F473459

General Info

Members Datasets Scaffolds Average Seq Length
662 326 1324 151

Family's Representative Sequence

Representative Sequence 3300005436|Ga0070713_100670012|Ga0070713_1006700122
Length 179
Sequence MRLPRIRLRYHQIADVSAHIFETEPDVFTPKPIGFIRSPFSDTKSIPKGLGVRHDEEGILEILPEFEAGLTDVEGFSHLFVIWAFDRSEGYELFGRSPTDDRPHGVFATRSPRRPNPIALTVVELLGRDGRNLHVRGLDMLDGTPILDIKPYMSSIPAEKLRRGWLAEAEARTQNHPPR

Samples

Sample ID Description Type Environment
1 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
27 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
28 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
29 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
30 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
31 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
32 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
33 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
40 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
41 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
42 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
43 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
44 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
45 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
46 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
47 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
48 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
49 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
50 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
51 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
52 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
53 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
54 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
55 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
56 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
57 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
58 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
59 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
60 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
61 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
62 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
63 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
64 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
65 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
66 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
67 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
68 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
69 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
70 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
71 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
72 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
73 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
75 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
76 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
77 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
78 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
79 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
80 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
81 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
82 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
83 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
84 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
85 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
86 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
87 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
88 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
89 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
90 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
91 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
92 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
93 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
94 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
95 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
96 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
97 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
98 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
99 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
100 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
101 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
102 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
103 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
104 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
105 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
106 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
107 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
108 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
109 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
110 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
111 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
112 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
113 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
114 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
115 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
116 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
117 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
177 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
178 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
182 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
183 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
184 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
185 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
186 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
187 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
188 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
189 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
190 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
191 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
192 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
193 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
194 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
195 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
196 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
197 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
198 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
199 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
200 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
201 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
202 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
203 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
204 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
205 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
206 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
207 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
208 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
209 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
210 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
211 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
212 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
213 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
214 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
215 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
216 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
217 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
218 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
219 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
220 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
221 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
222 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
223 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
224 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
225 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
226 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
227 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
228 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
229 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
230 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
231 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
232 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
233 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
234 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
235 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
236 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
237 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
238 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
239 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
240 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
241 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
242 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
243 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
244 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
245 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
246 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
247 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
248 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
249 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
250 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
251 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
252 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
253 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
254 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
255 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
256 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
257 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
258 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
259 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
260 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
261 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
262 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
263 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
264 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
265 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
266 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
267 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
268 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
269 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
270 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
271 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
272 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
273 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
274 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
275 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
276 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
277 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
278 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
279 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
280 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
281 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
282 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
283 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
284 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
285 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
286 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
287 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
288 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
289 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
290 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
291 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
292 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
293 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
294 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
295 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
296 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
297 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
298 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
299 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
300 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
301 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
302 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
303 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
304 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
305 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
306 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
307 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
308 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
309 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
310 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
311 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
312 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
313 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
314 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
315 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
316 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
317 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
318 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
319 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
320 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
321 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
322 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
323 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
324 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
325 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
326 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.55
Metatranscriptomes 0.45
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.02
Rhizosphere 96.37
Stem 0
Stem Tuber 0
Unclassified 30.82

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070713_100670012 3300005436 Bacteria 989
2 rootH2_10085532 3300003320 Bacteria 3074
3 Ga0065715_10246450 3300005293 Bacteria 1182
4 Ga0070676_10034643 3300005328 Bacteria 2899
5 Ga0070676_10744994 3300005328 Bacteria 719
6 Ga0070676_11078056 3300005328 Unclassified 606
7 Ga0070683_100097847 3300005329 Bacteria 2761
8 Ga0070683_100655116 3300005329 Unclassified 1005
9 Ga0070690_100128125 3300005330 Bacteria 1711
10 Ga0070690_100248171 3300005330 Unclassified 1258
11 Ga0070690_100358922 3300005330 Bacteria 1060
12 Ga0070690_100816328 3300005330 Bacteria 724
13 Ga0070670_100060133 3300005331 Bacteria 3262
14 Ga0070677_10238268 3300005333 Bacteria 897
15 Ga0068869_100005467 3300005334 Bacteria 7995
16 Ga0068869_100093110 3300005334 Unclassified 2270
17 Ga0068869_100476627 3300005334 Bacteria 1038
18 Ga0068869_100921282 3300005334 Bacteria 757
19 Ga0068869_101255585 3300005334 Bacteria 652
20 Ga0070666_10085837 3300005335 Unclassified 2156
21 Ga0070680_100496259 3300005336 Bacteria 1044
22 Ga0068868_100066043 3300005338 Unclassified 2875
23 Ga0068868_100124237 3300005338 Bacteria 2107
24 Ga0070689_100427196 3300005340 Bacteria 1124
25 Ga0070689_100429499 3300005340 Unclassified 1121
26 Ga0070687_100049971 3300005343 Unclassified 2158
27 Ga0070661_100166120 3300005344 Unclassified 1674
28 Ga0070692_10431158 3300005345 Bacteria 839
29 Ga0070668_100022053 3300005347 Bacteria 4814
30 Ga0070668_100615775 3300005347 Bacteria 951
31 Ga0070669_100057581 3300005353 Unclassified 2852
32 Ga0070669_101250220 3300005353 Unclassified 642
33 Ga0070669_101687282 3300005353 Unclassified 552
34 Ga0070675_100497006 3300005354 Bacteria 1099
35 Ga0070671_100276857 3300005355 Unclassified 1427
36 Ga0070674_101309702 3300005356 Bacteria 646
37 Ga0070673_100059045 3300005364 Bacteria 3035
38 Ga0070673_100908188 3300005364 Bacteria 817
39 Ga0070688_101682743 3300005365 Unclassified 519
40 Ga0070659_100475802 3300005366 Unclassified 1062
41 Ga0070667_100125513 3300005367 Unclassified 2236
42 Ga0070667_100493239 3300005367 Bacteria 1122
43 Ga0070703_10002836 3300005406 Bacteria 4965
44 Ga0070709_10000250 3300005434 Bacteria 34637
45 Ga0070709_10059174 3300005434 Bacteria 2432
46 Ga0070709_10145679 3300005434 Unclassified 1632
47 Ga0070714_100107984 3300005435 Bacteria 2460
48 Ga0070713_100060680 3300005436 Bacteria 3162
49 Ga0070713_100075720 3300005436 Bacteria 2855
50 Ga0070713_100091430 3300005436 Bacteria 2618
51 Ga0070713_100099400 3300005436 Bacteria 2517
52 Ga0070713_100144595 3300005436 Bacteria 2110
53 Ga0070713_100208276 3300005436 Bacteria 1769
54 Ga0070710_10546526 3300005437 Unclassified 799
55 Ga0070701_10963597 3300005438 Bacteria 593
56 Ga0070711_100000033 3300005439 Bacteria 96416
57 Ga0070711_100052104 3300005439 Bacteria 2815
58 Ga0070711_100364898 3300005439 Unclassified 1164
59 Ga0070711_100742404 3300005439 Unclassified 829
60 Ga0070711_100756111 3300005439 Unclassified 822
61 Ga0070694_100083845 3300005444 Bacteria 2222
62 Ga0070694_100176160 3300005444 Bacteria 1579
63 Ga0070708_100041728 3300005445 Bacteria 4024
64 Ga0070708_100042781 3300005445 Unclassified 3978
65 Ga0070708_100073053 3300005445 Unclassified 3091
66 Ga0070708_100145805 3300005445 Unclassified 2199
67 Ga0070708_100412548 3300005445 Bacteria 1274
68 Ga0070708_100424049 3300005445 Bacteria 1255
69 Ga0070663_100305995 3300005455 Unclassified 1274
70 Ga0070678_100015221 3300005456 Bacteria 4882
71 Ga0070662_100026776 3300005457 Bacteria 3996
72 Ga0070662_100293232 3300005457 Bacteria 1319
73 Ga0070681_10437735 3300005458 Bacteria 1219
74 Ga0070681_11228005 3300005458 Unclassified 672
75 Ga0068867_100103336 3300005459 Unclassified 2179
76 Ga0068867_100138685 3300005459 Bacteria 1899
77 Ga0068867_101546141 3300005459 Bacteria 619
78 Ga0070685_10095715 3300005466 Bacteria 1805
79 Ga0070685_10890084 3300005466 Unclassified 662
80 Ga0070706_100070491 3300005467 Bacteria 3232
81 Ga0070706_100330166 3300005467 Unclassified 1422
82 Ga0070706_100509565 3300005467 Bacteria 1119
83 Ga0070707_100084854 3300005468 Bacteria 3060
84 Ga0070707_100291674 3300005468 Bacteria 1585
85 Ga0070707_101081909 3300005468 Unclassified 768
86 Ga0070698_101887279 3300005471 Bacteria 550
87 Ga0070699_100029893 3300005518 Bacteria 4700
88 Ga0070699_100732803 3300005518 Bacteria 904
89 Ga0070699_101438865 3300005518 Bacteria 632
90 Ga0070679_100032076 3300005530 Bacteria 5195
91 Ga0070679_100808449 3300005530 Unclassified 881
92 Ga0070679_100819995 3300005530 Bacteria 873
93 Ga0068853_100434148 3300005539 Bacteria 1233
94 Ga0068853_100765974 3300005539 Bacteria 923
95 Ga0068853_101486141 3300005539 Unclassified 656
96 Ga0070672_100014202 3300005543 Bacteria 5636
97 Ga0070672_100241340 3300005543 Unclassified 1520
98 Ga0070686_101585218 3300005544 Unclassified 554
99 Ga0070695_100169161 3300005545 Unclassified 1541
100 Ga0070695_100643904 3300005545 Bacteria 836
101 Ga0070696_100296932 3300005546 Bacteria 1236
102 Ga0070693_100124956 3300005547 Bacteria 1600
103 Ga0070665_100015116 3300005548 Bacteria 7749
104 Ga0070665_100039108 3300005548 Bacteria 4770
105 Ga0070665_100040315 3300005548 Bacteria 4694
106 Ga0070665_100275766 3300005548 Unclassified 1683
107 Ga0070665_100792590 3300005548 Bacteria 961
108 Ga0070665_101513776 3300005548 Bacteria 679
109 Ga0070665_101573026 3300005548 Bacteria 665
110 Ga0070704_100040716 3300005549 Bacteria 3201
111 Ga0070704_100222732 3300005549 Bacteria 1534
112 Ga0068855_100254763 3300005563 Unclassified 1957
113 Ga0068855_100540726 3300005563 Bacteria 1262
114 Ga0068855_102505832 3300005563 Unclassified 513
115 Ga0070664_100040984 3300005564 Unclassified 3906
116 Ga0068854_100052824 3300005578 Bacteria 2916
117 Ga0068854_100080198 3300005578 Unclassified 2408
118 Ga0068854_100136990 3300005578 Bacteria 1875
119 Ga0068856_100199121 3300005614 Unclassified 2017
120 Ga0070702_100479422 3300005615 Unclassified 909
121 Ga0068852_100477501 3300005616 Unclassified 1238
122 Ga0068859_100009935 3300005617 Bacteria 9602
123 Ga0068859_100112478 3300005617 Unclassified 2786
124 Ga0068859_100179501 3300005617 Unclassified 2200
125 Ga0068859_100661523 3300005617 Bacteria 1136
126 Ga0068864_100018082 3300005618 Bacteria 5883
127 Ga0068864_100084274 3300005618 Bacteria 2792
128 Ga0068861_100081493 3300005719 Bacteria 2534
129 Ga0068861_100089962 3300005719 Bacteria 2420
130 Ga0068861_100166290 3300005719 Bacteria 1824
131 Ga0068861_100370937 3300005719 Unclassified 1261
132 Ga0068851_10069941 3300005834 Bacteria 1814
133 Ga0068851_10287614 3300005834 Unclassified 942
134 Ga0068870_10386987 3300005840 Bacteria 907
135 Ga0068863_100042774 3300005841 Bacteria 4304
136 Ga0068863_100063715 3300005841 Bacteria 3487
137 Ga0068863_100537283 3300005841 Bacteria 1153
138 Ga0068863_100641902 3300005841 Bacteria 1052
139 Ga0068858_100001405 3300005842 Bacteria 24749
140 Ga0068858_100066618 3300005842 Bacteria 3334
141 Ga0068858_100098885 3300005842 Bacteria 2720
142 Ga0068858_100614211 3300005842 Bacteria 1055
143 Ga0068860_100193650 3300005843 Bacteria 1968
144 Ga0068860_100222464 3300005843 Bacteria 1833
145 Ga0068860_100405805 3300005843 Unclassified 1349
146 Ga0068860_100839712 3300005843 Bacteria 933
147 Ga0068860_101526656 3300005843 Bacteria 690
148 Ga0068862_100059209 3300005844 Bacteria 3289
149 Ga0081538_10008982 3300005981 Bacteria 8397
150 Ga0070717_10428636 3300006028 Unclassified 1190
151 Ga0070717_10450964 3300006028 Unclassified 1159
152 Ga0070715_10649950 3300006163 Unclassified 624
153 Ga0070716_100277021 3300006173 Bacteria 1156
154 Ga0070716_101440392 3300006173 Bacteria 561
155 Ga0070712_100057634 3300006175 Bacteria 2730
156 Ga0070712_100187696 3300006175 Unclassified 1615
157 Ga0070712_100216073 3300006175 Bacteria 1515
158 Ga0070712_100487773 3300006175 Unclassified 1031
159 Ga0070712_101498772 3300006175 Unclassified 589
160 Ga0097621_100122815 3300006237 Bacteria 2204
161 Ga0097621_100733565 3300006237 Unclassified 911
162 Ga0068871_100110392 3300006358 Bacteria 2313
163 Ga0068871_100117993 3300006358 Unclassified 2238
164 Ga0068871_100151757 3300006358 Bacteria 1976
165 Ga0068871_100316773 3300006358 Bacteria 1372
166 Ga0075428_100008720 3300006844 Bacteria 11251
167 Ga0075428_100093108 3300006844 Bacteria 3285
168 Ga0075428_101184426 3300006844 Bacteria 806
169 Ga0075430_100539449 3300006846 Bacteria 962
170 Ga0075431_100705185 3300006847 Bacteria 987
171 Ga0075433_10068656 3300006852 Bacteria 3112
172 Ga0075433_10225145 3300006852 Bacteria 1666
173 Ga0075433_10262857 3300006852 Unclassified 1530
174 Ga0075434_100000744 3300006871 Bacteria 25604
175 Ga0075434_100166897 3300006871 Unclassified 2221
176 Ga0075434_100334109 3300006871 Unclassified 1536
177 Ga0075434_100352794 3300006871 Bacteria 1492
178 Ga0075429_100325105 3300006880 Bacteria 1346
179 Ga0075429_100548435 3300006880 Bacteria 1013
180 Ga0075429_100869179 3300006880 Bacteria 789
181 Ga0068865_100054547 3300006881 Bacteria 2778
182 Ga0068865_100058065 3300006881 Bacteria 2702
183 Ga0075436_100002464 3300006914 Bacteria 12739
184 Ga0075436_100007793 3300006914 Bacteria 7324
185 Ga0075436_100232278 3300006914 Bacteria 1310
186 Ga0075436_100239158 3300006914 Bacteria 1291
187 Ga0075436_100488597 3300006914 Bacteria 900
188 Ga0075436_100680117 3300006914 Bacteria 761
189 Ga0097620_100009935 3300006931 Bacteria 9602
190 Ga0097620_100112483 3300006931 Unclassified 2786
191 Ga0097620_100179499 3300006931 Unclassified 2200
192 Ga0097620_100661584 3300006931 Bacteria 1136
193 Ga0075435_100000431 3300007076 Bacteria 25670
194 Ga0075435_101051670 3300007076 Unclassified 711
195 Ga0099795_10381207 3300007788 Unclassified 637
196 Ga0105251_10405448 3300009011 Unclassified 627
197 Ga0105240_10026251 3300009093 Bacteria 7640
198 Ga0105240_10045482 3300009093 Bacteria 5568
199 Ga0105240_10060972 3300009093 Unclassified 4702
200 Ga0105240_10064011 3300009093 Unclassified 4571
201 Ga0105240_10102031 3300009093 Bacteria 3487
202 Ga0105240_10105507 3300009093 Bacteria 3421
203 Ga0105240_10136719 3300009093 Bacteria 2934
204 Ga0105240_10197925 3300009093 Bacteria 2357
205 Ga0105240_10560609 3300009093 Unclassified 1263
206 Ga0105240_10727859 3300009093 Bacteria 1080
207 Ga0111539_10120674 3300009094 Bacteria 3072
208 Ga0111539_10127899 3300009094 Bacteria 2975
209 Ga0111539_11037600 3300009094 Bacteria 953
210 Ga0105245_10470286 3300009098 Unclassified 1269
211 Ga0105247_10061933 3300009101 Bacteria 2320
212 Ga0105247_10071727 3300009101 Bacteria 2167
213 Ga0105247_10361665 3300009101 Unclassified 1024
214 Ga0114129_10007878 3300009147 Bacteria 15157
215 Ga0114129_10025007 3300009147 Bacteria 8465
216 Ga0114129_10033701 3300009147 Bacteria 7236
217 Ga0114129_10099732 3300009147 Bacteria 4019
218 Ga0114129_10212585 3300009147 Unclassified 2614
219 Ga0105243_10393433 3300009148 Unclassified 1285
220 Ga0105243_10761067 3300009148 Unclassified 950
221 Ga0105241_10280405 3300009174 Unclassified 1423
222 Ga0105241_10698597 3300009174 Unclassified 926
223 Ga0105241_10841808 3300009174 Unclassified 848
224 Ga0105241_11412639 3300009174 Bacteria 667
225 Ga0105242_10249910 3300009176 Bacteria 1597
226 Ga0105248_10227467 3300009177 Unclassified 2100
227 Ga0105248_10262955 3300009177 Unclassified 1942
228 Ga0105248_10351173 3300009177 Bacteria 1660
229 Ga0105237_10258360 3300009545 Unclassified 1744
230 Ga0105237_10348530 3300009545 Bacteria 1485
231 Ga0105237_10515342 3300009545 Unclassified 1202
232 Ga0105238_10193154 3300009551 Unclassified 2011
233 Ga0105249_10654019 3300009553 Bacteria 1109
234 Ga0105239_10351505 3300010375 Unclassified 1664
235 Ga0105246_10011856 3300011119 Bacteria 5421
236 Ga0105246_10348653 3300011119 Bacteria 1212
237 Ga0105246_11508314 3300011119 Unclassified 632
238 Ga0157373_10131399 3300013100 Bacteria 1761
239 Ga0157373_10515492 3300013100 Unclassified 865
240 Ga0157370_10187656 3300013104 Bacteria 1919
241 Ga0157369_10032326 3300013105 Bacteria 5755
242 Ga0157369_10394915 3300013105 Bacteria 1435
243 Ga0157369_10715344 3300013105 Bacteria 1031
244 Ga0157369_10728378 3300013105 Bacteria 1021
245 Ga0157369_10965625 3300013105 Unclassified 873
246 Ga0157369_11102128 3300013105 Bacteria 811
247 Ga0157369_12518417 3300013105 Bacteria 521
248 Ga0157374_10000012 3300013296 Bacteria 462353
249 Ga0157374_10008262 3300013296 Bacteria 8886
250 Ga0157374_10101058 3300013296 Bacteria 2765
251 Ga0157378_10045451 3300013297 Unclassified 3902
252 Ga0157378_10075246 3300013297 Bacteria 3039
253 Ga0157378_10370536 3300013297 Unclassified 1404
254 Ga0163162_10039775 3300013306 Bacteria 4700
255 Ga0157372_10042968 3300013307 Bacteria 5002
256 Ga0157372_10170903 3300013307 Bacteria 2515
257 Ga0157372_10221865 3300013307 Bacteria 2191
258 Ga0157372_10619390 3300013307 Bacteria 1261
259 Ga0157375_10027800 3300013308 Bacteria 5292
260 Ga0157375_10125011 3300013308 Bacteria 2686
261 Ga0157375_10178203 3300013308 Unclassified 2276
262 Ga0157375_12148333 3300013308 Bacteria 665
263 Ga0163163_10194094 3300014325 Bacteria 2078
264 Ga0163163_11108886 3300014325 Bacteria 854
265 Ga0163163_12076414 3300014325 Bacteria 628
266 Ga0157380_10003291 3300014326 Bacteria 11079
267 Ga0157380_10380409 3300014326 Bacteria 1332
268 Ga0157380_10473235 3300014326 Bacteria 1209
269 Ga0157377_10000002 3300014745 Bacteria 473827
270 Ga0157377_10037084 3300014745 Bacteria 2685
271 Ga0157379_10045284 3300014968 Bacteria 3927
272 Ga0157379_10165911 3300014968 Unclassified 1993
273 Ga0157379_10237593 3300014968 Bacteria 1652
274 Ga0157379_10534938 3300014968 Bacteria 1089
275 Ga0157376_10004945 3300014969 Bacteria 9295
276 Ga0157376_10282425 3300014969 Unclassified 1564
277 Ga0157376_10330733 3300014969 Unclassified 1452
278 Ga0157376_10534881 3300014969 Bacteria 1157
279 Ga0163161_10109075 3300017792 Unclassified 2067
280 Ga0206356_11700659 3300020070 Unclassified 1703
281 Ga0154015_1668427 3300020610 Unclassified 1057
282 Ga0207697_10198669 3300025315 Bacteria 882
283 Ga0207656_10224591 3300025321 Unclassified 914
284 Ga0207653_10100187 3300025885 Unclassified 1024
285 Ga0207710_10042921 3300025900 Unclassified 2010
286 Ga0207680_10077430 3300025903 Unclassified 2080
287 Ga0207647_10012485 3300025904 Bacteria 5912
288 Ga0207647_10029739 3300025904 Bacteria 3530
289 Ga0207685_10209262 3300025905 Bacteria 921
290 Ga0207699_10000211 3300025906 Bacteria 34696
291 Ga0207699_10389236 3300025906 Unclassified 991
292 Ga0207699_10837128 3300025906 Unclassified 677
293 Ga0207645_10023188 3300025907 Unclassified 4034
294 Ga0207645_10603606 3300025907 Unclassified 745
295 Ga0207643_10147042 3300025908 Unclassified 1410
296 Ga0207684_10033929 3300025910 Bacteria 4340
297 Ga0207684_10422153 3300025910 Unclassified 1146
298 Ga0207684_10440598 3300025910 Bacteria 1119
299 Ga0207654_10647805 3300025911 Unclassified 756
300 Ga0207654_10716541 3300025911 Unclassified 719
301 Ga0207707_10183980 3300025912 Unclassified 1823
302 Ga0207707_10618513 3300025912 Bacteria 915
303 Ga0207707_10849887 3300025912 Unclassified 757
304 Ga0207695_10004762 3300025913 Bacteria 18353
305 Ga0207695_10013190 3300025913 Bacteria 9862
306 Ga0207695_10171806 3300025913 Bacteria 2093
307 Ga0207695_10292793 3300025913 Unclassified 1520
308 Ga0207695_10300996 3300025913 Unclassified 1495
309 Ga0207695_11154471 3300025913 Bacteria 655
310 Ga0207695_11175183 3300025913 Unclassified 647
311 Ga0207671_10155543 3300025914 Unclassified 1768
312 Ga0207671_11483705 3300025914 Unclassified 524
313 Ga0207693_10275503 3300025915 Bacteria 1318
314 Ga0207663_10000026 3300025916 Bacteria 109142
315 Ga0207663_10185054 3300025916 Bacteria 1491
316 Ga0207660_10033655 3300025917 Bacteria 3547
317 Ga0207660_10175225 3300025917 Unclassified 1662
318 Ga0207662_10303789 3300025918 Unclassified 1061
319 Ga0207657_10725535 3300025919 Bacteria 771
320 Ga0207652_10013216 3300025921 Bacteria 6685
321 Ga0207652_10509954 3300025921 Unclassified 1082
322 Ga0207646_10147315 3300025922 Bacteria 2122
323 Ga0207646_10248548 3300025922 Bacteria 1606
324 Ga0207681_10041686 3300025923 Unclassified 3062
325 Ga0207681_10107477 3300025923 Bacteria 2024
326 Ga0207694_10041708 3300025924 Bacteria 3537
327 Ga0207694_10396121 3300025924 Unclassified 1148
328 Ga0207650_10721931 3300025925 Bacteria 842
329 Ga0207650_11807293 3300025925 Unclassified 517
330 Ga0207659_10369415 3300025926 Bacteria 1194
331 Ga0207687_10303974 3300025927 Unclassified 1286
332 Ga0207687_10345468 3300025927 Bacteria 1211
333 Ga0207700_10010649 3300025928 Bacteria 5816
334 Ga0207700_10072072 3300025928 Bacteria 2663
335 Ga0207700_10155491 3300025928 Unclassified 1894
336 Ga0207700_10252992 3300025928 Unclassified 1506
337 Ga0207700_10281862 3300025928 Bacteria 1430
338 Ga0207700_11393785 3300025928 Unclassified 623
339 Ga0207664_10072541 3300025929 Unclassified 2776
340 Ga0207664_10093662 3300025929 Bacteria 2468
341 Ga0207664_10478985 3300025929 Bacteria 1113
342 Ga0207644_10122462 3300025931 Bacteria 1982
343 Ga0207690_11818500 3300025932 Unclassified 509
344 Ga0207706_10015660 3300025933 Bacteria 6852
345 Ga0207706_10026970 3300025933 Bacteria 5139
346 Ga0207706_10099176 3300025933 Unclassified 2563
347 Ga0207686_10207706 3300025934 Bacteria 1406
348 Ga0207670_10200755 3300025936 Bacteria 1515
349 Ga0207670_10547877 3300025936 Unclassified 945
350 Ga0207670_11652365 3300025936 Unclassified 545
351 Ga0207669_10184530 3300025937 Bacteria 1499
352 Ga0207704_10015609 3300025938 Bacteria 3876
353 Ga0207704_10043693 3300025938 Bacteria 2648
354 Ga0207665_10027600 3300025939 Bacteria 3750
355 Ga0207665_10033120 3300025939 Bacteria 3424
356 Ga0207665_10257559 3300025939 Unclassified 1291
357 Ga0207665_10363618 3300025939 Bacteria 1095
358 Ga0207691_10021009 3300025940 Bacteria 6170
359 Ga0207691_10394681 3300025940 Bacteria 1180
360 Ga0207711_10081570 3300025941 Bacteria 2826
361 Ga0207711_10238087 3300025941 Unclassified 1668
362 Ga0207711_10345333 3300025941 Unclassified 1378
363 Ga0207689_10000308 3300025942 Bacteria 44966
364 Ga0207689_10130099 3300025942 Unclassified 2071
365 Ga0207689_10456336 3300025942 Bacteria 1068
366 Ga0207689_10571830 3300025942 Bacteria 950
367 Ga0207661_10152928 3300025944 Bacteria 1996
368 Ga0207661_11180320 3300025944 Bacteria 704
369 Ga0207661_11506382 3300025944 Unclassified 616
370 Ga0207679_10120291 3300025945 Unclassified 2089
371 Ga0207679_10431106 3300025945 Unclassified 1165
372 Ga0207667_10030353 3300025949 Bacteria 5849
373 Ga0207667_10259613 3300025949 Bacteria 1776
374 Ga0207667_10346702 3300025949 Unclassified 1515
375 Ga0207667_10750867 3300025949 Unclassified 975
376 Ga0207651_10013432 3300025960 Bacteria 4688
377 Ga0207651_10225860 3300025960 Bacteria 1517
378 Ga0207668_10085732 3300025972 Unclassified 2299
379 Ga0207640_10039857 3300025981 Bacteria 2977
380 Ga0207640_10101791 3300025981 Unclassified 2016
381 Ga0207658_10093908 3300025986 Bacteria 2333
382 Ga0207658_10681497 3300025986 Unclassified 928
383 Ga0207677_10101266 3300026023 Bacteria 2120
384 Ga0207677_10123900 3300026023 Unclassified 1949
385 Ga0207703_10006087 3300026035 Bacteria 9648
386 Ga0207703_10048250 3300026035 Bacteria 3436
387 Ga0207703_10794365 3300026035 Bacteria 903
388 Ga0207639_10000198 3300026041 Bacteria 45415
389 Ga0207639_10279489 3300026041 Unclassified 1468
390 Ga0207678_10314968 3300026067 Unclassified 1346
391 Ga0207708_10090653 3300026075 Bacteria 2356
392 Ga0207702_10186310 3300026078 Bacteria 1914
393 Ga0207702_11705649 3300026078 Unclassified 623
394 Ga0207641_10097525 3300026088 Unclassified 2584
395 Ga0207641_10107912 3300026088 Bacteria 2463
396 Ga0207676_10068233 3300026095 Bacteria 2843
397 Ga0207676_10167398 3300026095 Unclassified 1911
398 Ga0207676_10170094 3300026095 Unclassified 1897
399 Ga0207676_10845891 3300026095 Unclassified 895
400 Ga0207674_10025813 3300026116 Bacteria 6256
401 Ga0207675_100014971 3300026118 Bacteria 7240
402 Ga0207675_100042947 3300026118 Bacteria 4222
403 Ga0207675_100374076 3300026118 Bacteria 1400
404 Ga0207675_100501553 3300026118 Unclassified 1208
405 Ga0207683_10060072 3300026121 Bacteria 3341
406 Ga0207698_10255236 3300026142 Unclassified 1607
407 Ga0207428_10138588 3300027907 Unclassified 1859
408 Ga0207428_10315247 3300027907 Bacteria 1156
409 Ga0265356_1008887 3300028017 Bacteria 1139
410 Ga0268266_10035593 3300028379 Bacteria 4236
411 Ga0268266_10444988 3300028379 Unclassified 1231
412 Ga0268266_10488170 3300028379 Bacteria 1175
413 Ga0268266_10667359 3300028379 Bacteria 1001
414 Ga0268266_10843147 3300028379 Unclassified 886
415 Ga0268266_11232852 3300028379 Unclassified 723
416 Ga0268265_10113151 3300028380 Bacteria 2220
417 Ga0268265_10863871 3300028380 Bacteria 886
418 Ga0268265_11186773 3300028380 Bacteria 760
419 Ga0268264_10210802 3300028381 Bacteria 1783
420 Ga0268264_10223276 3300028381 Unclassified 1735
421 Ga0268264_10820555 3300028381 Unclassified 930
422 Ga0268264_10947168 3300028381 Bacteria 866
423 Ga0265338_10006484 3300028800 Bacteria 14897
424 Ga0265338_10089618 3300028800 Bacteria 2548
425 Ga0265760_10113914 3300031090 Unclassified 863
426 Ga0265330_10112514 3300031235 Bacteria 1162
427 Ga0265325_10047989 3300031241 Bacteria 2209
428 Ga0265325_10188485 3300031241 Bacteria 957
429 Ga0265340_10040969 3300031247 Bacteria 2279
430 Ga0265339_10099346 3300031249 Bacteria 1517
431 Ga0265316_10059409 3300031344 Bacteria 2974
432 Ga0265316_10080713 3300031344 Unclassified 2494
433 Ga0265316_10247826 3300031344 Bacteria 1309
434 Ga0307408_100202123 3300031548 Unclassified 1609
435 Ga0265313_10105974 3300031595 Bacteria 1241
436 Ga0265314_10020092 3300031711 Bacteria 5160
437 Ga0265314_10134700 3300031711 Bacteria 1536
438 Ga0265314_10219832 3300031711 Bacteria 1109
439 Ga0265314_10412493 3300031711 Unclassified 728
440 Ga0265342_10337516 3300031712 Bacteria 787
441 Ga0265342_10383575 3300031712 Unclassified 728
442 Ga0307405_10000794 3300031731 Bacteria 12385
443 Ga0307413_10084306 3300031824 Bacteria 2048
444 Ga0307413_10142999 3300031824 Bacteria 1655
445 Ga0307410_10002116 3300031852 Bacteria 9431
446 Ga0307406_10010890 3300031901 Bacteria 5143
447 Ga0307407_10000504 3300031903 Bacteria 12027
448 Ga0307407_10510195 3300031903 Bacteria 883
449 Ga0307412_10175023 3300031911 Bacteria 1608
450 Ga0307412_10331464 3300031911 Unclassified 1215
451 Ga0307416_100001240 3300032002 Bacteria 13769
452 Ga0307416_100129070 3300032002 Unclassified 2271
453 Ga0307416_100197712 3300032002 Bacteria 1904
454 Ga0307411_10021573 3300032005 Bacteria 3772
455 Ga0307415_100003916 3300032126 Bacteria 7652
456 Ga0373930_0063950 3300034816 Bacteria 825
457 Ga0373948_0003131 3300034817 Bacteria 2516
458 Ga0373950_0003702 3300034818 Bacteria 2204
459 Ga0373958_0002058 3300034819 Bacteria 2778
460 Ga0373959_0013334 3300034820 Bacteria 1480
461 Ga0373938_0016504 3300034957 Bacteria 1443
462 Ga0373928_0001597 3300035084 Bacteria 4392
463 Ga0373929_0002095 3300035085 Bacteria 3711
464 Ga0373929_0182090 3300035085 Bacteria 580
465 Ga0373934_0015403 3300035086 Bacteria 2901
466 Ga0373940_0023768 3300035088 Bacteria 1584
467 Ga0373944_0185520 3300035089 Unclassified 748
468 Ga0373949_0001119 3300035090 Bacteria 8112
469 Ga0373951_0003335 3300035091 Unclassified 3929
470 Ga0373952_0000824 3300035092 Bacteria 5596
471 Ga0373923_0072403 3300035111 Bacteria 1482
472 Ga0373932_0028199 3300035112 Bacteria 1541
473 Ga0373939_0207860 3300035114 Bacteria 743
474 Ga0373941_0133142 3300035115 Bacteria 897
475 Ga0373953_0250776 3300035117 Bacteria 769
476 Ga0373954_0113812 3300035118 Bacteria 1310
477 Ga0373956_0019511 3300035119 Bacteria 2876
478 Ga0373957_0408871 3300035120 Bacteria 584
479 Ga0373960_0015485 3300035121 Bacteria 1947
480 Ga0373943_0016974 3300035170 Bacteria 3329
481 Ga0373955_0017707 3300035172 Bacteria 3530
482 Ga0373942_0001341 3300035207 Bacteria 6382
483 Ga0373961_0001024 3300035241 Bacteria 9104
484 Ga0373924_0118171 3300035410 Bacteria 1149
485 Ga0373924_0180050 3300035410 Bacteria 930
486 Ga0373924_0443110 3300035410 Unclassified 582
487 Ga0373931_0000743 3300035691 Bacteria 13596
488 Ga0373935_0169702 3300035692 Bacteria 1492
489 Ga0373935_0385657 3300035692 Unclassified 1004
490 Ga0373927_0213098 3300035695 Bacteria 1269
491 Ga0373933_0000227 3300035724 Bacteria 37466
492 Ga0373937_0000065 3300036401 Bacteria 95014
493 Ga0373937_0000240 3300036401 Bacteria 53719
494 Ga0373937_0073624 3300036401 Bacteria 3152
495 Ga0373937_0080566 3300036401 Bacteria 3011
496 Ga0373937_0494486 3300036401 Unclassified 1162
497 Ga0373937_0533271 3300036401 Archaea 1115
498 Ga0373937_0618579 3300036401 Bacteria 1028
499 Ga0316582_0214856 3300036647 Bacteria 1314
500 Ga0373925_0823969 3300037068 Bacteria 765
501 Ga0395898_0288429 3300037466 Bacteria 1566
502 Ga0436363_1580473 3300039450 Unclassified 941
503 Ga0451839_1409582 3300041496 Bacteria 1165
504 Ga0439442_061777 3300042002 Bacteria 794
505 Ga0439446_0025782 3300042156 Bacteria 1681
506 Ga0439434_0204629 3300042435 Bacteria 666
507 Ga0451577_0009200 3300042876 Bacteria 9529
508 Ga0451577_0202180 3300042876 Bacteria 1793
509 Ga0451577_0314276 3300042876 Bacteria 1420
510 Ga0453683_0054565 3300044673 Bacteria 2501
511 Ga0453683_0058054 3300044673 Bacteria 2421
512 Ga0466966_0061664 3300044684 Bacteria 2365
513 Ga0466961_0508882 3300044693 Bacteria 727
514 Ga0466964_0115555 3300044706 Bacteria 1202
515 Ga0466964_0214641 3300044706 Bacteria 931
516 Ga0453684_2093754 3300044712 Bacteria 568
517 Ga0453684_2109735 3300044712 Bacteria 565
518 Ga0466968_0626345 3300044735 Bacteria 545
519 Ga0466959_0175345 3300045049 Bacteria 1502
520 Ga0451576_0084276 3300045051 Bacteria 3306
521 Ga0451576_0975231 3300045051 Bacteria 888
522 Ga0451576_2575743 3300045051 Unclassified 519
523 Ga0466958_0130164 3300045836 Bacteria 1580
524 Ga0466958_0176987 3300045836 Unclassified 1353
525 Ga0466967_0530756 3300045976 Bacteria 1157
526 Ga0495592_0206755 3300046454 Unclassified 1321
527 Ga0495592_0434296 3300046454 Unclassified 826
528 Ga0495629_0036066 3300046459 Bacteria 3493
529 Ga0495651_0029623 3300046462 Bacteria 4268
530 Ga0495651_0030099 3300046462 Bacteria 4233
531 Ga0495651_0453127 3300046462 Bacteria 829
532 Ga0495653_0140511 3300046463 Bacteria 1699
533 Ga0495580_0038917 3300046472 Bacteria 3403
534 Ga0495580_0046887 3300046472 Bacteria 3065
535 Ga0495582_0276532 3300046473 Bacteria 964
536 Ga0495639_0651158 3300046475 Archaea 543
537 Ga0495662_0356904 3300046476 Unclassified 718
538 Ga0495664_0037436 3300046477 Bacteria 2863
539 Ga0495608_0043841 3300046511 Unclassified 2988
540 Ga0495608_0422703 3300046511 Bacteria 813
541 Ga0495628_0015190 3300046516 Bacteria 6432
542 Ga0495628_0322861 3300046516 Bacteria 1139
543 Ga0495630_0160549 3300046517 Bacteria 1711
544 Ga0495652_0046377 3300046529 Bacteria 3732
545 Ga0495652_0115882 3300046529 Bacteria 2146
546 Ga0495652_0371922 3300046529 Bacteria 1018
547 Ga0495665_0696559 3300046531 Unclassified 504
548 Ga0495640_0370970 3300046533 Bacteria 881
549 Ga0495586_0203285 3300046535 Unclassified 1123
550 Ga0495587_0000047 3300046536 Bacteria 105516
551 Ga0495587_0355398 3300046536 Unclassified 816
552 Ga0495587_0371368 3300046536 Bacteria 796
553 Ga0495645_0014141 3300046543 Bacteria 5657
554 Ga0495645_0111346 3300046543 Unclassified 1936
555 Ga0495634_0416594 3300046642 Unclassified 796
556 Ga0495635_0080516 3300046663 Bacteria 2229
557 Ga0495657_0595393 3300046675 Unclassified 640
558 Ga0495599_0003513 3300046678 Bacteria 9179
559 Ga0495623_0022593 3300046679 Bacteria 4062
560 Ga0495623_0163577 3300046679 Unclassified 1306
561 Ga0495658_0027155 3300046683 Unclassified 3077
562 Ga0495658_0137148 3300046683 Bacteria 1494
563 Ga0495669_0042534 3300046684 Bacteria 2020
564 Ga0495613_0351803 3300046689 Unclassified 1012
565 Ga0495613_0964444 3300046689 Bacteria 549
566 Ga0495670_0395579 3300046691 Unclassified 746
567 Ga0495670_0817555 3300046691 Bacteria 509
568 Ga0495600_0039789 3300046809 Bacteria 3062
569 Ga0495604_0047521 3300047317 Bacteria 3342
570 Ga0495604_0420857 3300047317 Bacteria 877
571 Ga0495674_0070288 3300047319 Bacteria 3025
572 Ga0495674_0091739 3300047319 Bacteria 2594
573 Ga0495680_0114890 3300047322 Bacteria 1992
574 Ga0495675_0000391 3300047444 Bacteria 30273
575 Ga0495675_0059015 3300047444 Bacteria 2433
576 Ga0495684_0142366 3300047471 Bacteria 1797
577 Ga0495593_0199871 3300047673 Unclassified 1005
578 Ga0495602_0001895 3300048088 Bacteria 20969
579 Ga0495602_0209395 3300048088 Bacteria 1481
580 Ga0495602_0331722 3300048088 Unclassified 1103
581 Ga0495602_0719413 3300048088 Bacteria 676
582 Ga0496101_0367794 3300048904 Unclassified 1131
583 Ga0496104_0065670 3300048907 Unclassified 3444
584 Ga0496104_0266422 3300048907 Bacteria 1626
585 Ga0496104_1253964 3300048907 Bacteria 644
586 Ga0496105_0531118 3300048908 Bacteria 920
587 Ga0496106_0016838 3300048909 Bacteria 5409
588 Ga0496106_0300907 3300048909 Unclassified 1286
589 Ga0496107_0264056 3300048910 Unclassified 1281
590 Ga0496108_0996419 3300048911 Bacteria 716
591 Ga0496108_1657714 3300048911 Bacteria 528
592 Ga0496110_0407916 3300048913 Unclassified 1239
593 Ga0496112_0004345 3300048915 Bacteria 11983
594 Ga0496112_0232211 3300048915 Unclassified 1799
595 Ga0496112_0873352 3300048915 Bacteria 822
596 Ga0496112_1337575 3300048915 Unclassified 632
597 Ga0496112_1403785 3300048915 Bacteria 613
598 Ga0496115_0041230 3300048918 Bacteria 3673
599 Ga0496115_0071681 3300048918 Unclassified 2810
600 Ga0496115_0136703 3300048918 Unclassified 2021
601 Ga0496115_0621606 3300048918 Bacteria 857
602 Ga0496126_0199619 3300048929 Unclassified 1690
603 Ga0501032_0436042 3300049569 Bacteria 840
604 Ga0501036_0016911 3300049572 Bacteria 6093
605 Ga0501040_0064014 3300049576 Bacteria 2531
606 Ga0501040_0408370 3300049576 Bacteria 976
607 Ga0501040_0429508 3300049576 Bacteria 950
608 Ga0501041_0033974 3300049577 Bacteria 3087
609 Ga0501041_0054973 3300049577 Bacteria 2429
610 Ga0501042_0071069 3300049578 Bacteria 2490
611 Ga0501042_0166795 3300049578 Bacteria 1589
612 Ga0501042_0643113 3300049578 Bacteria 771
613 Ga0501048_0312622 3300049582 Bacteria 1119
614 Ga0501068_0068753 3300049584 Bacteria 2159
615 Ga0501071_0012722 3300049587 Bacteria 5720
616 Ga0501071_0057513 3300049587 Bacteria 2811
617 Ga0501071_0886093 3300049587 Bacteria 688
618 Ga0501072_0321878 3300049588 Bacteria 1229
619 Ga0501072_0347345 3300049588 Bacteria 1178
620 Ga0501074_0335527 3300049590 Bacteria 1073
621 Ga0501075_0024322 3300049591 Bacteria 4440
622 Ga0501075_0158518 3300049591 Bacteria 1726
623 Ga0501075_1065592 3300049591 Bacteria 614
624 Ga0501076_0179627 3300049592 Bacteria 1725
625 Ga0501077_0363713 3300049593 Unclassified 924
626 Ga0501079_0219657 3300049741 Bacteria 1485
627 Ga0501079_0759652 3300049741 Bacteria 763
628 Ga0501080_0095955 3300049742 Bacteria 2753
629 Ga0501035_0512056 3300049822 Bacteria 987
630 Ga0501045_0212938 3300049824 Bacteria 1439
631 nmdc:mga05p37_229180_c1 3300050507 Bacteria 2239
632 nmdc:mga05p37_2316_c1 3300050507 Bacteria 22175
633 nmdc:mga05p37_360663_c1 3300050507 Bacteria 1709
634 nmdc:mga05p37_361406_c1 3300050507 Bacteria 1706
635 nmdc:mga0qj67_508010_c1 3300050509 Bacteria 969
636 nmdc:mga06r32_482815_c1 3300050510 Unclassified 1217
637 nmdc:mga06r32_63742_c1 3300050510 Bacteria 3553
638 nmdc:mga08y16_457620_c1 3300050511 Unclassified 1301
639 nmdc:mga08y16_51952_c1 3300050511 Bacteria 4289
640 nmdc:mga0n895_1034890_c1 3300050512 Unclassified 801
641 nmdc:mga0n895_1145_c1 3300050512 Bacteria 19414
642 nmdc:mga0n895_408692_c1 3300050512 Bacteria 1373
643 nmdc:mga0n895_734712_c1 3300050512 Unclassified 981
644 nmdc:mga0rr50_1436_c1 3300050513 Bacteria 13102
645 nmdc:mga0rr50_384292_c1 3300050513 Unclassified 1184
646 nmdc:mga08x19_151664_c1 3300050514 Bacteria 1570
647 nmdc:mga08x19_275315_c1 3300050514 Bacteria 1165
648 nmdc:mga08x19_429260_c1 3300050514 Bacteria 929
649 nmdc:mga08x19_8672_c1 3300050514 Bacteria 6063
650 nmdc:mga08x19_959047_c1 3300050514 Bacteria 608
651 nmdc:mga0a205_1107230_c1 3300050515 Bacteria 639
652 nmdc:mga0a205_231053_c1 3300050515 Bacteria 1733
653 nmdc:mga0a205_279090_c1 3300050515 Bacteria 1546
654 nmdc:mga0a205_365803_c1 3300050515 Bacteria 1308
655 nmdc:mga0a205_396134_c1 3300050515 Bacteria 1245
656 nmdc:mga0a205_79381_c1 3300050515 Bacteria 3171
657 nmdc:mga0a205_820083_c1 3300050515 Unclassified 778
658 Ga0495619_1029870 3300053085 Unclassified 550
659 Ga0501084_0145856 3300054114 Bacteria 1994
660 Ga0501082_0238671 3300060353 Bacteria 1582
661 Ga0501082_1171239 3300060353 Bacteria 672
662 Ga0530510_0099297 3300061734 Bacteria 2128
663 Ga0070713_100670012
664 rootH2_10085532
665 Ga0065715_10246450
666 Ga0070676_10034643
667 Ga0070676_10744994
668 Ga0070676_11078056
669 Ga0070683_100097847
670 Ga0070683_100655116
671 Ga0070690_100128125
672 Ga0070690_100248171
673 Ga0070690_100358922
674 Ga0070690_100816328
675 Ga0070670_100060133
676 Ga0070677_10238268
677 Ga0068869_100005467
678 Ga0068869_100093110
679 Ga0068869_100476627
680 Ga0068869_100921282
681 Ga0068869_101255585
682 Ga0070666_10085837
683 Ga0070680_100496259
684 Ga0068868_100066043
685 Ga0068868_100124237
686 Ga0070689_100427196
687 Ga0070689_100429499
688 Ga0070687_100049971
689 Ga0070661_100166120
690 Ga0070692_10431158
691 Ga0070668_100022053
692 Ga0070668_100615775
693 Ga0070669_100057581
694 Ga0070669_101250220
695 Ga0070669_101687282
696 Ga0070675_100497006
697 Ga0070671_100276857
698 Ga0070674_101309702
699 Ga0070673_100059045
700 Ga0070673_100908188
701 Ga0070688_101682743
702 Ga0070659_100475802
703 Ga0070667_100125513
704 Ga0070667_100493239
705 Ga0070703_10002836
706 Ga0070709_10000250
707 Ga0070709_10059174
708 Ga0070709_10145679
709 Ga0070714_100107984
710 Ga0070713_100060680
711 Ga0070713_100075720
712 Ga0070713_100091430
713 Ga0070713_100099400
714 Ga0070713_100144595
715 Ga0070713_100208276
716 Ga0070710_10546526
717 Ga0070701_10963597
718 Ga0070711_100000033
719 Ga0070711_100052104
720 Ga0070711_100364898
721 Ga0070711_100742404
722 Ga0070711_100756111
723 Ga0070694_100083845
724 Ga0070694_100176160
725 Ga0070708_100041728
726 Ga0070708_100042781
727 Ga0070708_100073053
728 Ga0070708_100145805
729 Ga0070708_100412548
730 Ga0070708_100424049
731 Ga0070663_100305995
732 Ga0070678_100015221
733 Ga0070662_100026776
734 Ga0070662_100293232
735 Ga0070681_10437735
736 Ga0070681_11228005
737 Ga0068867_100103336
738 Ga0068867_100138685
739 Ga0068867_101546141
740 Ga0070685_10095715
741 Ga0070685_10890084
742 Ga0070706_100070491
743 Ga0070706_100330166
744 Ga0070706_100509565
745 Ga0070707_100084854
746 Ga0070707_100291674
747 Ga0070707_101081909
748 Ga0070698_101887279
749 Ga0070699_100029893
750 Ga0070699_100732803
751 Ga0070699_101438865
752 Ga0070679_100032076
753 Ga0070679_100808449
754 Ga0070679_100819995
755 Ga0068853_100434148
756 Ga0068853_100765974
757 Ga0068853_101486141
758 Ga0070672_100014202
759 Ga0070672_100241340
760 Ga0070686_101585218
761 Ga0070695_100169161
762 Ga0070695_100643904
763 Ga0070696_100296932
764 Ga0070693_100124956
765 Ga0070665_100015116
766 Ga0070665_100039108
767 Ga0070665_100040315
768 Ga0070665_100275766
769 Ga0070665_100792590
770 Ga0070665_101513776
771 Ga0070665_101573026
772 Ga0070704_100040716
773 Ga0070704_100222732
774 Ga0068855_100254763
775 Ga0068855_100540726
776 Ga0068855_102505832
777 Ga0070664_100040984
778 Ga0068854_100052824
779 Ga0068854_100080198
780 Ga0068854_100136990
781 Ga0068856_100199121
782 Ga0070702_100479422
783 Ga0068852_100477501
784 Ga0068859_100009935
785 Ga0068859_100112478
786 Ga0068859_100179501
787 Ga0068859_100661523
788 Ga0068864_100018082
789 Ga0068864_100084274
790 Ga0068861_100081493
791 Ga0068861_100089962
792 Ga0068861_100166290
793 Ga0068861_100370937
794 Ga0068851_10069941
795 Ga0068851_10287614
796 Ga0068870_10386987
797 Ga0068863_100042774
798 Ga0068863_100063715
799 Ga0068863_100537283
800 Ga0068863_100641902
801 Ga0068858_100001405
802 Ga0068858_100066618
803 Ga0068858_100098885
804 Ga0068858_100614211
805 Ga0068860_100193650
806 Ga0068860_100222464
807 Ga0068860_100405805
808 Ga0068860_100839712
809 Ga0068860_101526656
810 Ga0068862_100059209
811 Ga0081538_10008982
812 Ga0070717_10428636
813 Ga0070717_10450964
814 Ga0070715_10649950
815 Ga0070716_100277021
816 Ga0070716_101440392
817 Ga0070712_100057634
818 Ga0070712_100187696
819 Ga0070712_100216073
820 Ga0070712_100487773
821 Ga0070712_101498772
822 Ga0097621_100122815
823 Ga0097621_100733565
824 Ga0068871_100110392
825 Ga0068871_100117993
826 Ga0068871_100151757
827 Ga0068871_100316773
828 Ga0075428_100008720
829 Ga0075428_100093108
830 Ga0075428_101184426
831 Ga0075430_100539449
832 Ga0075431_100705185
833 Ga0075433_10068656
834 Ga0075433_10225145
835 Ga0075433_10262857
836 Ga0075434_100000744
837 Ga0075434_100166897
838 Ga0075434_100334109
839 Ga0075434_100352794
840 Ga0075429_100325105
841 Ga0075429_100548435
842 Ga0075429_100869179
843 Ga0068865_100054547
844 Ga0068865_100058065
845 Ga0075436_100002464
846 Ga0075436_100007793
847 Ga0075436_100232278
848 Ga0075436_100239158
849 Ga0075436_100488597
850 Ga0075436_100680117
851 Ga0097620_100009935
852 Ga0097620_100112483
853 Ga0097620_100179499
854 Ga0097620_100661584
855 Ga0075435_100000431
856 Ga0075435_101051670
857 Ga0099795_10381207
858 Ga0105251_10405448
859 Ga0105240_10026251
860 Ga0105240_10045482
861 Ga0105240_10060972
862 Ga0105240_10064011
863 Ga0105240_10102031
864 Ga0105240_10105507
865 Ga0105240_10136719
866 Ga0105240_10197925
867 Ga0105240_10560609
868 Ga0105240_10727859
869 Ga0111539_10120674
870 Ga0111539_10127899
871 Ga0111539_11037600
872 Ga0105245_10470286
873 Ga0105247_10061933
874 Ga0105247_10071727
875 Ga0105247_10361665
876 Ga0114129_10007878
877 Ga0114129_10025007
878 Ga0114129_10033701
879 Ga0114129_10099732
880 Ga0114129_10212585
881 Ga0105243_10393433
882 Ga0105243_10761067
883 Ga0105241_10280405
884 Ga0105241_10698597
885 Ga0105241_10841808
886 Ga0105241_11412639
887 Ga0105242_10249910
888 Ga0105248_10227467
889 Ga0105248_10262955
890 Ga0105248_10351173
891 Ga0105237_10258360
892 Ga0105237_10348530
893 Ga0105237_10515342
894 Ga0105238_10193154
895 Ga0105249_10654019
896 Ga0105239_10351505
897 Ga0105246_10011856
898 Ga0105246_10348653
899 Ga0105246_11508314
900 Ga0157373_10131399
901 Ga0157373_10515492
902 Ga0157370_10187656
903 Ga0157369_10032326
904 Ga0157369_10394915
905 Ga0157369_10715344
906 Ga0157369_10728378
907 Ga0157369_10965625
908 Ga0157369_11102128
909 Ga0157369_12518417
910 Ga0157374_10000012
911 Ga0157374_10008262
912 Ga0157374_10101058
913 Ga0157378_10045451
914 Ga0157378_10075246
915 Ga0157378_10370536
916 Ga0163162_10039775
917 Ga0157372_10042968
918 Ga0157372_10170903
919 Ga0157372_10221865
920 Ga0157372_10619390
921 Ga0157375_10027800
922 Ga0157375_10125011
923 Ga0157375_10178203
924 Ga0157375_12148333
925 Ga0163163_10194094
926 Ga0163163_11108886
927 Ga0163163_12076414
928 Ga0157380_10003291
929 Ga0157380_10380409
930 Ga0157380_10473235
931 Ga0157377_10000002
932 Ga0157377_10037084
933 Ga0157379_10045284
934 Ga0157379_10165911
935 Ga0157379_10237593
936 Ga0157379_10534938
937 Ga0157376_10004945
938 Ga0157376_10282425
939 Ga0157376_10330733
940 Ga0157376_10534881
941 Ga0163161_10109075
942 Ga0206356_11700659
943 Ga0154015_1668427
944 Ga0207697_10198669
945 Ga0207656_10224591
946 Ga0207653_10100187
947 Ga0207710_10042921
948 Ga0207680_10077430
949 Ga0207647_10012485
950 Ga0207647_10029739
951 Ga0207685_10209262
952 Ga0207699_10000211
953 Ga0207699_10389236
954 Ga0207699_10837128
955 Ga0207645_10023188
956 Ga0207645_10603606
957 Ga0207643_10147042
958 Ga0207684_10033929
959 Ga0207684_10422153
960 Ga0207684_10440598
961 Ga0207654_10647805
962 Ga0207654_10716541
963 Ga0207707_10183980
964 Ga0207707_10618513
965 Ga0207707_10849887
966 Ga0207695_10004762
967 Ga0207695_10013190
968 Ga0207695_10171806
969 Ga0207695_10292793
970 Ga0207695_10300996
971 Ga0207695_11154471
972 Ga0207695_11175183
973 Ga0207671_10155543
974 Ga0207671_11483705
975 Ga0207693_10275503
976 Ga0207663_10000026
977 Ga0207663_10185054
978 Ga0207660_10033655
979 Ga0207660_10175225
980 Ga0207662_10303789
981 Ga0207657_10725535
982 Ga0207652_10013216
983 Ga0207652_10509954
984 Ga0207646_10147315
985 Ga0207646_10248548
986 Ga0207681_10041686
987 Ga0207681_10107477
988 Ga0207694_10041708
989 Ga0207694_10396121
990 Ga0207650_10721931
991 Ga0207650_11807293
992 Ga0207659_10369415
993 Ga0207687_10303974
994 Ga0207687_10345468
995 Ga0207700_10010649
996 Ga0207700_10072072
997 Ga0207700_10155491
998 Ga0207700_10252992
999 Ga0207700_10281862
1000 Ga0207700_11393785
1001 Ga0207664_10072541
1002 Ga0207664_10093662
1003 Ga0207664_10478985
1004 Ga0207644_10122462
1005 Ga0207690_11818500
1006 Ga0207706_10015660
1007 Ga0207706_10026970
1008 Ga0207706_10099176
1009 Ga0207686_10207706
1010 Ga0207670_10200755
1011 Ga0207670_10547877
1012 Ga0207670_11652365
1013 Ga0207669_10184530
1014 Ga0207704_10015609
1015 Ga0207704_10043693
1016 Ga0207665_10027600
1017 Ga0207665_10033120
1018 Ga0207665_10257559
1019 Ga0207665_10363618
1020 Ga0207691_10021009
1021 Ga0207691_10394681
1022 Ga0207711_10081570
1023 Ga0207711_10238087
1024 Ga0207711_10345333
1025 Ga0207689_10000308
1026 Ga0207689_10130099
1027 Ga0207689_10456336
1028 Ga0207689_10571830
1029 Ga0207661_10152928
1030 Ga0207661_11180320
1031 Ga0207661_11506382
1032 Ga0207679_10120291
1033 Ga0207679_10431106
1034 Ga0207667_10030353
1035 Ga0207667_10259613
1036 Ga0207667_10346702
1037 Ga0207667_10750867
1038 Ga0207651_10013432
1039 Ga0207651_10225860
1040 Ga0207668_10085732
1041 Ga0207640_10039857
1042 Ga0207640_10101791
1043 Ga0207658_10093908
1044 Ga0207658_10681497
1045 Ga0207677_10101266
1046 Ga0207677_10123900
1047 Ga0207703_10006087
1048 Ga0207703_10048250
1049 Ga0207703_10794365
1050 Ga0207639_10000198
1051 Ga0207639_10279489
1052 Ga0207678_10314968
1053 Ga0207708_10090653
1054 Ga0207702_10186310
1055 Ga0207702_11705649
1056 Ga0207641_10097525
1057 Ga0207641_10107912
1058 Ga0207676_10068233
1059 Ga0207676_10167398
1060 Ga0207676_10170094
1061 Ga0207676_10845891
1062 Ga0207674_10025813
1063 Ga0207675_100014971
1064 Ga0207675_100042947
1065 Ga0207675_100374076
1066 Ga0207675_100501553
1067 Ga0207683_10060072
1068 Ga0207698_10255236
1069 Ga0207428_10138588
1070 Ga0207428_10315247
1071 Ga0265356_1008887
1072 Ga0268266_10035593
1073 Ga0268266_10444988
1074 Ga0268266_10488170
1075 Ga0268266_10667359
1076 Ga0268266_10843147
1077 Ga0268266_11232852
1078 Ga0268265_10113151
1079 Ga0268265_10863871
1080 Ga0268265_11186773
1081 Ga0268264_10210802
1082 Ga0268264_10223276
1083 Ga0268264_10820555
1084 Ga0268264_10947168
1085 Ga0265338_10006484
1086 Ga0265338_10089618
1087 Ga0265760_10113914
1088 Ga0265330_10112514
1089 Ga0265325_10047989
1090 Ga0265325_10188485
1091 Ga0265340_10040969
1092 Ga0265339_10099346
1093 Ga0265316_10059409
1094 Ga0265316_10080713
1095 Ga0265316_10247826
1096 Ga0307408_100202123
1097 Ga0265313_10105974
1098 Ga0265314_10020092
1099 Ga0265314_10134700
1100 Ga0265314_10219832
1101 Ga0265314_10412493
1102 Ga0265342_10337516
1103 Ga0265342_10383575
1104 Ga0307405_10000794
1105 Ga0307413_10084306
1106 Ga0307413_10142999
1107 Ga0307410_10002116
1108 Ga0307406_10010890
1109 Ga0307407_10000504
1110 Ga0307407_10510195
1111 Ga0307412_10175023
1112 Ga0307412_10331464
1113 Ga0307416_100001240
1114 Ga0307416_100129070
1115 Ga0307416_100197712
1116 Ga0307411_10021573
1117 Ga0307415_100003916
1118 Ga0373930_0063950
1119 Ga0373948_0003131
1120 Ga0373950_0003702
1121 Ga0373958_0002058
1122 Ga0373959_0013334
1123 Ga0373938_0016504
1124 Ga0373928_0001597
1125 Ga0373929_0002095
1126 Ga0373929_0182090
1127 Ga0373934_0015403
1128 Ga0373940_0023768
1129 Ga0373944_0185520
1130 Ga0373949_0001119
1131 Ga0373951_0003335
1132 Ga0373952_0000824
1133 Ga0373923_0072403
1134 Ga0373932_0028199
1135 Ga0373939_0207860
1136 Ga0373941_0133142
1137 Ga0373953_0250776
1138 Ga0373954_0113812
1139 Ga0373956_0019511
1140 Ga0373957_0408871
1141 Ga0373960_0015485
1142 Ga0373943_0016974
1143 Ga0373955_0017707
1144 Ga0373942_0001341
1145 Ga0373961_0001024
1146 Ga0373924_0118171
1147 Ga0373924_0180050
1148 Ga0373924_0443110
1149 Ga0373931_0000743
1150 Ga0373935_0169702
1151 Ga0373935_0385657
1152 Ga0373927_0213098
1153 Ga0373933_0000227
1154 Ga0373937_0000065
1155 Ga0373937_0000240
1156 Ga0373937_0073624
1157 Ga0373937_0080566
1158 Ga0373937_0494486
1159 Ga0373937_0533271
1160 Ga0373937_0618579
1161 Ga0316582_0214856
1162 Ga0373925_0823969
1163 Ga0395898_0288429
1164 Ga0436363_1580473
1165 Ga0451839_1409582
1166 Ga0439442_061777
1167 Ga0439446_0025782
1168 Ga0439434_0204629
1169 Ga0451577_0009200
1170 Ga0451577_0202180
1171 Ga0451577_0314276
1172 Ga0453683_0054565
1173 Ga0453683_0058054
1174 Ga0466966_0061664
1175 Ga0466961_0508882
1176 Ga0466964_0115555
1177 Ga0466964_0214641
1178 Ga0453684_2093754
1179 Ga0453684_2109735
1180 Ga0466968_0626345
1181 Ga0466959_0175345
1182 Ga0451576_0084276
1183 Ga0451576_0975231
1184 Ga0451576_2575743
1185 Ga0466958_0130164
1186 Ga0466958_0176987
1187 Ga0466967_0530756
1188 Ga0495592_0206755
1189 Ga0495592_0434296
1190 Ga0495629_0036066
1191 Ga0495651_0029623
1192 Ga0495651_0030099
1193 Ga0495651_0453127
1194 Ga0495653_0140511
1195 Ga0495580_0038917
1196 Ga0495580_0046887
1197 Ga0495582_0276532
1198 Ga0495639_0651158
1199 Ga0495662_0356904
1200 Ga0495664_0037436
1201 Ga0495608_0043841
1202 Ga0495608_0422703
1203 Ga0495628_0015190
1204 Ga0495628_0322861
1205 Ga0495630_0160549
1206 Ga0495652_0046377
1207 Ga0495652_0115882
1208 Ga0495652_0371922
1209 Ga0495665_0696559
1210 Ga0495640_0370970
1211 Ga0495586_0203285
1212 Ga0495587_0000047
1213 Ga0495587_0355398
1214 Ga0495587_0371368
1215 Ga0495645_0014141
1216 Ga0495645_0111346
1217 Ga0495634_0416594
1218 Ga0495635_0080516
1219 Ga0495657_0595393
1220 Ga0495599_0003513
1221 Ga0495623_0022593
1222 Ga0495623_0163577
1223 Ga0495658_0027155
1224 Ga0495658_0137148
1225 Ga0495669_0042534
1226 Ga0495613_0351803
1227 Ga0495613_0964444
1228 Ga0495670_0395579
1229 Ga0495670_0817555
1230 Ga0495600_0039789
1231 Ga0495604_0047521
1232 Ga0495604_0420857
1233 Ga0495674_0070288
1234 Ga0495674_0091739
1235 Ga0495680_0114890
1236 Ga0495675_0000391
1237 Ga0495675_0059015
1238 Ga0495684_0142366
1239 Ga0495593_0199871
1240 Ga0495602_0001895
1241 Ga0495602_0209395
1242 Ga0495602_0331722
1243 Ga0495602_0719413
1244 Ga0496101_0367794
1245 Ga0496104_0065670
1246 Ga0496104_0266422
1247 Ga0496104_1253964
1248 Ga0496105_0531118
1249 Ga0496106_0016838
1250 Ga0496106_0300907
1251 Ga0496107_0264056
1252 Ga0496108_0996419
1253 Ga0496108_1657714
1254 Ga0496110_0407916
1255 Ga0496112_0004345
1256 Ga0496112_0232211
1257 Ga0496112_0873352
1258 Ga0496112_1337575
1259 Ga0496112_1403785
1260 Ga0496115_0041230
1261 Ga0496115_0071681
1262 Ga0496115_0136703
1263 Ga0496115_0621606
1264 Ga0496126_0199619
1265 Ga0501032_0436042
1266 Ga0501036_0016911
1267 Ga0501040_0064014
1268 Ga0501040_0408370
1269 Ga0501040_0429508
1270 Ga0501041_0033974
1271 Ga0501041_0054973
1272 Ga0501042_0071069
1273 Ga0501042_0166795
1274 Ga0501042_0643113
1275 Ga0501048_0312622
1276 Ga0501068_0068753
1277 Ga0501071_0012722
1278 Ga0501071_0057513
1279 Ga0501071_0886093
1280 Ga0501072_0321878
1281 Ga0501072_0347345
1282 Ga0501074_0335527
1283 Ga0501075_0024322
1284 Ga0501075_0158518
1285 Ga0501075_1065592
1286 Ga0501076_0179627
1287 Ga0501077_0363713
1288 Ga0501079_0219657
1289 Ga0501079_0759652
1290 Ga0501080_0095955
1291 Ga0501035_0512056
1292 Ga0501045_0212938
1293 nmdc:mga05p37_229180_c1
1294 nmdc:mga05p37_2316_c1
1295 nmdc:mga05p37_360663_c1
1296 nmdc:mga05p37_361406_c1
1297 nmdc:mga0qj67_508010_c1
1298 nmdc:mga06r32_482815_c1
1299 nmdc:mga06r32_63742_c1
1300 nmdc:mga08y16_457620_c1
1301 nmdc:mga08y16_51952_c1
1302 nmdc:mga0n895_1034890_c1
1303 nmdc:mga0n895_1145_c1
1304 nmdc:mga0n895_408692_c1
1305 nmdc:mga0n895_734712_c1
1306 nmdc:mga0rr50_1436_c1
1307 nmdc:mga0rr50_384292_c1
1308 nmdc:mga08x19_151664_c1
1309 nmdc:mga08x19_275315_c1
1310 nmdc:mga08x19_429260_c1
1311 nmdc:mga08x19_8672_c1
1312 nmdc:mga08x19_959047_c1
1313 nmdc:mga0a205_1107230_c1
1314 nmdc:mga0a205_231053_c1
1315 nmdc:mga0a205_279090_c1
1316 nmdc:mga0a205_365803_c1
1317 nmdc:mga0a205_396134_c1
1318 nmdc:mga0a205_79381_c1
1319 nmdc:mga0a205_820083_c1
1320 Ga0495619_1029870
1321 Ga0501084_0145856
1322 Ga0501082_0238671
1323 Ga0501082_1171239
1324 Ga0530510_0099297

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01980

TrmO

tRNA-methyltransferase O

45

156

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
2nv4-assembly1.cif.gz_B crystal structure of upf0066 protein af0241 in complex with s-adenosylmethionine. northeast structural genomics consortium target gr27 0.8782 2 132
3okx-assembly1.cif.gz_A crystal structure of yaeb-like protein from rhodopseudomonas palustris 0.8633 2 132
3okx-assembly1.cif.gz_B crystal structure of yaeb-like protein from rhodopseudomonas palustris 0.8603 2 127
2nv4-assembly1.cif.gz_B crystal structure of upf0066 protein af0241 in complex with s-adenosylmethionine. northeast structural genomics consortium target gr27 0.8594 2 132
7bu1-assembly1.cif.gz_A crystal structure of trmo from pseudomonas aeruginosa 0.823 1 134
ID Description Score Start End Superfamily
af_Q6NMB4_59_230_2.40.30.70 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3;YaeB-like 0.9166 1 128 2.40.30.70
af_P28634_1_140_2.40.30.70 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3;YaeB-like 0.9066 1 128 2.40.30.70
af_A1Z759_99_248_2.40.30.70 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3;YaeB-like 0.8968 3 133 2.40.30.70
af_Q54CD3_97_243_2.40.30.70 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3;YaeB-like 0.8873 6 133 2.40.30.70
2nv4B00 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3;YaeB-like 0.8701 3 132 2.40.30.70
ID Description Score Start End GO Terms
AF-A0A2V9IQY1-F1-model_v4 tRNA (N6-threonylcarbamoyladenosine(37)-N6)-methyltransferase TrmO 0.9825 1 120 GO:0008168
GO:0032259
AF-A0A2V9IQY1-F1-model_v4 tRNA (N6-threonylcarbamoyladenosine(37)-N6)-methyltransferase TrmO 0.9587 1 120 GO:0008168
GO:0032259
AF-X0T1Q8-F1-model_v4 TsaA-like domain-containing protein 0.9403 5 127
AF-A0A839JFT4-F1-model_v4 SAM-dependent methyltransferase 0.9332 1 127 GO:0008168
GO:0032259
AF-A0A6G4HMT6-F1-model_v4 tRNA (N6-threonylcarbamoyladenosine(37)-N6)-methyltransferase TrmO 0.9326 1 129 GO:0008168
GO:0032259

Map