513 | 3300046678 | Bacteria | 9179 |
| 559 | Ga0495623_0022593 | 3300046679 | Bacteria | 4062 |
| 560 | Ga0495623_0163577 | 3300046679 | Unclassified | 1306 |
| 561 | Ga0495658_0027155 | 3300046683 | Unclassified | 3077 |
| 562 | Ga0495658_0137148 | 3300046683 | Bacteria | 1494 |
| 563 | Ga0495669_0042534 | 3300046684 | Bacteria | 2020 |
| 564 | Ga0495613_0351803 | 3300046689 | Unclassified | 1012 |
| 565 | Ga0495613_0964444 | 3300046689 | Bacteria | 549 |
| 566 | Ga0495670_0395579 | 3300046691 | Unclassified | 746 |
| 567 | Ga0495670_0817555 | 3300046691 | Bacteria | 509 |
| 568 | Ga0495600_0039789 | 3300046809 | Bacteria | 3062 |
| 569 | Ga0495604_0047521 | 3300047317 | Bacteria | 3342 |
| 570 | Ga0495604_0420857 | 3300047317 | Bacteria | 877 |
| 571 | Ga0495674_0070288 | 3300047319 | Bacteria | 3025 |
| 572 | Ga0495674_0091739 | 3300047319 | Bacteria | 2594 |
| 573 | Ga0495680_0114890 | 3300047322 | Bacteria | 1992 |
| 574 | Ga0495675_0000391 | 3300047444 | Bacteria | 30273 |
| 575 | Ga0495675_0059015 | 3300047444 | Bacteria | 2433 |
| 576 | Ga0495684_0142366 | 3300047471 | Bacteria | 1797 |
| 577 | Ga0495593_0199871 | 3300047673 | Unclassified | 1005 |
| 578 | Ga0495602_0001895 | 3300048088 | Bacteria | 20969 |
| 579 | Ga0495602_0209395 | 3300048088 | Bacteria | 1481 |
| 580 | Ga0495602_0331722 | 3300048088 | Unclassified | 1103 |
| 581 | Ga0495602_0719413 | 3300048088 | Bacteria | 676 |
| 582 | Ga0496101_0367794 | 3300048904 | Unclassified | 1131 |
| 583 | Ga0496104_0065670 | 3300048907 | Unclassified | 3444 |
| 584 | Ga0496104_0266422 | 3300048907 | Bacteria | 1626 |
| 585 | Ga0496104_1253964 | 3300048907 | Bacteria | 644 |
| 586 | Ga0496105_0531118 | 3300048908 | Bacteria | 920 |
| 587 | Ga0496106_0016838 | 3300048909 | Bacteria | 5409 |
| 588 | Ga0496106_0300907 | 3300048909 | Unclassified | 1286 |
| 589 | Ga0496107_0264056 | 3300048910 | Unclassified | 1281 |
| 590 | Ga0496108_0996419 | 3300048911 | Bacteria | 716 |
| 591 | Ga0496108_1657714 | 3300048911 | Bacteria | 528 |
| 592 | Ga0496110_0407916 | 3300048913 | Unclassified | 1239 |
| 593 | Ga0496112_0004345 | 3300048915 | Bacteria | 11983 |
| 594 | Ga0496112_0232211 | 3300048915 | Unclassified | 1799 |
| 595 | Ga0496112_0873352 | 3300048915 | Bacteria | 822 |
| 596 | Ga0496112_1337575 | 3300048915 | Unclassified | 632 |
| 597 | Ga0496112_1403785 | 3300048915 | Bacteria | 613 |
| 598 | Ga0496115_0041230 | 3300048918 | Bacteria | 3673 |
| 599 | Ga0496115_0071681 | 3300048918 | Unclassified | 2810 |
| 600 | Ga0496115_0136703 | 3300048918 | Unclassified | 2021 |
| 601 | Ga0496115_0621606 | 3300048918 | Bacteria | 857 |
| 602 | Ga0496126_0199619 | 3300048929 | Unclassified | 1690 |
| 603 | Ga0501032_0436042 | 3300049569 | Bacteria | 840 |
| 604 | Ga0501036_0016911 | 3300049572 | Bacteria | 6093 |
| 605 | Ga0501040_0064014 | 3300049576 | Bacteria | 2531 |
| 606 | Ga0501040_0408370 | 3300049576 | Bacteria | 976 |
| 607 | Ga0501040_0429508 | 3300049576 | Bacteria | 950 |
| 608 | Ga0501041_0033974 | 3300049577 | Bacteria | 3087 |
| 609 | Ga0501041_0054973 | 3300049577 | Bacteria | 2429 |
| 610 | Ga0501042_0071069 | 3300049578 | Bacteria | 2490 |
| 611 | Ga0501042_0166795 | 3300049578 | Bacteria | 1589 |
| 612 | Ga0501042_0643113 | 3300049578 | Bacteria | 771 |
| 613 | Ga0501048_0312622 | 3300049582 | Bacteria | 1119 |
| 614 | Ga0501068_0068753 | 3300049584 | Bacteria | 2159 |
| 615 | Ga0501071_0012722 | 3300049587 | Bacteria | 5720 |
| 616 | Ga0501071_0057513 | 3300049587 | Bacteria | 2811 |
| 617 | Ga0501071_0886093 | 3300049587 | Bacteria | 688 |
| 618 | Ga0501072_0321878 | 3300049588 | Bacteria | 1229 |
| 619 | Ga0501072_0347345 | 3300049588 | Bacteria | 1178 |
| 620 | Ga0501074_0335527 | 3300049590 | Bacteria | 1073 |
| 621 | Ga0501075_0024322 | 3300049591 | Bacteria | 4440 |
| 622 | Ga0501075_0158518 | 3300049591 | Bacteria | 1726 |
| 623 | Ga0501075_1065592 | 3300049591 | Bacteria | 614 |
| 624 | Ga0501076_0179627 | 3300049592 | Bacteria | 1725 |
| 625 | Ga0501077_0363713 | 3300049593 | Unclassified | 924 |
| 626 | Ga0501079_0219657 | 3300049741 | Bacteria | 1485 |
| 627 | Ga0501079_0759652 | 3300049741 | Bacteria | 763 |
| 628 | Ga0501080_0095955 | 3300049742 | Bacteria | 2753 |
| 629 | Ga0501035_0512056 | 3300049822 | Bacteria | 987 |
| 630 | Ga0501045_0212938 | 3300049824 | Bacteria | 1439 |
| 631 | nmdc:mga05p37_229180_c1 | 3300050507 | Bacteria | 2239 |
| 632 | nmdc:mga05p37_2316_c1 | 3300050507 | Bacteria | 22175 |
| 633 | nmdc:mga05p37_360663_c1 | 3300050507 | Bacteria | 1709 |
| 634 | nmdc:mga05p37_361406_c1 | 3300050507 | Bacteria | 1706 |
| 635 | nmdc:mga0qj67_508010_c1 | 3300050509 | Bacteria | 969 |
| 636 | nmdc:mga06r32_482815_c1 | 3300050510 | Unclassified | 1217 |
| 637 | nmdc:mga06r32_63742_c1 | 3300050510 | Bacteria | 3553 |
| 638 | nmdc:mga08y16_457620_c1 | 3300050511 | Unclassified | 1301 |
| 639 | nmdc:mga08y16_51952_c1 | 3300050511 | Bacteria | 4289 |
| 640 | nmdc:mga0n895_1034890_c1 | 3300050512 | Unclassified | 801 |
| 641 | nmdc:mga0n895_1145_c1 | 3300050512 | Bacteria | 19414 |
| 642 | nmdc:mga0n895_408692_c1 | 3300050512 | Bacteria | 1373 |
| 643 | nmdc:mga0n895_734712_c1 | 3300050512 | Unclassified | 981 |
| 644 | nmdc:mga0rr50_1436_c1 | 3300050513 | Bacteria | 13102 |
| 645 | nmdc:mga0rr50_384292_c1 | 3300050513 | Unclassified | 1184 |
| 646 | nmdc:mga08x19_151664_c1 | 3300050514 | Bacteria | 1570 |
| 647 | nmdc:mga08x19_275315_c1 | 3300050514 | Bacteria | 1165 |
| 648 | nmdc:mga08x19_429260_c1 | 3300050514 | Bacteria | 929 |
| 649 | nmdc:mga08x19_8672_c1 | 3300050514 | Bacteria | 6063 |
| 650 | nmdc:mga08x19_959047_c1 | 3300050514 | Bacteria | 608 |
| 651 | nmdc:mga0a205_1107230_c1 | 3300050515 | Bacteria | 639 |
| 652 | nmdc:mga0a205_231053_c1 | 3300050515 | Bacteria | 1733 |
| 653 | nmdc:mga0a205_279090_c1 | 3300050515 | Bacteria | 1546 |
| 654 | nmdc:mga0a205_365803_c1 | 3300050515 | Bacteria | 1308 |
| 655 | nmdc:mga0a205_396134_c1 | 3300050515 | Bacteria | 1245 |
| 656 | nmdc:mga0a205_79381_c1 | 3300050515 | Bacteria | 3171 |
| 657 | nmdc:mga0a205_820083_c1 | 3300050515 | Unclassified | 778 |
| 658 | Ga0495619_1029870 | 3300053085 | Unclassified | 550 |
| 659 | Ga0501084_0145856 | 3300054114 | Bacteria | 1994 |
| 660 | Ga0501082_0238671 | 3300060353 | Bacteria | 1582 |
| 661 | Ga0501082_1171239 | 3300060353 | Bacteria | 672 |
| 662 | Ga0530510_0099297 | 3300061734 | Bacteria | 2128 |
| 663 | Ga0070713_100670012 | |||
| 664 | rootH2_10085532 | |||
| 665 | Ga0065715_10246450 | |||
| 666 | Ga0070676_10034643 | |||
| 667 | Ga0070676_10744994 | |||
| 668 | Ga0070676_11078056 | |||
| 669 | Ga0070683_100097847 | |||
| 670 | Ga0070683_100655116 | |||
| 671 | Ga0070690_100128125 | |||
| 672 | Ga0070690_100248171 | |||
| 673 | Ga0070690_100358922 | |||
| 674 | Ga0070690_100816328 | |||
| 675 | Ga0070670_100060133 | |||
| 676 | Ga0070677_10238268 | |||
| 677 | Ga0068869_100005467 | |||
| 678 | Ga0068869_100093110 | |||
| 679 | Ga0068869_100476627 | |||
| 680 | Ga0068869_100921282 | |||
| 681 | Ga0068869_101255585 | |||
| 682 | Ga0070666_10085837 | |||
| 683 | Ga0070680_100496259 | |||
| 684 | Ga0068868_100066043 | |||
| 685 | Ga0068868_100124237 | |||
| 686 | Ga0070689_100427196 | |||
| 687 | Ga0070689_100429499 | |||
| 688 | Ga0070687_100049971 | |||
| 689 | Ga0070661_100166120 | |||
| 690 | Ga0070692_10431158 | |||
| 691 | Ga0070668_100022053 | |||
| 692 | Ga0070668_100615775 | |||
| 693 | Ga0070669_100057581 | |||
| 694 | Ga0070669_101250220 | |||
| 695 | Ga0070669_101687282 | |||
| 696 | Ga0070675_100497006 | |||
| 697 | Ga0070671_100276857 | |||
| 698 | Ga0070674_101309702 | |||
| 699 | Ga0070673_100059045 | |||
| 700 | Ga0070673_100908188 | |||
| 701 | Ga0070688_101682743 | |||
| 702 | Ga0070659_100475802 | |||
| 703 | Ga0070667_100125513 | |||
| 704 | Ga0070667_100493239 | |||
| 705 | Ga0070703_10002836 | |||
| 706 | Ga0070709_10000250 | |||
| 707 | Ga0070709_10059174 | |||
| 708 | Ga0070709_10145679 | |||
| 709 | Ga0070714_100107984 | |||
| 710 | Ga0070713_100060680 | |||
| 711 | Ga0070713_100075720 | |||
| 712 | Ga0070713_100091430 | |||
| 713 | Ga0070713_100099400 | |||
| 714 | Ga0070713_100144595 | |||
| 715 | Ga0070713_100208276 | |||
| 716 | Ga0070710_10546526 | |||
| 717 | Ga0070701_10963597 | |||
| 718 | Ga0070711_100000033 | |||
| 719 | Ga0070711_100052104 | |||
| 720 | Ga0070711_100364898 | |||
| 721 | Ga0070711_100742404 | |||
| 722 | Ga0070711_100756111 | |||
| 723 | Ga0070694_100083845 | |||
| 724 | Ga0070694_100176160 | |||
| 725 | Ga0070708_100041728 | |||
| 726 | Ga0070708_100042781 | |||
| 727 | Ga0070708_100073053 | |||
| 728 | Ga0070708_100145805 | |||
| 729 | Ga0070708_100412548 | |||
| 730 | Ga0070708_100424049 | |||
| 731 | Ga0070663_100305995 | |||
| 732 | Ga0070678_100015221 | |||
| 733 | Ga0070662_100026776 | |||
| 734 | Ga0070662_100293232 | |||
| 735 | Ga0070681_10437735 | |||
| 736 | Ga0070681_11228005 | |||
| 737 | Ga0068867_100103336 | |||
| 738 | Ga0068867_100138685 | |||
| 739 | Ga0068867_101546141 | |||
| 740 | Ga0070685_10095715 | |||
| 741 | Ga0070685_10890084 | |||
| 742 | Ga0070706_100070491 | |||
| 743 | Ga0070706_100330166 | |||
| 744 | Ga0070706_100509565 | |||
| 745 | Ga0070707_100084854 | |||
| 746 | Ga0070707_100291674 | |||
| 747 | Ga0070707_101081909 | |||
| 748 | Ga0070698_101887279 | |||
| 749 | Ga0070699_100029893 | |||
| 750 | Ga0070699_100732803 | |||
| 751 | Ga0070699_101438865 | |||
| 752 | Ga0070679_100032076 | |||
| 753 | Ga0070679_100808449 | |||
| 754 | Ga0070679_100819995 | |||
| 755 | Ga0068853_100434148 | |||
| 756 | Ga0068853_100765974 | |||
| 757 | Ga0068853_101486141 | |||
| 758 | Ga0070672_100014202 | |||
| 759 | Ga0070672_100241340 | |||
| 760 | Ga0070686_101585218 | |||
| 761 | Ga0070695_100169161 | |||
| 762 | Ga0070695_100643904 | |||
| 763 | Ga0070696_100296932 | |||
| 764 | Ga0070693_100124956 | |||
| 765 | Ga0070665_100015116 | |||
| 766 | Ga0070665_100039108 | |||
| 767 | Ga0070665_100040315 | |||
| 768 | Ga0070665_100275766 | |||
| 769 | Ga0070665_100792590 | |||
| 770 | Ga0070665_101513776 | |||
| 771 | Ga0070665_101573026 | |||
| 772 | Ga0070704_100040716 | |||
| 773 | Ga0070704_100222732 | |||
| 774 | Ga0068855_100254763 | |||
| 775 | Ga0068855_100540726 | |||
| 776 | Ga0068855_102505832 | |||
| 777 | Ga0070664_100040984 | |||
| 778 | Ga0068854_100052824 | |||
| 779 | Ga0068854_100080198 | |||
| 780 | Ga0068854_100136990 | |||
| 781 | Ga0068856_100199121 | |||
| 782 | Ga0070702_100479422 | |||
| 783 | Ga0068852_100477501 | |||
| 784 | Ga0068859_100009935 | |||
| 785 | Ga0068859_100112478 | |||
| 786 | Ga0068859_100179501 | |||
| 787 | Ga0068859_100661523 | |||
| 788 | Ga0068864_100018082 | |||
| 789 | Ga0068864_100084274 | |||
| 790 | Ga0068861_100081493 | |||
| 791 | Ga0068861_100089962 | |||
| 792 | Ga0068861_100166290 | |||
| 793 | Ga0068861_100370937 | |||
| 794 | Ga0068851_10069941 | |||
| 795 | Ga0068851_10287614 | |||
| 796 | Ga0068870_10386987 | |||
| 797 | Ga0068863_100042774 | |||
| 798 | Ga0068863_100063715 | |||
| 799 | Ga0068863_100537283 | |||
| 800 | Ga0068863_100641902 | |||
| 801 | Ga0068858_100001405 | |||
| 802 | Ga0068858_100066618 | |||
| 803 | Ga0068858_100098885 | |||
| 804 | Ga0068858_100614211 | |||
| 805 | Ga0068860_100193650 | |||
| 806 | Ga0068860_100222464 | |||
| 807 | Ga0068860_100405805 | |||
| 808 | Ga0068860_100839712 | |||
| 809 | Ga0068860_101526656 | |||
| 810 | Ga0068862_100059209 | |||
| 811 | Ga0081538_10008982 | |||
| 812 | Ga0070717_10428636 | |||
| 813 | Ga0070717_10450964 | |||
| 814 | Ga0070715_10649950 | |||
| 815 | Ga0070716_100277021 | |||
| 816 | Ga0070716_101440392 | |||
| 817 | Ga0070712_100057634 | |||
| 818 | Ga0070712_100187696 | |||
| 819 | Ga0070712_100216073 | |||
| 820 | Ga0070712_100487773 | |||
| 821 | Ga0070712_101498772 | |||
| 822 | Ga0097621_100122815 | |||
| 823 | Ga0097621_100733565 | |||
| 824 | Ga0068871_100110392 | |||
| 825 | Ga0068871_100117993 | |||
| 826 | Ga0068871_100151757 | |||
| 827 | Ga0068871_100316773 | |||
| 828 | Ga0075428_100008720 | |||
| 829 | Ga0075428_100093108 | |||
| 830 | Ga0075428_101184426 | |||
| 831 | Ga0075430_100539449 | |||
| 832 | Ga0075431_100705185 | |||
| 833 | Ga0075433_10068656 | |||
| 834 | Ga0075433_10225145 | |||
| 835 | Ga0075433_10262857 | |||
| 836 | Ga0075434_100000744 | |||
| 837 | Ga0075434_100166897 | |||
| 838 | Ga0075434_100334109 | |||
| 839 | Ga0075434_100352794 | |||
| 840 | Ga0075429_100325105 | |||
| 841 | Ga0075429_100548435 | |||
| 842 | Ga0075429_100869179 | |||
| 843 | Ga0068865_100054547 | |||
| 844 | Ga0068865_100058065 | |||
| 845 | Ga0075436_100002464 | |||
| 846 | Ga0075436_100007793 | |||
| 847 | Ga0075436_100232278 | |||
| 848 | Ga0075436_100239158 | |||
| 849 | Ga0075436_100488597 | |||
| 850 | Ga0075436_100680117 | |||
| 851 | Ga0097620_100009935 | |||
| 852 | Ga0097620_100112483 | |||
| 853 | Ga0097620_100179499 | |||
| 854 | Ga0097620_100661584 | |||
| 855 | Ga0075435_100000431 | |||
| 856 | Ga0075435_101051670 | |||
| 857 | Ga0099795_10381207 | |||
| 858 | Ga0105251_10405448 | |||
| 859 | Ga0105240_10026251 | |||
| 860 | Ga0105240_10045482 | |||
| 861 | Ga0105240_10060972 | |||
| 862 | Ga0105240_10064011 | |||
| 863 | Ga0105240_10102031 | |||
| 864 | Ga0105240_10105507 | |||
| 865 | Ga0105240_10136719 | |||
| 866 | Ga0105240_10197925 | |||
| 867 | Ga0105240_10560609 | |||
| 868 | Ga0105240_10727859 | |||
| 869 | Ga0111539_10120674 | |||
| 870 | Ga0111539_10127899 | |||
| 871 | Ga0111539_11037600 | |||
| 872 | Ga0105245_10470286 | |||
| 873 | Ga0105247_10061933 | |||
| 874 | Ga0105247_10071727 | |||
| 875 | Ga0105247_10361665 | |||
| 876 | Ga0114129_10007878 | |||
| 877 | Ga0114129_10025007 | |||
| 878 | Ga0114129_10033701 | |||
| 879 | Ga0114129_10099732 | |||
| 880 | Ga0114129_10212585 | |||
| 881 | Ga0105243_10393433 | |||
| 882 | Ga0105243_10761067 | |||
| 883 | Ga0105241_10280405 | |||
| 884 | Ga0105241_10698597 | |||
| 885 | Ga0105241_10841808 | |||
| 886 | Ga0105241_11412639 | |||
| 887 | Ga0105242_10249910 | |||
| 888 | Ga0105248_10227467 | |||
| 889 | Ga0105248_10262955 | |||
| 890 | Ga0105248_10351173 | |||
| 891 | Ga0105237_10258360 | |||
| 892 | Ga0105237_10348530 | |||
| 893 | Ga0105237_10515342 | |||
| 894 | Ga0105238_10193154 | |||
| 895 | Ga0105249_10654019 | |||
| 896 | Ga0105239_10351505 | |||
| 897 | Ga0105246_10011856 | |||
| 898 | Ga0105246_10348653 | |||
| 899 | Ga0105246_11508314 | |||
| 900 | Ga0157373_10131399 | |||
| 901 | Ga0157373_10515492 | |||
| 902 | Ga0157370_10187656 | |||
| 903 | Ga0157369_10032326 | |||
| 904 | Ga0157369_10394915 | |||
| 905 | Ga0157369_10715344 | |||
| 906 | Ga0157369_10728378 | |||
| 907 | Ga0157369_10965625 | |||
| 908 | Ga0157369_11102128 | |||
| 909 | Ga0157369_12518417 | |||
| 910 | Ga0157374_10000012 | |||
| 911 | Ga0157374_10008262 | |||
| 912 | Ga0157374_10101058 | |||
| 913 | Ga0157378_10045451 | |||
| 914 | Ga0157378_10075246 | |||
| 915 | Ga0157378_10370536 | |||
| 916 | Ga0163162_10039775 | |||
| 917 | Ga0157372_10042968 | |||
| 918 | Ga0157372_10170903 | |||
| 919 | Ga0157372_10221865 | |||
| 920 | Ga0157372_10619390 | |||
| 921 | Ga0157375_10027800 | |||
| 922 | Ga0157375_10125011 | |||
| 923 | Ga0157375_10178203 | |||
| 924 | Ga0157375_12148333 | |||
| 925 | Ga0163163_10194094 | |||
| 926 | Ga0163163_11108886 | |||
| 927 | Ga0163163_12076414 | |||
| 928 | Ga0157380_10003291 | |||
| 929 | Ga0157380_10380409 | |||
| 930 | Ga0157380_10473235 | |||
| 931 | Ga0157377_10000002 | |||
| 932 | Ga0157377_10037084 | |||
| 933 | Ga0157379_10045284 | |||
| 934 | Ga0157379_10165911 | |||
| 935 | Ga0157379_10237593 | |||
| 936 | Ga0157379_10534938 | |||
| 937 | Ga0157376_10004945 | |||
| 938 | Ga0157376_10282425 | |||
| 939 | Ga0157376_10330733 | |||
| 940 | Ga0157376_10534881 | |||
| 941 | Ga0163161_10109075 | |||
| 942 | Ga0206356_11700659 | |||
| 943 | Ga0154015_1668427 | |||
| 944 | Ga0207697_10198669 | |||
| 945 | Ga0207656_10224591 | |||
| 946 | Ga0207653_10100187 | |||
| 947 | Ga0207710_10042921 | |||
| 948 | Ga0207680_10077430 | |||
| 949 | Ga0207647_10012485 | |||
| 950 | Ga0207647_10029739 | |||
| 951 | Ga0207685_10209262 | |||
| 952 | Ga0207699_10000211 | |||
| 953 | Ga0207699_10389236 | |||
| 954 | Ga0207699_10837128 | |||
| 955 | Ga0207645_10023188 | |||
| 956 | Ga0207645_10603606 | |||
| 957 | Ga0207643_10147042 | |||
| 958 | Ga0207684_10033929 | |||
| 959 | Ga0207684_10422153 | |||
| 960 | Ga0207684_10440598 | |||
| 961 | Ga0207654_10647805 | |||
| 962 | Ga0207654_10716541 | |||
| 963 | Ga0207707_10183980 | |||
| 964 | Ga0207707_10618513 | |||
| 965 | Ga0207707_10849887 | |||
| 966 | Ga0207695_10004762 | |||
| 967 | Ga0207695_10013190 | |||
| 968 | Ga0207695_10171806 | |||
| 969 | Ga0207695_10292793 | |||
| 970 | Ga0207695_10300996 | |||
| 971 | Ga0207695_11154471 | |||
| 972 | Ga0207695_11175183 | |||
| 973 | Ga0207671_10155543 | |||
| 974 | Ga0207671_11483705 | |||
| 975 | Ga0207693_10275503 | |||
| 976 | Ga0207663_10000026 | |||
| 977 | Ga0207663_10185054 | |||
| 978 | Ga0207660_10033655 | |||
| 979 | Ga0207660_10175225 | |||
| 980 | Ga0207662_10303789 | |||
| 981 | Ga0207657_10725535 | |||
| 982 | Ga0207652_10013216 | |||
| 983 | Ga0207652_10509954 | |||
| 984 | Ga0207646_10147315 | |||
| 985 | Ga0207646_10248548 | |||
| 986 | Ga0207681_10041686 | |||
| 987 | Ga0207681_10107477 | |||
| 988 | Ga0207694_10041708 | |||
| 989 | Ga0207694_10396121 | |||
| 990 | Ga0207650_10721931 | |||
| 991 | Ga0207650_11807293 | |||
| 992 | Ga0207659_10369415 | |||
| 993 | Ga0207687_10303974 | |||
| 994 | Ga0207687_10345468 | |||
| 995 | Ga0207700_10010649 | |||
| 996 | Ga0207700_10072072 | |||
| 997 | Ga0207700_10155491 | |||
| 998 | Ga0207700_10252992 | |||
| 999 | Ga0207700_10281862 | |||
| 1000 | Ga0207700_11393785 | |||
| 1001 | Ga0207664_10072541 | |||
| 1002 | Ga0207664_10093662 | |||
| 1003 | Ga0207664_10478985 | |||
| 1004 | Ga0207644_10122462 | |||
| 1005 | Ga0207690_11818500 | |||
| 1006 | Ga0207706_10015660 | |||
| 1007 | Ga0207706_10026970 | |||
| 1008 | Ga0207706_10099176 | |||
| 1009 | Ga0207686_10207706 | |||
| 1010 | Ga0207670_10200755 | |||
| 1011 | Ga0207670_10547877 | |||
| 1012 | Ga0207670_11652365 | |||
| 1013 | Ga0207669_10184530 | |||
| 1014 | Ga0207704_10015609 | |||
| 1015 | Ga0207704_10043693 | |||
| 1016 | Ga0207665_10027600 | |||
| 1017 | Ga0207665_10033120 | |||
| 1018 | Ga0207665_10257559 | |||
| 1019 | Ga0207665_10363618 | |||
| 1020 | Ga0207691_10021009 | |||
| 1021 | Ga0207691_10394681 | |||
| 1022 | Ga0207711_10081570 | |||
| 1023 | Ga0207711_10238087 | |||
| 1024 | Ga0207711_10345333 | |||
| 1025 | Ga0207689_10000308 | |||
| 1026 | Ga0207689_10130099 | |||
| 1027 | Ga0207689_10456336 | |||
| 1028 | Ga0207689_10571830 | |||
| 1029 | Ga0207661_10152928 | |||
| 1030 | Ga0207661_11180320 | |||
| 1031 | Ga0207661_11506382 | |||
| 1032 | Ga0207679_10120291 | |||
| 1033 | Ga0207679_10431106 | |||
| 1034 | Ga0207667_10030353 | |||
| 1035 | Ga0207667_10259613 | |||
| 1036 | Ga0207667_10346702 | |||
| 1037 | Ga0207667_10750867 | |||
| 1038 | Ga0207651_10013432 | |||
| 1039 | Ga0207651_10225860 | |||
| 1040 | Ga0207668_10085732 | |||
| 1041 | Ga0207640_10039857 | |||
| 1042 | Ga0207640_10101791 | |||
| 1043 | Ga0207658_10093908 | |||
| 1044 | Ga0207658_10681497 | |||
| 1045 | Ga0207677_10101266 | |||
| 1046 | Ga0207677_10123900 | |||
| 1047 | Ga0207703_10006087 | |||
| 1048 | Ga0207703_10048250 | |||
| 1049 | Ga0207703_10794365 | |||
| 1050 | Ga0207639_10000198 | |||
| 1051 | Ga0207639_10279489 | |||
| 1052 | Ga0207678_10314968 | |||
| 1053 | Ga0207708_10090653 | |||
| 1054 | Ga0207702_10186310 | |||
| 1055 | Ga0207702_11705649 | |||
| 1056 | Ga0207641_10097525 | |||
| 1057 | Ga0207641_10107912 | |||
| 1058 | Ga0207676_10068233 | |||
| 1059 | Ga0207676_10167398 | |||
| 1060 | Ga0207676_10170094 | |||
| 1061 | Ga0207676_10845891 | |||
| 1062 | Ga0207674_10025813 | |||
| 1063 | Ga0207675_100014971 | |||
| 1064 | Ga0207675_100042947 | |||
| 1065 | Ga0207675_100374076 | |||
| 1066 | Ga0207675_100501553 | |||
| 1067 | Ga0207683_10060072 | |||
| 1068 | Ga0207698_10255236 | |||
| 1069 | Ga0207428_10138588 | |||
| 1070 | Ga0207428_10315247 | |||
| 1071 | Ga0265356_1008887 | |||
| 1072 | Ga0268266_10035593 | |||
| 1073 | Ga0268266_10444988 | |||
| 1074 | Ga0268266_10488170 | |||
| 1075 | Ga0268266_10667359 | |||
| 1076 | Ga0268266_10843147 | |||
| 1077 | Ga0268266_11232852 | |||
| 1078 | Ga0268265_10113151 | |||
| 1079 | Ga0268265_10863871 | |||
| 1080 | Ga0268265_11186773 | |||
| 1081 | Ga0268264_10210802 | |||
| 1082 | Ga0268264_10223276 | |||
| 1083 | Ga0268264_10820555 | |||
| 1084 | Ga0268264_10947168 | |||
| 1085 | Ga0265338_10006484 | |||
| 1086 | Ga0265338_10089618 | |||
| 1087 | Ga0265760_10113914 | |||
| 1088 | Ga0265330_10112514 | |||
| 1089 | Ga0265325_10047989 | |||
| 1090 | Ga0265325_10188485 | |||
| 1091 | Ga0265340_10040969 | |||
| 1092 | Ga0265339_10099346 | |||
| 1093 | Ga0265316_10059409 | |||
| 1094 | Ga0265316_10080713 | |||
| 1095 | Ga0265316_10247826 | |||
| 1096 | Ga0307408_100202123 | |||
| 1097 | Ga0265313_10105974 | |||
| 1098 | Ga0265314_10020092 | |||
| 1099 | Ga0265314_10134700 | |||
| 1100 | Ga0265314_10219832 | |||
| 1101 | Ga0265314_10412493 | |||
| 1102 | Ga0265342_10337516 | |||
| 1103 | Ga0265342_10383575 | |||
| 1104 | Ga0307405_10000794 | |||
| 1105 | Ga0307413_10084306 | |||
| 1106 | Ga0307413_10142999 | |||
| 1107 | Ga0307410_10002116 | |||
| 1108 | Ga0307406_10010890 | |||
| 1109 | Ga0307407_10000504 | |||
| 1110 | Ga0307407_10510195 | |||
| 1111 | Ga0307412_10175023 | |||
| 1112 | Ga0307412_10331464 | |||
| 1113 | Ga0307416_100001240 | |||
| 1114 | Ga0307416_100129070 | |||
| 1115 | Ga0307416_100197712 | |||
| 1116 | Ga0307411_10021573 | |||
| 1117 | Ga0307415_100003916 | |||
| 1118 | Ga0373930_0063950 | |||
| 1119 | Ga0373948_0003131 | |||
| 1120 | Ga0373950_0003702 | |||
| 1121 | Ga0373958_0002058 | |||
| 1122 | Ga0373959_0013334 | |||
| 1123 | Ga0373938_0016504 | |||
| 1124 | Ga0373928_0001597 | |||
| 1125 | Ga0373929_0002095 | |||
| 1126 | Ga0373929_0182090 | |||
| 1127 | Ga0373934_0015403 | |||
| 1128 | Ga0373940_0023768 | |||
| 1129 | Ga0373944_0185520 | |||
| 1130 | Ga0373949_0001119 | |||
| 1131 | Ga0373951_0003335 | |||
| 1132 | Ga0373952_0000824 | |||
| 1133 | Ga0373923_0072403 | |||
| 1134 | Ga0373932_0028199 | |||
| 1135 | Ga0373939_0207860 | |||
| 1136 | Ga0373941_0133142 | |||
| 1137 | Ga0373953_0250776 | |||
| 1138 | Ga0373954_0113812 | |||
| 1139 | Ga0373956_0019511 | |||
| 1140 | Ga0373957_0408871 | |||
| 1141 | Ga0373960_0015485 | |||
| 1142 | Ga0373943_0016974 | |||
| 1143 | Ga0373955_0017707 | |||
| 1144 | Ga0373942_0001341 | |||
| 1145 | Ga0373961_0001024 | |||
| 1146 | Ga0373924_0118171 | |||
| 1147 | Ga0373924_0180050 | |||
| 1148 | Ga0373924_0443110 | |||
| 1149 | Ga0373931_0000743 | |||
| 1150 | Ga0373935_0169702 | |||
| 1151 | Ga0373935_0385657 | |||
| 1152 | Ga0373927_0213098 | |||
| 1153 | Ga0373933_0000227 | |||
| 1154 | Ga0373937_0000065 | |||
| 1155 | Ga0373937_0000240 | |||
| 1156 | Ga0373937_0073624 | |||
| 1157 | Ga0373937_0080566 | |||
| 1158 | Ga0373937_0494486 | |||
| 1159 | Ga0373937_0533271 | |||
| 1160 | Ga0373937_0618579 | |||
| 1161 | Ga0316582_0214856 | |||
| 1162 | Ga0373925_0823969 | |||
| 1163 | Ga0395898_0288429 | |||
| 1164 | Ga0436363_1580473 | |||
| 1165 | Ga0451839_1409582 | |||
| 1166 | Ga0439442_061777 | |||
| 1167 | Ga0439446_0025782 | |||
| 1168 | Ga0439434_0204629 | |||
| 1169 | Ga0451577_0009200 | |||
| 1170 | Ga0451577_0202180 | |||
| 1171 | Ga0451577_0314276 | |||
| 1172 | Ga0453683_0054565 | |||
| 1173 | Ga0453683_0058054 | |||
| 1174 | Ga0466966_0061664 | |||
| 1175 | Ga0466961_0508882 | |||
| 1176 | Ga0466964_0115555 | |||
| 1177 | Ga0466964_0214641 | |||
| 1178 | Ga0453684_2093754 | |||
| 1179 | Ga0453684_2109735 | |||
| 1180 | Ga0466968_0626345 | |||
| 1181 | Ga0466959_0175345 | |||
| 1182 | Ga0451576_0084276 | |||
| 1183 | Ga0451576_0975231 | |||
| 1184 | Ga0451576_2575743 | |||
| 1185 | Ga0466958_0130164 | |||
| 1186 | Ga0466958_0176987 | |||
| 1187 | Ga0466967_0530756 | |||
| 1188 | Ga0495592_0206755 | |||
| 1189 | Ga0495592_0434296 | |||
| 1190 | Ga0495629_0036066 | |||
| 1191 | Ga0495651_0029623 | |||
| 1192 | Ga0495651_0030099 | |||
| 1193 | Ga0495651_0453127 | |||
| 1194 | Ga0495653_0140511 | |||
| 1195 | Ga0495580_0038917 | |||
| 1196 | Ga0495580_0046887 | |||
| 1197 | Ga0495582_0276532 | |||
| 1198 | Ga0495639_0651158 | |||
| 1199 | Ga0495662_0356904 | |||
| 1200 | Ga0495664_0037436 | |||
| 1201 | Ga0495608_0043841 | |||
| 1202 | Ga0495608_0422703 | |||
| 1203 | Ga0495628_0015190 | |||
| 1204 | Ga0495628_0322861 | |||
| 1205 | Ga0495630_0160549 | |||
| 1206 | Ga0495652_0046377 | |||
| 1207 | Ga0495652_0115882 | |||
| 1208 | Ga0495652_0371922 | |||
| 1209 | Ga0495665_0696559 | |||
| 1210 | Ga0495640_0370970 | |||
| 1211 | Ga0495586_0203285 | |||
| 1212 | Ga0495587_0000047 | |||
| 1213 | Ga0495587_0355398 | |||
| 1214 | Ga0495587_0371368 | |||
| 1215 | Ga0495645_0014141 | |||
| 1216 | Ga0495645_0111346 | |||
| 1217 | Ga0495634_0416594 | |||
| 1218 | Ga0495635_0080516 | |||
| 1219 | Ga0495657_0595393 | |||
| 1220 | Ga0495599_0003513 | |||
| 1221 | Ga0495623_0022593 | |||
| 1222 | Ga0495623_0163577 | |||
| 1223 | Ga0495658_0027155 | |||
| 1224 | Ga0495658_0137148 | |||
| 1225 | Ga0495669_0042534 | |||
| 1226 | Ga0495613_0351803 | |||
| 1227 | Ga0495613_0964444 | |||
| 1228 | Ga0495670_0395579 | |||
| 1229 | Ga0495670_0817555 | |||
| 1230 | Ga0495600_0039789 | |||
| 1231 | Ga0495604_0047521 | |||
| 1232 | Ga0495604_0420857 | |||
| 1233 | Ga0495674_0070288 | |||
| 1234 | Ga0495674_0091739 | |||
| 1235 | Ga0495680_0114890 | |||
| 1236 | Ga0495675_0000391 | |||
| 1237 | Ga0495675_0059015 | |||
| 1238 | Ga0495684_0142366 | |||
| 1239 | Ga0495593_0199871 | |||
| 1240 | Ga0495602_0001895 | |||
| 1241 | Ga0495602_0209395 | |||
| 1242 | Ga0495602_0331722 | |||
| 1243 | Ga0495602_0719413 | |||
| 1244 | Ga0496101_0367794 | |||
| 1245 | Ga0496104_0065670 | |||
| 1246 | Ga0496104_0266422 | |||
| 1247 | Ga0496104_1253964 | |||
| 1248 | Ga0496105_0531118 | |||
| 1249 | Ga0496106_0016838 | |||
| 1250 | Ga0496106_0300907 | |||
| 1251 | Ga0496107_0264056 | |||
| 1252 | Ga0496108_0996419 | |||
| 1253 | Ga0496108_1657714 | |||
| 1254 | Ga0496110_0407916 | |||
| 1255 | Ga0496112_0004345 | |||
| 1256 | Ga0496112_0232211 | |||
| 1257 | Ga0496112_0873352 | |||
| 1258 | Ga0496112_1337575 | |||
| 1259 | Ga0496112_1403785 | |||
| 1260 | Ga0496115_0041230 | |||
| 1261 | Ga0496115_0071681 | |||
| 1262 | Ga0496115_0136703 | |||
| 1263 | Ga0496115_0621606 | |||
| 1264 | Ga0496126_0199619 | |||
| 1265 | Ga0501032_0436042 | |||
| 1266 | Ga0501036_0016911 | |||
| 1267 | Ga0501040_0064014 | |||
| 1268 | Ga0501040_0408370 | |||
| 1269 | Ga0501040_0429508 | |||
| 1270 | Ga0501041_0033974 | |||
| 1271 | Ga0501041_0054973 | |||
| 1272 | Ga0501042_0071069 | |||
| 1273 | Ga0501042_0166795 | |||
| 1274 | Ga0501042_0643113 | |||
| 1275 | Ga0501048_0312622 | |||
| 1276 | Ga0501068_0068753 | |||
| 1277 | Ga0501071_0012722 | |||
| 1278 | Ga0501071_0057513 | |||
| 1279 | Ga0501071_0886093 | |||
| 1280 | Ga0501072_0321878 | |||
| 1281 | Ga0501072_0347345 | |||
| 1282 | Ga0501074_0335527 | |||
| 1283 | Ga0501075_0024322 | |||
| 1284 | Ga0501075_0158518 | |||
| 1285 | Ga0501075_1065592 | |||
| 1286 | Ga0501076_0179627 | |||
| 1287 | Ga0501077_0363713 | |||
| 1288 | Ga0501079_0219657 | |||
| 1289 | Ga0501079_0759652 | |||
| 1290 | Ga0501080_0095955 | |||
| 1291 | Ga0501035_0512056 | |||
| 1292 | Ga0501045_0212938 | |||
| 1293 | nmdc:mga05p37_229180_c1 | |||
| 1294 | nmdc:mga05p37_2316_c1 | |||
| 1295 | nmdc:mga05p37_360663_c1 | |||
| 1296 | nmdc:mga05p37_361406_c1 | |||
| 1297 | nmdc:mga0qj67_508010_c1 | |||
| 1298 | nmdc:mga06r32_482815_c1 | |||
| 1299 | nmdc:mga06r32_63742_c1 | |||
| 1300 | nmdc:mga08y16_457620_c1 | |||
| 1301 | nmdc:mga08y16_51952_c1 | |||
| 1302 | nmdc:mga0n895_1034890_c1 | |||
| 1303 | nmdc:mga0n895_1145_c1 | |||
| 1304 | nmdc:mga0n895_408692_c1 | |||
| 1305 | nmdc:mga0n895_734712_c1 | |||
| 1306 | nmdc:mga0rr50_1436_c1 | |||
| 1307 | nmdc:mga0rr50_384292_c1 | |||
| 1308 | nmdc:mga08x19_151664_c1 | |||
| 1309 | nmdc:mga08x19_275315_c1 | |||
| 1310 | nmdc:mga08x19_429260_c1 | |||
| 1311 | nmdc:mga08x19_8672_c1 | |||
| 1312 | nmdc:mga08x19_959047_c1 | |||
| 1313 | nmdc:mga0a205_1107230_c1 | |||
| 1314 | nmdc:mga0a205_231053_c1 | |||
| 1315 | nmdc:mga0a205_279090_c1 | |||
| 1316 | nmdc:mga0a205_365803_c1 | |||
| 1317 | nmdc:mga0a205_396134_c1 | |||
| 1318 | nmdc:mga0a205_79381_c1 | |||
| 1319 | nmdc:mga0a205_820083_c1 | |||
| 1320 | Ga0495619_1029870 | |||
| 1321 | Ga0501084_0145856 | |||
| 1322 | Ga0501082_0238671 | |||
| 1323 | Ga0501082_1171239 | |||
| 1324 | Ga0530510_0099297 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2nv4-assembly1.cif.gz_B | crystal structure of upf0066 protein af0241 in complex with s-adenosylmethionine. northeast structural genomics consortium target gr27 | 0.8782 | 2 | 132 |
| 3okx-assembly1.cif.gz_A | crystal structure of yaeb-like protein from rhodopseudomonas palustris | 0.8633 | 2 | 132 |
| 3okx-assembly1.cif.gz_B | crystal structure of yaeb-like protein from rhodopseudomonas palustris | 0.8603 | 2 | 127 |
| 2nv4-assembly1.cif.gz_B | crystal structure of upf0066 protein af0241 in complex with s-adenosylmethionine. northeast structural genomics consortium target gr27 | 0.8594 | 2 | 132 |
| 7bu1-assembly1.cif.gz_A | crystal structure of trmo from pseudomonas aeruginosa | 0.823 | 1 | 134 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q6NMB4_59_230_2.40.30.70 | Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3;YaeB-like | 0.9166 | 1 | 128 | 2.40.30.70 |
| af_P28634_1_140_2.40.30.70 | Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3;YaeB-like | 0.9066 | 1 | 128 | 2.40.30.70 |
| af_A1Z759_99_248_2.40.30.70 | Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3;YaeB-like | 0.8968 | 3 | 133 | 2.40.30.70 |
| af_Q54CD3_97_243_2.40.30.70 | Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3;YaeB-like | 0.8873 | 6 | 133 | 2.40.30.70 |
| 2nv4B00 | Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3;YaeB-like | 0.8701 | 3 | 132 | 2.40.30.70 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2V9IQY1-F1-model_v4 | tRNA (N6-threonylcarbamoyladenosine(37)-N6)-methyltransferase TrmO | 0.9825 | 1 | 120 |
GO:0008168
GO:0032259 |
| AF-A0A2V9IQY1-F1-model_v4 | tRNA (N6-threonylcarbamoyladenosine(37)-N6)-methyltransferase TrmO | 0.9587 | 1 | 120 |
GO:0008168
GO:0032259 |
| AF-X0T1Q8-F1-model_v4 | TsaA-like domain-containing protein | 0.9403 | 5 | 127 |
|
| AF-A0A839JFT4-F1-model_v4 | SAM-dependent methyltransferase | 0.9332 | 1 | 127 |
GO:0008168
GO:0032259 |
| AF-A0A6G4HMT6-F1-model_v4 | tRNA (N6-threonylcarbamoyladenosine(37)-N6)-methyltransferase TrmO | 0.9326 | 1 | 129 |
GO:0008168
GO:0032259 |