metagRoot

F473236

General Info

Members	Datasets	Scaffolds	Average Seq Length
659	278	515	186

Family's Representative Sequence

Representative Sequence	3300009092\|Ga0105250_10000003\|Ga0105250_1000000348
Length	193
Sequence	MMKWIPVVLALFLAACSSDGKKTYYQLPTVNSSAPVAVVSAGGGLTPAAQKPKLWISQVSVADFLGTSGLVYQTNDVQYVMAANNLWASPLDQQLQQTLQTYLGRNLPGWVVSGQQASDGNQEQLSVNVTGFHGRYDGKAVISGTWTLTRDGQVSQHNFNIELKQNQDGYDALVRTLATGWEQEANSIALQIR

Samples

	Sample ID	Description	Type	Environment
1	2162886007	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1	Metagenome	Rhizosphere
2	2506520007	Serratia plymuthica AS9	Isolate	Rhizosphere
3	2506520008	Serratia plymuthica AS12	Isolate	Unclassified
4	2508501071	Serratia proteamaculans S4	Isolate	Rhizosphere
5	2511231025	Pantoea sp. YR343	Isolate	Rhizosphere
6	2511231035	Pantoea sp. GM01	Isolate	Rhizosphere
7	2547132181	Kosakonia sacchari SP1	Isolate	Stem
8	2547132416	Enterobacter sp. MR1	Isolate	Rhizoplane
9	2554235234	Klebsiella michiganensis SA2	Isolate	Unclassified
10	2561511199	Enterobacter sp. R4-368	Isolate	Nodule
11	2585427591	Rahnella aquatilis OV744	Isolate	Rhizosphere
12	2585427592	Rahnella aquatilis OV588	Isolate	Rhizosphere
13	2599185169	Klebsiella quasipneumoniae NFPP35	Isolate	Rhizoplane
14	2599185299	Pantoea ananatis NFR11	Isolate	Rhizoplane
15	2600255254	Klebsiella quasipneumoniae NFIX15	Isolate	Rhizoplane
16	2600255255	Klebsiella quasipneumoniae NFIX23	Isolate	Rhizoplane
17	2600255256	Enterobacter sp. NFIX08	Isolate	Rhizoplane
18	2600255257	Enterobacter sp. NFIX03	Isolate	Rhizoplane
19	2600255280	Klebsiella quasipneumoniae NFIX42	Isolate	Rhizoplane
20	2600255281	Klebsiella quasipneumoniae NFIX43	Isolate	Rhizoplane
21	2600255287	Klebsiella quasipneumoniae NFIX11	Isolate	Rhizoplane
22	2600255288	Klebsiella quasipneumoniae NFIX14	Isolate	Rhizoplane
23	2600255289	Klebsiella quasipneumoniae NFIX16	Isolate	Rhizoplane
24	2600255290	Klebsiella quasipneumoniae NFIX17	Isolate	Rhizoplane
25	2600255291	Klebsiella quasipneumoniae NFIX19	Isolate	Rhizoplane
26	2600255298	Klebsiella quasipneumoniae NFIX21	Isolate	Rhizoplane
27	2600255299	Klebsiella quasipneumoniae NFIX22	Isolate	Rhizoplane
28	2600255300	Klebsiella quasipneumoniae NFIX30	Isolate	Rhizoplane
29	2600255301	Klebsiella quasipneumoniae NFIX33	Isolate	Rhizoplane
30	2600255302	Klebsiella quasipneumoniae NFIX35	Isolate	Rhizoplane
31	2600255303	Klebsiella quasipneumoniae NFIX36	Isolate	Rhizoplane
32	2600255304	Klebsiella quasipneumoniae NFIX37	Isolate	Rhizoplane
33	2600255305	Klebsiella quasipneumoniae NFIX41	Isolate	Rhizoplane
34	2600255306	Klebsiella quasipneumoniae NFIX44	Isolate	Rhizoplane
35	2600255307	Klebsiella quasipneumoniae NFIX56	Isolate	Rhizoplane
36	2600255309	Klebsiella sp. NFIX53	Isolate	Rhizoplane
37	2600255310	Enterobacter sp. NFIX06	Isolate	Rhizoplane
38	2600255311	Enterobacter sp. NFIX04	Isolate	Rhizoplane
39	2600255392	Klebsiella quasipneumoniae NFIX54	Isolate	Rhizoplane
40	2602042046	Enterobacter sp. NFIX09	Isolate	Rhizoplane
41	2602042047	Enterobacter sp. NFIX59	Isolate	Rhizoplane
42	2602042052	Klebsiella quasipneumoniae NFIX18	Isolate	Rhizoplane
43	2602042053	Klebsiella quasipneumoniae NFIX12	Isolate	Rhizoplane
44	2602042066	Enterobacter sp. NFIX45	Isolate	Rhizoplane
45	2602042067	Enterobacter sp. NFIX58	Isolate	Rhizoplane
46	2602042103	Klebsiella quasipneumoniae NFIX29	Isolate	Rhizoplane
47	2602042104	Klebsiella quasipneumoniae NFIX26	Isolate	Rhizoplane
48	2602042105	Klebsiella quasipneumoniae NFIX25	Isolate	Rhizoplane
49	2602042106	Klebsiella quasipneumoniae NFIX13	Isolate	Rhizoplane
50	2602042109	Klebsiella aerogenes NFIX39	Isolate	Rhizoplane
51	2602042110	Klebsiella quasipneumoniae NFIX40	Isolate	Rhizoplane
52	2602042111	Klebsiella quasipneumoniae NFIX20	Isolate	Rhizoplane
53	2603880178	Klebsiella quasipneumoniae NFIX34	Isolate	Rhizoplane
54	2603880184	Klebsiella quasipneumoniae NFIX27	Isolate	Rhizoplane
55	2603880202	Klebsiella quasipneumoniae NFIX38	Isolate	Rhizoplane
56	2603880211	Klebsiella quasipneumoniae NFIX24	Isolate	Rhizoplane
57	2608642108	Pantoea agglomerans NFPP29	Isolate	Rhizoplane
58	2609459761	Enterobacter sp. NFR05	Isolate	Rhizoplane
59	2636415599	Klebsiella variicola DX120E	Isolate	Unclassified
60	2648501693	Pantoea ananatis B1-9	Isolate	Rhizosphere
61	2654587920	Serratia plymuthica HRO-C48	Isolate	Rhizosphere
62	2667528172	Enterobacteriaceae bacterium NFIX31	Isolate	Rhizoplane
63	2667528173	Rahnella sp. NFIX50	Isolate	Rhizoplane
64	2671180115	Cedecea sp. NFIX57	Isolate	Rhizoplane
65	2675903046	Klebsiella quasipneumoniae NFIX52	Isolate	Rhizoplane
66	2681812866	Enterobacter asburiae NFIX55	Isolate	Rhizoplane
67	2681812869	Enterobacter ludwigii NFPP41	Isolate	Rhizoplane
68	2684622997	Pantoea ananatis NFIX48	Isolate	Rhizoplane
69	2687453601	Serratia plymuthica 3Rp8	Isolate	Unclassified
70	2711768156	Atlantibacter hermannii DDE1	Isolate	Unclassified
71	2751185917	Enterobacter sp. HK169	Isolate	Unclassified
72	2765235842	Enterobacter ludwigii AA4	Isolate	Unclassified
73	2772190666	Serratia surfactantfaciens YD25	Isolate	Unclassified
74	2775506706	Enterobacter asburiae 1216	Isolate	Unclassified
75	2775507074	Klebsiella sp. D5A	Isolate	Unclassified
76	2791355010	Kosakonia pseudosacchari NN143	Isolate	Unclassified
77	2806310673	Serratia quinivorans NCTC 13189	Isolate	Rhizosphere
78	2808606414	Pantoea sp. SJZ147	Isolate	Rhizosphere
79	2811995292	Kosakonia oryzae Ola 51	Isolate	Unclassified
80	2814123068	Kosakonia radicincitans GXGL-4A	Isolate	Rhizosphere
81	2821118458	Enterobacter asburiae 609	Isolate	Unclassified
82	2823373977	Enterobacter ludwigii NCR3	Isolate	Rhizosphere
83	2844425489	Enterobacter cloacae SBP-8	Isolate	Rhizosphere
84	2844528606	Pantoea sp. R-72498 v. 2	Isolate	Unclassified
85	2847797336	Pantoea ananatis NN08200	Isolate	Unclassified
86	2852103415	Edaphovirga cremea DSM 105170	Isolate	Rhizosphere
87	2865014394	Pantoea sp. R-71966	Isolate	Unclassified
88	2869551831	Serratia inhibens PRI-2C	Isolate	Rhizosphere
89	2876601092	Pantoea endophytica 596	Isolate	Unclassified
90	2881609920	Pantoea sp. ARC607	Isolate	Rhizosphere
91	2884086401	Kluyvera sp. PO2S7	Isolate	Rhizosphere
92	2888366609	Serratia sp. NGAS9	Isolate	Rhizosphere
93	2888373701	Serratia rhizosphaerae KUDC3025	Isolate	Rhizosphere
94	2891670763	Buttiauxella sp. B2	Isolate	Rhizosphere
95	2904474040	Rahnella aquatilis 4485	Isolate	Rhizosphere
96	2904504865	Serratia marcescens 1822	Isolate	Unclassified
97	2904513164	Klebsiella variicola 1431	Isolate	Rhizosphere
98	2908669403	Pantoea coffeiphila 1480	Isolate	Rhizosphere
99	2919108558	Klebsiella sp. 1400	Isolate	Rhizosphere
100	2919150387	Rahnella aceris 1817	Isolate	Unclassified
101	2923634449	Enterobacter kobei SLBN-76	Isolate	Rhizosphere
102	2927143783	Rahnella sp. 2050	Isolate	Unclassified
103	2927833300	Enterobacter sp. SLBN-59	Isolate	Rhizosphere
104	2932406140	Serratia sp. 2723	Isolate	Rhizosphere
105	2935625433	Kosakonia sp. 1610	Isolate	Rhizosphere
106	2937539931	Pantoea sp. LS15	Isolate	Unclassified
107	2937967321	Serratia sp. YC16	Isolate	Unclassified
108	2939568625	Lelliottia sp. 489	Isolate	Rhizosphere
109	2939573065	Citrobacter sp. 506	Isolate	Rhizosphere
110	2939577877	Serratia sp. 509	Isolate	Rhizosphere
111	2939602548	Pantoea dispersa 1175	Isolate	Rhizosphere
112	2939607340	Leclercia sp. 1548	Isolate	Rhizosphere
113	2939617950	Kosakonia cowanii 2056	Isolate	Rhizosphere
114	2939642701	Lelliottia nimipressuralis 2756	Isolate	Rhizosphere
115	2945874760	Phytobacter diazotrophicus UAEU22	Isolate	Rhizosphere
116	2945951305	Pantoea agglomerans W2I1	Isolate	Rhizosphere
117	2969079654	Klebsiella variicola E57-7	Isolate	Unclassified
118	2971820967	Klebsiella sp. MPUS7	Isolate	Rhizosphere
119	2974310843	Enterobacter sp. SORGH_AS 287	Isolate	Unclassified
120	2974435778	Kosakonia cowanii SORGH_AS 304	Isolate	Unclassified
121	2978975091	Pantoea anthophila SORGH_AS 797	Isolate	Unclassified
122	2984494565	Pantoea ananatis SORGH_AS197	Isolate	Aerial Root
123	2984559226	Klebsiella variicola SORGH_AS834	Isolate	Aerial Root
124	2984595703	Klebsiella variicola SORGH_AS1070	Isolate	Aerial Root
125	2990261002	Pantoea ananatis SORGH_AS213	Isolate	Aerial Root
126	3000376612	Enterobacteriaceae bacterium 4M9	Isolate	Rhizosphere
127	3300001989	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5	Metagenome	Rhizosphere
128	3300002737	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA	Metagenome	Endosphere
129	3300002771	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB	Metagenome	Endosphere
130	3300002772	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS	Metagenome	Endosphere
131	3300002773	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS	Metagenome	Endosphere
132	3300003320	Sugarcane root Sample H2	Metagenome	Unclassified
133	3300003751	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2	Metagenome	Endosphere
134	3300003752	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2	Metagenome	Endosphere
135	3300003756	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2	Metagenome	Endosphere
136	3300003759	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2	Metagenome	Endosphere
137	3300003841	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2	Metagenome	Endosphere
138	3300003856	Agave microbial communities from Guanajuato, Mexico - At.Am.rz	Metagenome	Rhizosphere
139	3300005272	Switchgrass rhizosphere microbial communities from Buena Vista Grasslands Wildlife Area, Michigan, USA - BV2.1 v1	Metagenome	Rhizosphere
140	3300005289	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2)	Metagenome	Rhizosphere
141	3300005339	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG	Metagenome	Rhizosphere
142	3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Metagenome	Rhizosphere
143	3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Metagenome	Rhizosphere
144	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
145	3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Metagenome	Rhizosphere
146	3300005834	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2	Metagenome	Rhizosphere
147	3300006051	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4	Metagenome	Endosphere
148	3300006195	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1	Metagenome	Endosphere
149	3300006946	Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG	Metagenome	Nodule
150	3300009011	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG	Metagenome	Rhizosphere
151	3300009036	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG	Metagenome	Rhizosphere
152	3300009092	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG	Metagenome	Rhizosphere
153	3300009101	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG	Metagenome	Rhizosphere
154	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
155	3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Metagenome	Rhizosphere
156	3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Metagenome	Rhizosphere
157	3300013100	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG	Metagenome	Rhizosphere
158	3300013102	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG	Metagenome	Rhizosphere
159	3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Metagenome	Rhizosphere
160	3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Metagenome	Rhizosphere
161	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
162	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
163	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
164	3300014497	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG	Metagenome	Rhizosphere
165	3300015261	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG	Metagenome	Rhizosphere
166	3300015262	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG	Metagenome	Rhizosphere
167	3300015679	Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.4_F08	Metagenome	Unclassified
168	3300015680	Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.2_H03	Metagenome	Rhizosphere
169	3300015685	Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12	Metagenome	Unclassified
170	3300015687	Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08	Metagenome	Rhizosphere
171	3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Metagenome	Rhizosphere
172	3300021384	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9	Metagenome	Unclassified
173	3300025207	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2)	Metagenome	Endosphere
174	3300025224	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2)	Metagenome	Endosphere
175	3300025225	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2)	Metagenome	Endosphere
176	3300025226	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
177	3300025230	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2)	Metagenome	Endosphere
178	3300025231	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2)	Metagenome	Endosphere
179	3300025233	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2)	Metagenome	Endosphere
180	3300025245	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3)	Metagenome	Endosphere
181	3300025253	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
182	3300025258	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3)	Metagenome	Endosphere
183	3300025261	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2)	Metagenome	Endosphere
184	3300025711	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
185	3300025728	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
186	3300025735	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
187	3300025900	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
188	3300025911	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
189	3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
190	3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
191	3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
192	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
193	3300027111	Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2)	Metagenome	Nodule
194	3300027312	Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2)	Metagenome	Rhizosphere
195	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
196	3300030500	Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3)	Metagenome	Rhizosphere
197	3300039437	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2	Metagenome	Unclassified
198	3300041405	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414	Metagenome	Rhizosphere
199	3300041407	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416	Metagenome	Rhizosphere
200	3300041411	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708	Metagenome	Rhizosphere
201	3300041507	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG	Metagenome	Unclassified
202	3300042006	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437	Metagenome	Rhizosphere
203	3300042007	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290	Metagenome	Rhizosphere
204	3300042010	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431	Metagenome	Rhizosphere
205	3300042016	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357	Metagenome	Rhizosphere
206	3300042146	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979	Metagenome	Rhizosphere
207	3300042439	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363	Metagenome	Rhizosphere
208	3300044669	Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2E	Metagenome	Unclassified
209	3300046452	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere	Metagenome	Rhizosphere
210	3300046453	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere	Metagenome	Rhizosphere
211	3300046458	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere	Metagenome	Rhizosphere
212	3300046460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere	Metagenome	Rhizosphere
213	3300046461	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere	Metagenome	Rhizosphere
214	3300046471	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere	Metagenome	Rhizosphere
215	3300046474	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere	Metagenome	Rhizosphere
216	3300046492	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere	Metagenome	Rhizosphere
217	3300046501	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere	Metagenome	Rhizosphere
218	3300046507	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere	Metagenome	Rhizosphere
219	3300046513	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere	Metagenome	Rhizosphere
220	3300046515	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere	Metagenome	Rhizosphere
221	3300046520	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere	Metagenome	Rhizosphere
222	3300046522	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere	Metagenome	Rhizosphere
223	3300046523	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere	Metagenome	Rhizosphere
224	3300046524	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere	Metagenome	Rhizosphere
225	3300046530	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere	Metagenome	Rhizosphere
226	3300046542	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere	Metagenome	Rhizosphere
227	3300046616	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere	Metagenome	Rhizosphere
228	3300046648	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere	Metagenome	Rhizosphere
229	3300046660	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere	Metagenome	Rhizosphere
230	3300046674	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere	Metagenome	Rhizosphere
231	3300046692	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere	Metagenome	Rhizosphere
232	3300046694	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere	Metagenome	Rhizosphere
233	3300046794	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere	Metagenome	Rhizosphere
234	3300046810	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere	Metagenome	Rhizosphere
235	3300047320	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere	Metagenome	Rhizosphere
236	3300047323	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere	Metagenome	Rhizosphere
237	3300047446	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere	Metagenome	Rhizosphere
238	3300047469	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere	Metagenome	Rhizosphere
239	3300047470	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere	Metagenome	Rhizosphere
240	3300048903	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled	Metagenome	Rhizoplane
241	3300048904	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled	Metagenome	Rhizoplane
242	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
243	3300048906	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15	Metagenome	Rhizoplane
244	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
245	3300048908	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15	Metagenome	Rhizoplane
246	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
247	3300048916	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15	Metagenome	Rhizoplane
248	3300048919	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled	Metagenome	Unclassified
249	3300048920	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15	Metagenome	Unclassified
250	3300048921	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15	Metagenome	Unclassified
251	3300048922	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15	Metagenome	Unclassified
252	3300048923	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15	Metagenome	Unclassified
253	3300048924	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15	Metagenome	Unclassified
254	3300048925	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled	Metagenome	Unclassified
255	3300048926	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled	Metagenome	Unclassified
256	3300048927	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15	Metagenome	Unclassified
257	3300048928	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15	Metagenome	Unclassified
258	3300048929	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15	Metagenome	Unclassified
259	3300049459	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere	Metagenome	Rhizosphere
260	3300049460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere	Metagenome	Rhizosphere
261	3300050491	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation	Metagenome	Endosphere
262	3300050493	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation	Metagenome	Endosphere
263	3300053126	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere	Metagenome	Endosphere
264	640753048	Serratia proteamaculans 568	Isolate	Endosphere
265	8004592986	Serratia sp. S119	Isolate	Unclassified
266	8015394850	Serratia sp. PGPR-27	Isolate	Rhizosphere
267	8016733728	Pantoea sp. SORGH_AS 659	Isolate	Unclassified
268	8018221730	Enterobacter sp. CM29	Isolate	Unclassified
269	8018405270	Enterobacter sp. 198	Isolate	Rhizosphere
270	8019499862	Kluyvera sp. 1366	Isolate	Rhizosphere
271	8019504834	Atlantibacter hermannii 1903	Isolate	Rhizosphere
272	8054844752	Dryocola boscaweniae H18W14	Isolate	Rhizosphere
273	8054849141	Dryocola clanedunensis H11S18	Isolate	Rhizosphere
274	8055087960	Silvania hatchlandensis H19S6	Isolate	Rhizosphere
275	8055092621	Silvania confinis H4N4	Isolate	Rhizosphere
276	8055097453	Leclercia tamurae H6W5	Isolate	Rhizosphere
277	8055693939	Hafnia alvei A23BA	Isolate	Rhizosphere
278	8057304971	Scandinavium manionii H17S15	Isolate	Rhizosphere

Type Distribution

Type	Percentage (%)
Metagenomes	78.15
Metatranscriptomes	0
Isolates	21.85

Biome Distribution

Category	Percentage (%)
Aerial Root	0.61
Bulb	0
Endosphere	5.61
Nodule	3.95
Rhizoplane	10.62
Rhizosphere	52.81
Stem	0.15
Stem Tuber	0
Unclassified	26.25

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	SwRhRL2b_contig_1387449	2162886007	Bacteria	3100
2	SwRhRL2b_contig_1462375	2162886007	Bacteria	7393
3	SwRhRL2b_contig_244625	2162886007	Bacteria	2969
4	SwRhRL2b_contig_3876119	2162886007	Bacteria	2973
5	SwRhRL2b_contig_435514	2162886007	Bacteria	2052
6	JGI24739J22299_10004839	3300001989	Bacteria	5132
7	JGI25162J39368_1000035	3300002737	Bacteria	180993
8	JGI25162J39368_1004627	3300002737	Bacteria	3097
9	JGI25163J39215_1000010	3300002771	Bacteria	91462
10	JGI25164J39214_1000019	3300002772	Bacteria	180993
11	JGI25152J39213_1000040	3300002773	Bacteria	88322
12	rootH2_10033826	3300003320	Bacteria	17763
13	Ga0055538_1000039	3300003751	Bacteria	180993
14	Ga0055539_1000050	3300003752	Bacteria	180993
15	Ga0055533_1000062	3300003756	Bacteria	180993
16	Ga0055525_1000072	3300003759	Bacteria	180993
17	Ga0055541_1000038	3300003841	Bacteria	180993
18	Ga0058692_1000076	3300003856	Bacteria	75166
19	Ga0058692_1000189	3300003856	Bacteria	37488
20	Ga0058692_1000809	3300003856	Bacteria	12447
21	Ga0058692_1000959	3300003856	Bacteria	11357
22	Ga0058692_1001707	3300003856	Bacteria	7842
23	Ga0058692_1002605	3300003856	Bacteria	5954
24	Ga0058692_1010323	3300003856	Bacteria	2311
25	Ga0058692_1010332	3300003856	Bacteria	2310
26	Ga0058692_1015248	3300003856	Bacteria	1738
27	Ga0058692_1034521	3300003856	Bacteria	928
28	Ga0058692_1034550	3300003856	Bacteria	928
29	Ga0058692_1041679	3300003856	Bacteria	802
30	Ga0065703_1018756	3300005272	Bacteria	14133
31	Ga0065704_10000483	3300005289	Bacteria	67975
32	Ga0065704_10001725	3300005289	Bacteria	8687
33	Ga0065704_10002392	3300005289	Bacteria	6448
34	Ga0065704_10004405	3300005289	Bacteria	5256
35	Ga0065704_10072964	3300005289	Bacteria	7736
36	Ga0065704_10101890	3300005289	Bacteria	2223
37	Ga0070660_100173763	3300005339	Bacteria	1741
38	Ga0070668_100002085	3300005347	Bacteria	14617
39	Ga0070659_100014398	3300005366	Bacteria	5911
40	Ga0070665_100000345	3300005548	Bacteria	70001
41	Ga0070665_100055030	3300005548	Bacteria	3991
42	Ga0068857_100001550	3300005577	Bacteria	18402
43	Ga0068851_10145912	3300005834	Bacteria	1290
44	Ga0068851_10438608	3300005834	Bacteria	774
45	Ga0075364_10002520	3300006051	Bacteria	10257
46	Ga0075364_10055499	3300006051	Bacteria	2592
47	Ga0075364_10101011	3300006051	Bacteria	1920
48	Ga0075364_10176920	3300006051	Bacteria	1443
49	Ga0075366_10016727	3300006195	Bacteria	4217
50	Ga0079104_1000035	3300006946	Bacteria	198709
51	Ga0079104_1000114	3300006946	Bacteria	115700
52	Ga0079104_1000196	3300006946	Bacteria	84941
53	Ga0079104_1000794	3300006946	Bacteria	26776
54	Ga0079104_1001186	3300006946	Bacteria	18726
55	Ga0079104_1001217	3300006946	Bacteria	18222
56	Ga0079104_1001661	3300006946	Bacteria	14334
57	Ga0079104_1003903	3300006946	Bacteria	6663
58	Ga0079104_1004467	3300006946	Bacteria	5968
59	Ga0079104_1004588	3300006946	Bacteria	5832
60	Ga0079104_1004734	3300006946	Bacteria	5684
61	Ga0079104_1012426	3300006946	Bacteria	2675
62	Ga0079104_1027911	3300006946	Bacteria	1440
63	Ga0105251_10000351	3300009011	Bacteria	45565
64	Ga0105251_10000474	3300009011	Bacteria	38106
65	Ga0105251_10002584	3300009011	Bacteria	14046
66	Ga0105251_10004164	3300009011	Bacteria	10055
67	Ga0105251_10004500	3300009011	Bacteria	9455
68	Ga0105251_10004798	3300009011	Bacteria	9050
69	Ga0105251_10005884	3300009011	Bacteria	7930
70	Ga0105251_10009064	3300009011	Bacteria	5924
71	Ga0105251_10023719	3300009011	Bacteria	3162
72	Ga0105251_10031944	3300009011	Bacteria	2628
73	Ga0105251_10034009	3300009011	Bacteria	2526
74	Ga0105251_10037801	3300009011	Bacteria	2366
75	Ga0105251_10053954	3300009011	Bacteria	1910
76	Ga0105251_10063555	3300009011	Bacteria	1732
77	Ga0105251_10114409	3300009011	Bacteria	1227
78	Ga0105251_10216600	3300009011	Bacteria	862
79	Ga0105244_10000034	3300009036	Bacteria	168462
80	Ga0105244_10000085	3300009036	Bacteria	102531
81	Ga0105244_10000094	3300009036	Bacteria	94550
82	Ga0105244_10000231	3300009036	Bacteria	57614
83	Ga0105244_10000358	3300009036	Bacteria	42449
84	Ga0105244_10004281	3300009036	Bacteria	9886
85	Ga0105244_10007471	3300009036	Bacteria	6941
86	Ga0105244_10019646	3300009036	Bacteria	3766
87	Ga0105244_10044549	3300009036	Bacteria	2285
88	Ga0105244_10075448	3300009036	Bacteria	1675
89	Ga0105244_10075471	3300009036	Bacteria	1675
90	Ga0105244_10079497	3300009036	Bacteria	1625
91	Ga0105244_10090119	3300009036	Bacteria	1509
92	Ga0105244_10109288	3300009036	Bacteria	1347
93	Ga0105244_10337076	3300009036	Bacteria	696
94	Ga0105250_10000003	3300009092	Bacteria	547770
95	Ga0105250_10000168	3300009092	Bacteria	56841
96	Ga0105250_10000206	3300009092	Bacteria	49617
97	Ga0105250_10000698	3300009092	Bacteria	20842
98	Ga0105250_10001459	3300009092	Bacteria	12771
99	Ga0105250_10003403	3300009092	Bacteria	7541
100	Ga0105250_10004087	3300009092	Bacteria	6785
101	Ga0105250_10006097	3300009092	Bacteria	5306
102	Ga0105250_10007050	3300009092	Bacteria	4853
103	Ga0105250_10016320	3300009092	Bacteria	3028
104	Ga0105250_10073661	3300009092	Bacteria	1381
105	Ga0105250_10073833	3300009092	Bacteria	1379
106	Ga0105250_10082058	3300009092	Bacteria	1308
107	Ga0105247_10000215	3300009101	Bacteria	55886
108	Ga0105243_10282343	3300009148	Bacteria	1496
109	Ga0105241_10000004	3300009174	Bacteria	803007
110	Ga0105241_10000005	3300009174	Bacteria	384203
111	Ga0105246_10010335	3300011119	Bacteria	5771
112	Ga0105246_10017703	3300011119	Bacteria	4532
113	Ga0105246_10048853	3300011119	Bacteria	2894
114	Ga0157373_10000242	3300013100	Bacteria	44728
115	Ga0157373_10000657	3300013100	Bacteria	27182
116	Ga0157373_10023784	3300013100	Bacteria	4439
117	Ga0157373_10151113	3300013100	Bacteria	1633
118	Ga0157371_10000177	3300013102	Bacteria	92877
119	Ga0157371_10000288	3300013102	Bacteria	68107
120	Ga0157371_10001352	3300013102	Bacteria	25802
121	Ga0157371_10005654	3300013102	Bacteria	10497
122	Ga0157371_10007098	3300013102	Bacteria	9107
123	Ga0157371_10025291	3300013102	Bacteria	4328
124	Ga0157371_10037241	3300013102	Bacteria	3482
125	Ga0157370_10000416	3300013104	Bacteria	53865
126	Ga0157370_10001685	3300013104	Bacteria	27219
127	Ga0157370_10004546	3300013104	Bacteria	15887
128	Ga0157369_10018317	3300013105	Bacteria	7852
129	Ga0163162_10052016	3300013306	Bacteria	4112
130	Ga0163162_10063424	3300013306	Bacteria	3738
131	Ga0163162_10133202	3300013306	Bacteria	2595
132	Ga0157372_10007676	3300013307	Bacteria	11475
133	Ga0157372_10010990	3300013307	Bacteria	9635
134	Ga0157372_10122560	3300013307	Bacteria	2988
135	Ga0157372_10146045	3300013307	Bacteria	2727
136	Ga0157372_10237535	3300013307	Bacteria	2114
137	Ga0157372_10309950	3300013307	Bacteria	1837
138	Ga0157372_11585912	3300013307	Bacteria	754
139	Ga0157375_10611562	3300013308	Bacteria	1248
140	Ga0182008_10004895	3300014497	Bacteria	7722
141	Ga0182008_10032529	3300014497	Bacteria	2620
142	Ga0182008_10211242	3300014497	Bacteria	990
143	Ga0182006_1000022	3300015261	Bacteria	275350
144	Ga0182006_1001188	3300015261	Bacteria	16314
145	Ga0182006_1050656	3300015261	Bacteria	1599
146	Ga0182006_1054670	3300015261	Bacteria	1527
147	Ga0182007_10043706	3300015262	Bacteria	1488
148	Ga0183366_1001	3300015679	Bacteria	2743932
149	Ga0183370_1001	3300015680	Bacteria	2743932
150	Ga0183369_1001	3300015685	Bacteria	2743932
151	Ga0183368_1001	3300015687	Bacteria	2743932
152	Ga0163161_10000001	3300017792	Bacteria	2041488
153	Ga0163161_10007073	3300017792	Bacteria	7761
154	Ga0213876_10000016	3300021384	Bacteria	300175
155	Ga0209760_100002	3300025207	Bacteria	274743
156	Ga0209784_100001	3300025224	Bacteria	3600592
157	Ga0209566_100001	3300025225	Bacteria	3600765
158	Ga0209674_100002	3300025226	Bacteria	3600592
159	Ga0209563_100002	3300025230	Bacteria	2045675
160	Ga0207427_100012	3300025231	Bacteria	585657
161	Ga0209437_100001	3300025233	Bacteria	2045675
162	Ga0209437_100035	3300025233	Bacteria	481110
163	Ga0207425_1019142	3300025245	Bacteria	1478
164	Ga0209677_100002	3300025253	Bacteria	2045675
165	Ga0209129_1000018	3300025258	Bacteria	469298
166	Ga0209233_1032453	3300025261	Bacteria	1207
167	Ga0207696_1000001	3300025711	Bacteria	2579611
168	Ga0207696_1000004	3300025711	Bacteria	671626
169	Ga0207696_1000070	3300025711	Bacteria	227242
170	Ga0207696_1000077	3300025711	Bacteria	209611
171	Ga0207696_1000287	3300025711	Bacteria	59175
172	Ga0207696_1000521	3300025711	Bacteria	31832
173	Ga0207696_1000535	3300025711	Bacteria	30862
174	Ga0207696_1000669	3300025711	Bacteria	24147
175	Ga0207696_1000764	3300025711	Bacteria	21257
176	Ga0207696_1002648	3300025711	Bacteria	8628
177	Ga0207655_1000001	3300025728	Bacteria	1866413
178	Ga0207655_1000009	3300025728	Bacteria	664676
179	Ga0207655_1000046	3300025728	Bacteria	309474
180	Ga0207655_1000102	3300025728	Bacteria	185859
181	Ga0207655_1000194	3300025728	Bacteria	107189
182	Ga0207655_1000280	3300025728	Bacteria	78923
183	Ga0207655_1000454	3300025728	Bacteria	53716
184	Ga0207655_1001280	3300025728	Bacteria	23932
185	Ga0207655_1001903	3300025728	Bacteria	17914
186	Ga0207655_1013649	3300025728	Bacteria	4648
187	Ga0207655_1014233	3300025728	Bacteria	4509
188	Ga0207655_1014981	3300025728	Bacteria	4341
189	Ga0207655_1034340	3300025728	Bacteria	2282
190	Ga0207655_1043304	3300025728	Bacteria	1905
191	Ga0207655_1060869	3300025728	Bacteria	1461
192	Ga0207655_1110386	3300025728	Bacteria	930
193	Ga0207713_1000001	3300025735	Bacteria	2295391
194	Ga0207713_1000012	3300025735	Bacteria	501860
195	Ga0207713_1000040	3300025735	Bacteria	245322
196	Ga0207713_1000093	3300025735	Bacteria	146199
197	Ga0207713_1000303	3300025735	Bacteria	56199
198	Ga0207713_1000332	3300025735	Bacteria	53045
199	Ga0207713_1000346	3300025735	Bacteria	50868
200	Ga0207713_1004859	3300025735	Bacteria	8616
201	Ga0207713_1018287	3300025735	Bacteria	3475
202	Ga0207713_1029592	3300025735	Bacteria	2451
203	Ga0207713_1031089	3300025735	Bacteria	2366
204	Ga0207713_1031187	3300025735	Bacteria	2360
205	Ga0207713_1053336	3300025735	Bacteria	1593
206	Ga0207713_1065021	3300025735	Bacteria	1370
207	Ga0207713_1104500	3300025735	Bacteria	972
208	Ga0207710_10000074	3300025900	Bacteria	147390
209	Ga0207654_10000006	3300025911	Bacteria	815027
210	Ga0207654_10000007	3300025911	Bacteria	384211
211	Ga0207681_10582706	3300025923	Bacteria	923
212	Ga0207690_10012840	3300025932	Bacteria	5019
213	Ga0207668_10027644	3300025972	Bacteria	3697
214	Ga0207674_10003176	3300026116	Bacteria	20236
215	Ga0209281_1000001	3300027111	Bacteria	1933496
216	Ga0209281_1000027	3300027111	Bacteria	463409
217	Ga0209281_1000114	3300027111	Bacteria	210536
218	Ga0209281_1000180	3300027111	Bacteria	147099
219	Ga0209281_1000234	3300027111	Bacteria	115401
220	Ga0209281_1000358	3300027111	Bacteria	75325
221	Ga0209281_1000525	3300027111	Bacteria	49178
222	Ga0209281_1000535	3300027111	Bacteria	48029
223	Ga0209281_1000892	3300027111	Bacteria	25408
224	Ga0209281_1001835	3300027111	Bacteria	10477
225	Ga0209281_1002366	3300027111	Bacteria	7733
226	Ga0209281_1002915	3300027111	Bacteria	6183
227	Ga0209371_1000001	3300027312	Bacteria	2771503
228	Ga0209371_1000010	3300027312	Bacteria	922021
229	Ga0209371_1000085	3300027312	Bacteria	179586
230	Ga0209371_1000086	3300027312	Bacteria	175099
231	Ga0209371_1000269	3300027312	Bacteria	60878
232	Ga0209371_1000404	3300027312	Bacteria	45170
233	Ga0209371_1000413	3300027312	Bacteria	44119
234	Ga0209371_1000432	3300027312	Bacteria	42626
235	Ga0209371_1000454	3300027312	Bacteria	40492
236	Ga0209371_1001208	3300027312	Bacteria	18680
237	Ga0209371_1001802	3300027312	Bacteria	13385
238	Ga0209371_1002193	3300027312	Bacteria	11382
239	Ga0209371_1002371	3300027312	Bacteria	10652
240	Ga0209371_1002420	3300027312	Bacteria	10469
241	Ga0209371_1002719	3300027312	Bacteria	9536
242	Ga0209371_1003319	3300027312	Bacteria	7935
243	Ga0209371_1003748	3300027312	Bacteria	7106
244	Ga0209371_1005589	3300027312	Bacteria	4945
245	Ga0209371_1014856	3300027312	Bacteria	2117
246	Ga0268266_10002880	3300028379	Bacteria	17873
247	Ga0268266_10037595	3300028379	Bacteria	4123
248	Ga0268256_1000001	3300030500	Bacteria	2771065
249	Ga0268256_1000003	3300030500	Bacteria	1289401
250	Ga0268256_1000048	3300030500	Bacteria	312298
251	Ga0268256_1000092	3300030500	Bacteria	144061
252	Ga0268256_1000124	3300030500	Bacteria	111181
253	Ga0268256_1000371	3300030500	Bacteria	42627
254	Ga0268256_1000597	3300030500	Bacteria	28677
255	Ga0268256_1001186	3300030500	Bacteria	16699
256	Ga0268256_1001573	3300030500	Bacteria	13385
257	Ga0268256_1003001	3300030500	Bacteria	7971
258	Ga0268256_1003191	3300030500	Bacteria	7605
259	Ga0268256_1004965	3300030500	Bacteria	5363
260	Ga0268256_1005403	3300030500	Bacteria	5017
261	Ga0268256_1006184	3300030500	Bacteria	4503
262	Ga0268256_1008053	3300030500	Bacteria	3658
263	Ga0268256_1013924	3300030500	Bacteria	2412
264	Ga0268256_1014245	3300030500	Bacteria	2371
265	Ga0268256_1027517	3300030500	Bacteria	1415
266	Ga0268256_1031965	3300030500	Bacteria	1259
267	Ga0436365_1910565	3300039437	Bacteria	475219
268	Ga0439438_000001	3300041405	Bacteria	1263568
269	Ga0439438_005818	3300041405	Bacteria	4473
270	Ga0439438_010238	3300041405	Bacteria	2976
271	Ga0439438_033877	3300041405	Bacteria	1347
272	Ga0439447_002002	3300041407	Bacteria	7486
273	Ga0439447_010010	3300041407	Bacteria	2838
274	Ga0439447_014850	3300041407	Bacteria	2173
275	Ga0439466_0000003	3300041411	Bacteria	486229
276	Ga0451851_0931241	3300041507	Bacteria	518
277	Ga0439432_003243	3300042006	Bacteria	6051
278	Ga0439432_016683	3300042006	Bacteria	2470
279	Ga0439449_0056830	3300042007	Bacteria	1445
280	Ga0439452_000001	3300042010	Bacteria	1725439
281	Ga0439452_000003	3300042010	Bacteria	942815
282	Ga0439452_000008	3300042010	Bacteria	569877
283	Ga0439452_000061	3300042010	Bacteria	101240
284	Ga0439452_001514	3300042010	Bacteria	9388
285	Ga0439463_002199	3300042016	Bacteria	5025
286	Ga0450907_000795	3300042146	Bacteria	7847
287	Ga0439464_0003100	3300042439	Bacteria	4159
288	Ga0439464_0004715	3300042439	Bacteria	3494
289	Ga0439464_0038103	3300042439	Bacteria	1365
290	Ga0466981_0000005	3300044669	Bacteria	165643
291	Ga0495617_136261	3300046452	Bacteria	785
292	Ga0495627_000018	3300046453	Bacteria	315125
293	Ga0495627_039317	3300046453	Bacteria	1460
294	Ga0495591_000014	3300046458	Bacteria	254281
295	Ga0495591_000022	3300046458	Bacteria	199449
296	Ga0495591_000956	3300046458	Bacteria	19754
297	Ga0495591_009190	3300046458	Bacteria	3951
298	Ga0495591_084986	3300046458	Bacteria	801
299	Ga0495638_0016862	3300046460	Bacteria	4884
300	Ga0495641_0171067	3300046461	Bacteria	972
301	Ga0495650_0000018	3300046471	Bacteria	538888
302	Ga0495650_0000021	3300046471	Bacteria	531242
303	Ga0495650_0000032	3300046471	Bacteria	425389
304	Ga0495650_0125786	3300046471	Bacteria	939
305	Ga0495605_0040761	3300046474	Bacteria	2316
306	Ga0495585_0014673	3300046492	Bacteria	4558
307	Ga0495607_0028131	3300046501	Bacteria	3471
308	Ga0495606_0000483	3300046507	Bacteria	65224
309	Ga0495616_0022488	3300046513	Bacteria	3406
310	Ga0495620_0051478	3300046515	Bacteria	1752
311	Ga0495637_0030525	3300046520	Bacteria	2391
312	Ga0495643_0025546	3300046522	Bacteria	3341
313	Ga0495643_0077563	3300046522	Bacteria	1736
314	Ga0495643_0084378	3300046522	Bacteria	1648
315	Ga0495643_0114300	3300046522	Bacteria	1369
316	Ga0495644_0001036	3300046523	Bacteria	11569
317	Ga0495648_0003073	3300046524	Bacteria	14910
318	Ga0495648_0030680	3300046524	Bacteria	3550
319	Ga0495654_0000049	3300046530	Bacteria	147151
320	Ga0495654_0000052	3300046530	Bacteria	145382
321	Ga0495654_0000765	3300046530	Bacteria	24875
322	Ga0495654_0006559	3300046530	Bacteria	6594
323	Ga0495654_0020006	3300046530	Bacteria	3495
324	Ga0495654_0025354	3300046530	Bacteria	3055
325	Ga0495597_0000412	3300046542	Bacteria	36859
326	Ga0495668_0064565	3300046616	Bacteria	2015
327	Ga0495611_0246827	3300046648	Bacteria	828
328	Ga0495625_0050971	3300046660	Bacteria	2968
329	Ga0495588_0073243	3300046674	Bacteria	1783
330	Ga0495671_0001475	3300046692	Bacteria	15768
331	Ga0495671_0056612	3300046692	Bacteria	1941
332	Ga0495649_0001822	3300046694	Bacteria	15655
333	Ga0495649_0005938	3300046694	Bacteria	7655
334	Ga0495649_0012923	3300046694	Bacteria	4835
335	Ga0495589_0000002	3300046794	Bacteria	758846
336	Ga0495589_0000041	3300046794	Bacteria	140490
337	Ga0495589_0029835	3300046794	Bacteria	2749
338	Ga0495660_0000004	3300046810	Bacteria	1003183
339	Ga0495660_0000021	3300046810	Bacteria	293250
340	Ga0495660_0023974	3300046810	Bacteria	3477
341	Ga0495660_0491718	3300046810	Bacteria	525
342	Ga0495672_0000002	3300047320	Bacteria	740116
343	Ga0495672_0000012	3300047320	Bacteria	519975
344	Ga0495672_0000199	3300047320	Bacteria	85658
345	Ga0495683_0002909	3300047323	Bacteria	10133
346	Ga0495679_000020	3300047446	Bacteria	228413
347	Ga0495679_011729	3300047446	Bacteria	3367
348	Ga0495679_071872	3300047446	Bacteria	995
349	Ga0495679_107744	3300047446	Bacteria	769
350	Ga0495673_0000022	3300047469	Bacteria	544086
351	Ga0495673_0000095	3300047469	Bacteria	183429
352	Ga0495681_0012107	3300047470	Bacteria	5084
353	Ga0495681_0055153	3300047470	Bacteria	1854
354	Ga0496100_0003630	3300048903	Bacteria	8063
355	Ga0496100_0251175	3300048903	Bacteria	1308
356	Ga0496101_0000316	3300048904	Bacteria	33306
357	Ga0496101_0072806	3300048904	Bacteria	2523
358	Ga0496101_0454883	3300048904	Bacteria	1010
359	Ga0496102_0009593	3300048905	Bacteria	8325
360	Ga0496102_0168735	3300048905	Bacteria	2060
361	Ga0496103_0055325	3300048906	Bacteria	2461
362	Ga0496104_0000148	3300048907	Bacteria	64805
363	Ga0496104_0001540	3300048907	Bacteria	19900
364	Ga0496105_0009036	3300048908	Bacteria	7776
365	Ga0496105_0076142	3300048908	Bacteria	2770
366	Ga0496105_0355008	3300048908	Bacteria	1170
367	Ga0496105_0444650	3300048908	Bacteria	1024
368	Ga0496110_0212496	3300048913	Bacteria	1759
369	Ga0496113_0238362	3300048916	Bacteria	1451
370	Ga0496116_0000001	3300048919	Bacteria	1501681
371	Ga0496116_0000083	3300048919	Bacteria	220955
372	Ga0496116_0000245	3300048919	Bacteria	98583
373	Ga0496116_0001411	3300048919	Bacteria	27010
374	Ga0496116_0005250	3300048919	Bacteria	12104
375	Ga0496116_0006132	3300048919	Bacteria	10994
376	Ga0496116_0025772	3300048919	Bacteria	4314
377	Ga0496116_0035684	3300048919	Bacteria	3489
378	Ga0496116_0066533	3300048919	Bacteria	2305
379	Ga0496116_0250723	3300048919	Bacteria	881
380	Ga0496117_0000004	3300048920	Bacteria	877131
381	Ga0496117_0000164	3300048920	Bacteria	140349
382	Ga0496117_0000795	3300048920	Bacteria	49204
383	Ga0496117_0001185	3300048920	Bacteria	39192
384	Ga0496117_0002212	3300048920	Bacteria	25193
385	Ga0496117_0004306	3300048920	Bacteria	15842
386	Ga0496117_0005694	3300048920	Bacteria	12981
387	Ga0496117_0006143	3300048920	Bacteria	12279
388	Ga0496117_0009582	3300048920	Bacteria	8973
389	Ga0496117_0069680	3300048920	Bacteria	2366
390	Ga0496117_0069728	3300048920	Bacteria	2365
391	Ga0496117_0077523	3300048920	Bacteria	2199
392	Ga0496117_0137274	3300048920	Bacteria	1471
393	Ga0496117_0288205	3300048920	Bacteria	875
394	Ga0496117_0336738	3300048920	Bacteria	784
395	Ga0496118_0000072	3300048921	Bacteria	201387
396	Ga0496118_0000456	3300048921	Bacteria	67691
397	Ga0496118_0000614	3300048921	Bacteria	58751
398	Ga0496118_0000921	3300048921	Bacteria	46017
399	Ga0496118_0001831	3300048921	Bacteria	30465
400	Ga0496118_0007651	3300048921	Bacteria	11376
401	Ga0496118_0034162	3300048921	Bacteria	4155
402	Ga0496118_0035711	3300048921	Bacteria	4031
403	Ga0496118_0049484	3300048921	Bacteria	3235
404	Ga0496118_0066152	3300048921	Bacteria	2639
405	Ga0496118_0080179	3300048921	Bacteria	2299
406	Ga0496118_0256061	3300048921	Bacteria	991
407	Ga0496118_0429026	3300048921	Bacteria	677
408	Ga0496119_0000008	3300048922	Bacteria	446822
409	Ga0496119_0000124	3300048922	Bacteria	108620
410	Ga0496119_0005184	3300048922	Bacteria	12597
411	Ga0496119_0005255	3300048922	Bacteria	12481
412	Ga0496119_0007503	3300048922	Bacteria	9802
413	Ga0496119_0007606	3300048922	Bacteria	9717
414	Ga0496119_0008650	3300048922	Bacteria	8908
415	Ga0496119_0009751	3300048922	Bacteria	8174
416	Ga0496119_0023407	3300048922	Bacteria	4380
417	Ga0496119_0030167	3300048922	Bacteria	3661
418	Ga0496119_0033906	3300048922	Bacteria	3374
419	Ga0496119_0050999	3300048922	Bacteria	2546
420	Ga0496119_0313594	3300048922	Bacteria	769
421	Ga0496120_0000040	3300048923	Bacteria	201554
422	Ga0496120_0000062	3300048923	Bacteria	172365
423	Ga0496120_0000252	3300048923	Bacteria	89838
424	Ga0496120_0001361	3300048923	Bacteria	29976
425	Ga0496120_0004557	3300048923	Bacteria	11548
426	Ga0496120_0005672	3300048923	Bacteria	9862
427	Ga0496120_0007167	3300048923	Bacteria	8356
428	Ga0496120_0008864	3300048923	Bacteria	7211
429	Ga0496120_0009027	3300048923	Bacteria	7124
430	Ga0496120_0015621	3300048923	Bacteria	4997
431	Ga0496120_0023349	3300048923	Bacteria	3872
432	Ga0496120_0085454	3300048923	Bacteria	1698
433	Ga0496120_0098857	3300048923	Bacteria	1546
434	Ga0496120_0228610	3300048923	Bacteria	884
435	Ga0496120_0231372	3300048923	Bacteria	878
436	Ga0496120_0280930	3300048923	Bacteria	769
437	Ga0496121_0000047	3300048924	Bacteria	335768
438	Ga0496121_0010375	3300048924	Bacteria	10521
439	Ga0496121_0010647	3300048924	Bacteria	10326
440	Ga0496121_0026479	3300048924	Bacteria	5462
441	Ga0496121_0027279	3300048924	Bacteria	5347
442	Ga0496121_0046683	3300048924	Bacteria	3704
443	Ga0496121_0092164	3300048924	Bacteria	2362
444	Ga0496121_0188389	3300048924	Bacteria	1481
445	Ga0496121_0422692	3300048924	Bacteria	866
446	Ga0496122_0000007	3300048925	Bacteria	606493
447	Ga0496122_0000340	3300048925	Bacteria	100894
448	Ga0496122_0000623	3300048925	Bacteria	72623
449	Ga0496122_0000645	3300048925	Bacteria	70755
450	Ga0496122_0002665	3300048925	Bacteria	24891
451	Ga0496122_0020269	3300048925	Bacteria	6021
452	Ga0496122_0022909	3300048925	Bacteria	5529
453	Ga0496122_0024600	3300048925	Bacteria	5263
454	Ga0496122_0073615	3300048925	Bacteria	2421
455	Ga0496122_0102227	3300048925	Bacteria	1911
456	Ga0496122_0268829	3300048925	Bacteria	940
457	Ga0496122_0294200	3300048925	Bacteria	879
458	Ga0496122_0489096	3300048925	Bacteria	600
459	Ga0496123_0000004	3300048926	Bacteria	777230
460	Ga0496123_0000005	3300048926	Bacteria	658131
461	Ga0496123_0000425	3300048926	Bacteria	76122
462	Ga0496123_0000469	3300048926	Bacteria	70755
463	Ga0496123_0001301	3300048926	Bacteria	35551
464	Ga0496123_0003413	3300048926	Bacteria	17881
465	Ga0496123_0007189	3300048926	Bacteria	10563
466	Ga0496123_0009714	3300048926	Bacteria	8618
467	Ga0496123_0011753	3300048926	Bacteria	7542
468	Ga0496123_0065409	3300048926	Bacteria	2311
469	Ga0496123_0090324	3300048926	Bacteria	1821
470	Ga0496123_0308864	3300048926	Bacteria	751
471	Ga0496123_0422514	3300048926	Bacteria	600
472	Ga0496124_0000021	3300048927	Bacteria	432123
473	Ga0496124_0000097	3300048927	Bacteria	183703
474	Ga0496124_0000369	3300048927	Bacteria	82290
475	Ga0496124_0000399	3300048927	Bacteria	79230
476	Ga0496124_0000999	3300048927	Bacteria	44845
477	Ga0496124_0008744	3300048927	Bacteria	10519
478	Ga0496124_0010470	3300048927	Bacteria	9385
479	Ga0496124_0014593	3300048927	Bacteria	7589
480	Ga0496124_0030222	3300048927	Bacteria	4811
481	Ga0496124_0066620	3300048927	Bacteria	2998
482	Ga0496124_0090179	3300048927	Bacteria	2501
483	Ga0496124_0096073	3300048927	Bacteria	2407
484	Ga0496124_0102712	3300048927	Bacteria	2313
485	Ga0496124_0218162	3300048927	Bacteria	1437
486	Ga0496124_0361659	3300048927	Bacteria	1022
487	Ga0496124_0430811	3300048927	Bacteria	905
488	Ga0496124_0484863	3300048927	Bacteria	833
489	Ga0496124_0519484	3300048927	Bacteria	793
490	Ga0496125_0000013	3300048928	Bacteria	628761
491	Ga0496125_0000055	3300048928	Bacteria	278140
492	Ga0496125_0007368	3300048928	Bacteria	11715
493	Ga0496125_0016182	3300048928	Bacteria	7171
494	Ga0496125_0018728	3300048928	Bacteria	6564
495	Ga0496125_0028168	3300048928	Bacteria	5079
496	Ga0496125_0087232	3300048928	Bacteria	2357
497	Ga0496126_0000562	3300048929	Bacteria	71336
498	Ga0496126_0000650	3300048929	Bacteria	64468
499	Ga0496126_0001503	3300048929	Bacteria	36077
500	Ga0496126_0017342	3300048929	Bacteria	7176
501	Ga0496126_0021409	3300048929	Bacteria	6315
502	Ga0496126_0051047	3300048929	Bacteria	3767
503	Ga0496126_0087922	3300048929	Bacteria	2738
504	Ga0496126_0168199	3300048929	Bacteria	1869
505	Ga0496126_0345754	3300048929	Bacteria	1217
506	Ga0496126_0496446	3300048929	Bacteria	976
507	Ga0495678_000118	3300049459	Bacteria	93371
508	Ga0495682_0000015	3300049460	Bacteria	235048
509	nmdc:mga00v17_1412_c1	3300050491	Bacteria	12605
510	nmdc:mga00v17_210893_c1	3300050491	Bacteria	1257
511	nmdc:mga00v17_4676_c1	3300050491	Bacteria	7151
512	nmdc:mga00v17_553609_c1	3300050491	Bacteria	744
513	nmdc:mga00v17_88606_c1	3300050491	Bacteria	1941
514	nmdc:mga0k408_3619_c1	3300050493	Bacteria	8176
515	Ga0500621_000001	3300053126	Bacteria	1049698

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300041507	Ga0451851_0931241	Ga0451851_0931241_25_495	154
2	3300042007	Ga0439449_0056830	Ga0439449_0056830_64_534	154
3	3300046810	Ga0495660_0491718	Ga0495660_0491718_37_507	154
4	3300048913	Ga0496110_0212496	Ga0496110_0212496_65_535	154
5	3300048924	Ga0496121_0000047	Ga0496121_0000047_234253_234723	154
6	3300003856	Ga0058692_1034521	Ga0058692_10345211	156
7	3300027312	Ga0209371_1000086	Ga0209371_1000086126	156
8	3300030500	Ga0268256_1000003	Ga0268256_1000003686	156
9	3300046453	Ga0495627_039317	Ga0495627_039317_930_1409	159
10	3300048927	Ga0496124_0519484	Ga0496124_0519484_69_548	159
11	3300027312	Ga0209371_1014856	Ga0209371_10148563	164
12	3300030500	Ga0268256_1014245	Ga0268256_10142452	164
13	3300015261	Ga0182006_1000022	Ga0182006_100002253	167
14	3300042010	Ga0439452_000003	Ga0439452_000003_181967_182533	167
15	3300048919	Ga0496116_0035684	Ga0496116_0035684_2862_3413	167
16	3300002773	JGI25152J39213_1000040	JGI25152J39213_100004070	170
17	3300003856	Ga0058692_1034550	Ga0058692_10345501	170
18	3300003856	Ga0058692_1041679	Ga0058692_10416791	170
19	3300013307	Ga0157372_10010990	Ga0157372_100109904	170
20	3300025245	Ga0207425_1019142	Ga0207425_10191422	170
21	3300025258	Ga0209129_1000018	Ga0209129_1000018165	170
22	3300030500	Ga0268256_1008053	Ga0268256_10080531	170
23	3300042010	Ga0439452_000008	Ga0439452_000008_360002_360574	170
24	3300042439	Ga0439464_0038103	Ga0439464_0038103_514_1086	170
25	3300048919	Ga0496116_0250723	Ga0496116_0250723_288_860	170
26	3300048920	Ga0496117_0288205	Ga0496117_0288205_69_641	170
27	3300048921	Ga0496118_0429026	Ga0496118_0429026_36_608	170
28	3300048927	Ga0496124_0000097	Ga0496124_0000097_171455_172027	170
29	3300048928	Ga0496125_0087232	Ga0496125_0087232_59_631	170
30	3300048929	Ga0496126_0017342	Ga0496126_0017342_1272_1844	170
31	3300013102	Ga0157371_10025291	Ga0157371_100252912	171
32	3300048920	Ga0496117_0004306	Ga0496117_0004306_298_870	171
33	3300048921	Ga0496118_0066152	Ga0496118_0066152_1770_2342	171
34	3300048925	Ga0496122_0102227	Ga0496122_0102227_423_995	171
35	3300048926	Ga0496123_0065409	Ga0496123_0065409_386_958	171
36	3300048927	Ga0496124_0430811	Ga0496124_0430811_298_870	171
37	3300027312	Ga0209371_1001208	Ga0209371_10012086	174
38	3300030500	Ga0268256_1001186	Ga0268256_100118611	174
39	3300048916	Ga0496113_0238362	Ga0496113_0238362_297_839	174
40	3300003856	Ga0058692_1000189	Ga0058692_100018916	175
41	3300027312	Ga0209371_1000269	Ga0209371_100026932	175
42	3300030500	Ga0268256_1000597	Ga0268256_100059732	175
43	iso_pu_bacteria	2508501071	2508854864	175
44	iso_pu_bacteria	2806310673	2807179122	175
45	iso_pu_bacteria	640753048	640935870	175
46	iso_pu_bacteria	640753048	640940427	175
47	3300048904	Ga0496101_0072806	Ga0496101_0072806_861_1448	176
48	3300048922	Ga0496119_0000008	Ga0496119_0000008_227743_228315	177
49	3300048923	Ga0496120_0008864	Ga0496120_0008864_6422_6994	177
50	iso_pu_bacteria	2506520007	2506577777	178
51	iso_pu_bacteria	2506520008	2506582915	178
52	iso_pu_bacteria	2508501071	2508851717	178
53	iso_pu_bacteria	2585427591	2585827481	178
54	iso_pu_bacteria	2585427592	2585832450	178
55	iso_pu_bacteria	2654587920	2656278538	178
56	iso_pu_bacteria	2667528173	2671106821	178
57	iso_pu_bacteria	2687453601	2689444315	178
58	iso_pu_bacteria	2869551831	2869553632	178
59	iso_pu_bacteria	2904474040	2904475781	178
60	iso_pu_bacteria	2919150387	2919151950	178
61	iso_pu_bacteria	2927143783	2927144619	178
62	iso_pu_bacteria	2932406140	2932410150	178
63	iso_pu_bacteria	2939577877	2939579907	178
64	iso_pu_bacteria	640753048	640937279	178
65	iso_pu_bacteria	8015394850	8015398980	178
66	3300005272	Ga0065703_1018756	Ga0065703_10187566	179
67	3300006946	Ga0079104_1003903	Ga0079104_10039032	179
68	3300009011	Ga0105251_10000474	Ga0105251_100004748	179
69	3300009174	Ga0105241_10000004	Ga0105241_10000004276	179
70	3300014497	Ga0182008_10211242	Ga0182008_102112422	179
71	3300025735	Ga0207713_1000093	Ga0207713_1000093135	179
72	3300025911	Ga0207654_10000006	Ga0207654_10000006293	179
73	3300046520	Ga0495637_0030525	Ga0495637_0030525_1438_1986	179
74	3300046794	Ga0495589_0000041	Ga0495589_0000041_92544_93092	179
75	3300048923	Ga0496120_0231372	Ga0496120_0231372_288_836	179
76	iso_pu_bacteria	2772190666	2772438305	179
77	iso_pu_bacteria	2888366609	2888368376	179
78	iso_pu_bacteria	2888373701	2888374086	179
79	iso_pu_bacteria	2937967321	2937970048	179
80	iso_pu_bacteria	8004592986	8004595231	179
81	iso_pu_bacteria	8015394850	8015396868	179
82	iso_pu_bacteria	2852103415	2852106375	180
83	iso_pu_bacteria	2884086401	2884089586	180
84	iso_pu_bacteria	2904504865	2904505245	180
85	iso_pu_bacteria	8055693939	8055695592	180
86	3300001989	JGI24739J22299_10004839	JGI24739J22299_100048393	181
87	3300009011	Ga0105251_10004798	Ga0105251_100047984	181
88	3300009036	Ga0105244_10000358	Ga0105244_1000035834	181
89	3300013100	Ga0157373_10023784	Ga0157373_100237844	181
90	3300013102	Ga0157371_10001352	Ga0157371_1000135211	181
91	3300013104	Ga0157370_10000416	Ga0157370_1000041624	181
92	3300015261	Ga0182006_1050656	Ga0182006_10506562	181
93	3300025728	Ga0207655_1001280	Ga0207655_100128019	181
94	3300042006	Ga0439432_016683	Ga0439432_016683_1391_1975	181
95	3300042010	Ga0439452_000001	Ga0439452_000001_307258_307842	181
96	3300046794	Ga0495589_0000002	Ga0495589_0000002_23267_23821	181
97	3300048919	Ga0496116_0000245	Ga0496116_0000245_45830_46414	181
98	3300048920	Ga0496117_0000164	Ga0496117_0000164_93941_94525	181
99	3300048921	Ga0496118_0000614	Ga0496118_0000614_22707_23291	181
100	2162886007	SwRhRL2b_contig_1462375	SwRhRL2b_0266.00000350	182
101	3300002737	JGI25162J39368_1000035	JGI25162J39368_100003553	182
102	3300002771	JGI25163J39215_1000010	JGI25163J39215_100001065	182
103	3300002772	JGI25164J39214_1000019	JGI25164J39214_100001953	182
104	3300003751	Ga0055538_1000039	Ga0055538_100003953	182
105	3300003752	Ga0055539_1000050	Ga0055539_1000050117	182
106	3300003756	Ga0055533_1000062	Ga0055533_100006253	182
107	3300003759	Ga0055525_1000072	Ga0055525_1000072117	182
108	3300003841	Ga0055541_1000038	Ga0055541_1000038117	182
109	3300005289	Ga0065704_10000483	Ga0065704_1000048337	182
110	3300005289	Ga0065704_10101890	Ga0065704_101018902	182
111	3300005834	Ga0068851_10438608	Ga0068851_104386081	182
112	3300006946	Ga0079104_1000794	Ga0079104_100079421	182
113	3300006946	Ga0079104_1004467	Ga0079104_10044672	182
114	3300006946	Ga0079104_1027911	Ga0079104_10279112	182
115	3300009011	Ga0105251_10002584	Ga0105251_100025848	182
116	3300009011	Ga0105251_10004500	Ga0105251_100045003	182
117	3300009036	Ga0105244_10000231	Ga0105244_1000023125	182
118	3300009092	Ga0105250_10000168	Ga0105250_100001684	182
119	3300009092	Ga0105250_10006097	Ga0105250_100060976	182
120	3300009101	Ga0105247_10000215	Ga0105247_1000021544	182
121	3300009174	Ga0105241_10000005	Ga0105241_10000005203	182
122	3300013100	Ga0157373_10000242	Ga0157373_1000024237	182
123	3300013102	Ga0157371_10000177	Ga0157371_1000017745	182
124	3300013306	Ga0163162_10052016	Ga0163162_100520163	182
125	3300014497	Ga0182008_10004895	Ga0182008_100048953	182
126	3300017792	Ga0163161_10000001	Ga0163161_10000001495	182
127	3300025207	Ga0209760_100002	Ga0209760_10000237	182
128	3300025224	Ga0209784_100001	Ga0209784_1000012704	182
129	3300025225	Ga0209566_100001	Ga0209566_1000012704	182
130	3300025226	Ga0209674_100002	Ga0209674_1000022704	182
131	3300025230	Ga0209563_100002	Ga0209563_1000021239	182
132	3300025231	Ga0207427_100012	Ga0207427_100012111	182
133	3300025233	Ga0209437_100001	Ga0209437_1000011239	182
134	3300025253	Ga0209677_100002	Ga0209677_1000021239	182
135	3300025261	Ga0209233_1032453	Ga0209233_10324532	182
136	3300025711	Ga0207696_1000001	Ga0207696_1000001570	182
137	3300025711	Ga0207696_1000287	Ga0207696_100028745	182
138	3300025728	Ga0207655_1000454	Ga0207655_100045411	182
139	3300025735	Ga0207713_1000303	Ga0207713_10003038	182
140	3300025735	Ga0207713_1000332	Ga0207713_10003328	182
141	3300025900	Ga0207710_10000074	Ga0207710_100000743	182
142	3300025911	Ga0207654_10000007	Ga0207654_10000007187	182
143	3300027111	Ga0209281_1000027	Ga0209281_1000027331	182
144	3300027111	Ga0209281_1000892	Ga0209281_10008928	182
145	3300041405	Ga0439438_005818	Ga0439438_005818_38_586	182
146	3300046453	Ga0495627_000018	Ga0495627_000018_12976_13533	182
147	3300046471	Ga0495650_0000018	Ga0495650_0000018_409584_410150	182
148	3300046530	Ga0495654_0000765	Ga0495654_0000765_19713_20270	182
149	3300046810	Ga0495660_0000004	Ga0495660_0000004_657429_657995	182
150	3300048907	Ga0496104_0001540	Ga0496104_0001540_2756_3322	182
151	3300048919	Ga0496116_0000001	Ga0496116_0000001_49517_50074	182
152	3300048919	Ga0496116_0000083	Ga0496116_0000083_208817_209383	182
153	3300048920	Ga0496117_0005694	Ga0496117_0005694_7845_8411	182
154	3300048920	Ga0496117_0009582	Ga0496117_0009582_620_1177	182
155	3300048921	Ga0496118_0000456	Ga0496118_0000456_45903_46472	182
156	3300048921	Ga0496118_0001831	Ga0496118_0001831_11573_12139	182
157	3300048922	Ga0496119_0007606	Ga0496119_0007606_6684_7250	182
158	3300048922	Ga0496119_0033906	Ga0496119_0033906_2363_2920	182
159	3300048923	Ga0496120_0098857	Ga0496120_0098857_775_1332	182
160	3300048925	Ga0496122_0000007	Ga0496122_0000007_501593_502159	182
161	3300048926	Ga0496123_0000004	Ga0496123_0000004_275071_275637	182
162	3300048927	Ga0496124_0000369	Ga0496124_0000369_64704_65270	182
163	3300048928	Ga0496125_0000013	Ga0496125_0000013_79164_79730	182
164	3300048929	Ga0496126_0000562	Ga0496126_0000562_57403_57969	182
165	iso_pu_bacteria	2609459761	2609910783	182
166	iso_pu_bacteria	2711768156	2712469171	182
167	iso_pu_bacteria	2945874760	2945878683	182
168	3300006946	Ga0079104_1000196	Ga0079104_100019656	183
169	3300013307	Ga0157372_10237535	Ga0157372_102375354	183
170	3300027111	Ga0209281_1000114	Ga0209281_1000114201	183
171	3300027312	Ga0209371_1002420	Ga0209371_10024201	183
172	3300030500	Ga0268256_1013924	Ga0268256_10139241	183
173	3300048922	Ga0496119_0007503	Ga0496119_0007503_230_790	183
174	3300048922	Ga0496119_0009751	Ga0496119_0009751_1742_2302	183
175	3300048923	Ga0496120_0009027	Ga0496120_0009027_36_596	183
176	3300048923	Ga0496120_0228610	Ga0496120_0228610_95_655	183
177	3300048927	Ga0496124_0000021	Ga0496124_0000021_49458_50018	183
178	iso_pu_bacteria	2511231025	2511378194	183
179	iso_pu_bacteria	2511231035	2511434135	183
180	iso_pu_bacteria	2554235234	2555261324	183
181	iso_pu_bacteria	2599185169	2599410737	183
182	iso_pu_bacteria	2599185299	2599927489	183
183	iso_pu_bacteria	2600255254	2601523620	183
184	iso_pu_bacteria	2600255255	2601528779	183
185	iso_pu_bacteria	2600255280	2601615612	183
186	iso_pu_bacteria	2600255281	2601620668	183
187	iso_pu_bacteria	2600255287	2601645515	183
188	iso_pu_bacteria	2600255288	2601649065	183
189	iso_pu_bacteria	2600255289	2601653663	183
190	iso_pu_bacteria	2600255290	2601659083	183
191	iso_pu_bacteria	2600255291	2601665498	183
192	iso_pu_bacteria	2600255298	2601698357	183
193	iso_pu_bacteria	2600255299	2601703661	183
194	iso_pu_bacteria	2600255300	2601707760	183
195	iso_pu_bacteria	2600255301	2601712819	183
196	iso_pu_bacteria	2600255302	2601716922	183
197	iso_pu_bacteria	2600255303	2601723599	183
198	iso_pu_bacteria	2600255304	2601724915	183
199	iso_pu_bacteria	2600255305	2601732198	183
200	iso_pu_bacteria	2600255306	2601737924	183
201	iso_pu_bacteria	2600255307	2601742670	183
202	iso_pu_bacteria	2600255309	2601752122	183
203	iso_pu_bacteria	2600255392	2602020569	183
204	iso_pu_bacteria	2602042052	2603658811	183
205	iso_pu_bacteria	2602042053	2603668390	183
206	iso_pu_bacteria	2602042103	2603839268	183
207	iso_pu_bacteria	2602042104	2603844676	183
208	iso_pu_bacteria	2602042105	2603849425	183
209	iso_pu_bacteria	2602042106	2603854493	183
210	iso_pu_bacteria	2602042109	2603865807	183
211	iso_pu_bacteria	2602042110	2603870094	183
212	iso_pu_bacteria	2602042111	2603875047	183
213	iso_pu_bacteria	2603880178	2606047285	183
214	iso_pu_bacteria	2603880184	2606072812	183
215	iso_pu_bacteria	2603880202	2606146213	183
216	iso_pu_bacteria	2603880211	2606177139	183
217	iso_pu_bacteria	2608642108	2608668908	183
218	iso_pu_bacteria	2636415599	2637226117	183
219	iso_pu_bacteria	2648501693	2650896837	183
220	iso_pu_bacteria	2675903046	2676407690	183
221	iso_pu_bacteria	2684622997	2686352836	183
222	iso_pu_bacteria	2775507074	2777020523	183
223	iso_pu_bacteria	2808606414	2809127734	183
224	iso_pu_bacteria	2844528606	2844531707	183
225	iso_pu_bacteria	2847797336	2847800484	183
226	iso_pu_bacteria	2865014394	2865015737	183
227	iso_pu_bacteria	2876601092	2876602085	183
228	iso_pu_bacteria	2881609920	2881610356	183
229	iso_pu_bacteria	2904513164	2904517601	183
230	iso_pu_bacteria	2908669403	2908670751	183
231	iso_pu_bacteria	2919108558	2919111636	183
232	iso_pu_bacteria	2939573065	2939574380	183
233	iso_pu_bacteria	2939602548	2939602637	183
234	iso_pu_bacteria	2939607340	2939608071	183
235	iso_pu_bacteria	2945951305	2945953571	183
236	iso_pu_bacteria	2969079654	2969083130	183
237	iso_pu_bacteria	2971820967	2971824513	183
238	iso_pu_bacteria	2978975091	2978976064	183
239	iso_pu_bacteria	2984494565	2984496065	183
240	iso_pu_bacteria	2984559226	2984560150	183
241	iso_pu_bacteria	2984595703	2984598231	183
242	iso_pu_bacteria	2990261002	2990262744	183
243	iso_pu_bacteria	8016733728	8016736464	183
244	iso_pu_bacteria	8019499862	8019503136	183
245	iso_pu_bacteria	8055097453	8055099527	183
246	iso_pu_bacteria	8057304971	8057305609	183
247	3300009036	Ga0105244_10000085	Ga0105244_1000008551	184
248	3300009092	Ga0105250_10000003	Ga0105250_1000000348	184
249	3300013104	Ga0157370_10001685	Ga0157370_1000168512	184
250	3300025711	Ga0207696_1000004	Ga0207696_1000004586	184
251	3300025728	Ga0207655_1000194	Ga0207655_100019466	184
252	3300047470	Ga0495681_0055153	Ga0495681_0055153_668_1249	184
253	iso_pu_bacteria	2547132181	2547694803	184
254	iso_pu_bacteria	2547132416	2548648967	184
255	iso_pu_bacteria	2561511199	2562466833	184
256	iso_pu_bacteria	2600255256	2601532361	184
257	iso_pu_bacteria	2600255257	2601537731	184
258	iso_pu_bacteria	2600255310	2601756077	184
259	iso_pu_bacteria	2600255311	2601761448	184
260	iso_pu_bacteria	2602042046	2603638527	184
261	iso_pu_bacteria	2602042047	2603643058	184
262	iso_pu_bacteria	2602042066	2603699630	184
263	iso_pu_bacteria	2602042067	2603703638	184
264	iso_pu_bacteria	2667528172	2671102791	184
265	iso_pu_bacteria	2671180115	2671588044	184
266	iso_pu_bacteria	2681812866	2681995425	184
267	iso_pu_bacteria	2681812869	2682007200	184
268	iso_pu_bacteria	2751185917	2753855392	184
269	iso_pu_bacteria	2765235842	2765588349	184
270	iso_pu_bacteria	2775506706	2775542142	184
271	iso_pu_bacteria	2791355010	2792311690	184
272	iso_pu_bacteria	2811995292	2813729578	184
273	iso_pu_bacteria	2814123068	2814697078	184
274	iso_pu_bacteria	2821118458	2821119211	184
275	iso_pu_bacteria	2823373977	2823374139	184
276	iso_pu_bacteria	2844425489	2844426946	184
277	iso_pu_bacteria	2891670763	2891673787	184
278	iso_pu_bacteria	2923634449	2923638837	184
279	iso_pu_bacteria	2927833300	2927834680	184
280	iso_pu_bacteria	2935625433	2935627215	184
281	iso_pu_bacteria	2937539931	2937543422	184
282	iso_pu_bacteria	2939568625	2939572740	184
283	iso_pu_bacteria	2939617950	2939618999	184
284	iso_pu_bacteria	2939642701	2939644321	184
285	iso_pu_bacteria	2974310843	2974312724	184
286	iso_pu_bacteria	2974435778	2974437867	184
287	iso_pu_bacteria	3000376612	3000379718	184
288	iso_pu_bacteria	8018221730	8018225484	184
289	iso_pu_bacteria	8018405270	8018407264	184
290	iso_pu_bacteria	8019504834	8019505883	184
291	iso_pu_bacteria	8054844752	8054844824	184
292	iso_pu_bacteria	8054849141	8054849549	184
293	iso_pu_bacteria	8055087960	8055088648	184
294	iso_pu_bacteria	8055092621	8055094102	184
295	3300003856	Ga0058692_1000076	Ga0058692_100007619	186
296	3300003856	Ga0058692_1015248	Ga0058692_10152482	186
297	3300009011	Ga0105251_10000351	Ga0105251_1000035135	186
298	3300009036	Ga0105244_10000034	Ga0105244_1000003433	186
299	3300009036	Ga0105244_10007471	Ga0105244_100074713	186
300	3300009036	Ga0105244_10079497	Ga0105244_100794972	186
301	3300009036	Ga0105244_10090119	Ga0105244_100901193	186
302	3300009092	Ga0105250_10000206	Ga0105250_1000020635	186
303	3300013100	Ga0157373_10151113	Ga0157373_101511131	186
304	3300013102	Ga0157371_10007098	Ga0157371_100070989	186
305	3300013307	Ga0157372_10007676	Ga0157372_100076763	186
306	3300021384	Ga0213876_10000016	Ga0213876_10000016287	186
307	3300025711	Ga0207696_1000077	Ga0207696_1000077166	186
308	3300025728	Ga0207655_1000046	Ga0207655_100004671	186
309	3300025728	Ga0207655_1014233	Ga0207655_10142334	186
310	3300025735	Ga0207713_1000346	Ga0207713_10003466	186
311	3300027312	Ga0209371_1000085	Ga0209371_100008539	186
312	3300027312	Ga0209371_1000404	Ga0209371_100040441	186
313	3300030500	Ga0268256_1000048	Ga0268256_100004839	186
314	3300030500	Ga0268256_1004965	Ga0268256_10049651	186
315	3300039437	Ga0436365_1910565	Ga0436365_1910565_198833_199399	186
316	3300041405	Ga0439438_000001	Ga0439438_000001_351680_352243	186
317	3300041405	Ga0439438_010238	Ga0439438_010238_496_1059	186
318	3300041407	Ga0439447_002002	Ga0439447_002002_399_962	186
319	3300041407	Ga0439447_014850	Ga0439447_014850_119_682	186
320	3300042006	Ga0439432_003243	Ga0439432_003243_3326_3889	186
321	3300046458	Ga0495591_000956	Ga0495591_000956_15425_15985	186
322	3300046522	Ga0495643_0114300	Ga0495643_0114300_774_1334	186
323	3300046694	Ga0495649_0005938	Ga0495649_0005938_191_751	186
324	3300047446	Ga0495679_011729	Ga0495679_011729_1369_1929	186
325	3300048925	Ga0496122_0000623	Ga0496122_0000623_50446_51012	186
326	3300048926	Ga0496123_0000425	Ga0496123_0000425_46286_46852	186
327	3300048926	Ga0496123_0003413	Ga0496123_0003413_9183_9749	186
328	3300048929	Ga0496126_0021409	Ga0496126_0021409_1851_2411	186
329	3300002737	JGI25162J39368_1004627	JGI25162J39368_10046274	187
330	3300003856	Ga0058692_1000809	Ga0058692_10008094	187
331	3300003856	Ga0058692_1000959	Ga0058692_10009595	187
332	3300003856	Ga0058692_1001707	Ga0058692_10017075	187
333	3300003856	Ga0058692_1002605	Ga0058692_10026052	187
334	3300005347	Ga0070668_100002085	Ga0070668_1000020857	187
335	3300005548	Ga0070665_100055030	Ga0070665_1000550302	187
336	3300006051	Ga0075364_10055499	Ga0075364_100554992	187
337	3300006051	Ga0075364_10101011	Ga0075364_101010111	187
338	3300006946	Ga0079104_1000035	Ga0079104_100003535	187
339	3300006946	Ga0079104_1001661	Ga0079104_10016618	187
340	3300009011	Ga0105251_10005884	Ga0105251_100058845	187
341	3300009011	Ga0105251_10009064	Ga0105251_100090645	187
342	3300009011	Ga0105251_10031944	Ga0105251_100319443	187
343	3300009011	Ga0105251_10037801	Ga0105251_100378012	187
344	3300009011	Ga0105251_10053954	Ga0105251_100539542	187
345	3300009011	Ga0105251_10114409	Ga0105251_101144092	187
346	3300009011	Ga0105251_10216600	Ga0105251_102166001	187
347	3300009036	Ga0105244_10000094	Ga0105244_1000009450	187
348	3300009036	Ga0105244_10004281	Ga0105244_1000428110	187
349	3300009036	Ga0105244_10044549	Ga0105244_100445492	187
350	3300009036	Ga0105244_10337076	Ga0105244_103370762	187
351	3300009092	Ga0105250_10000698	Ga0105250_100006988	187
352	3300009092	Ga0105250_10001459	Ga0105250_100014596	187
353	3300009092	Ga0105250_10004087	Ga0105250_100040875	187
354	3300009092	Ga0105250_10082058	Ga0105250_100820581	187
355	3300011119	Ga0105246_10010335	Ga0105246_100103354	187
356	3300011119	Ga0105246_10017703	Ga0105246_100177034	187
357	3300011119	Ga0105246_10048853	Ga0105246_100488531	187
358	3300013100	Ga0157373_10000657	Ga0157373_1000065717	187
359	3300013102	Ga0157371_10000288	Ga0157371_1000028822	187
360	3300013105	Ga0157369_10018317	Ga0157369_100183175	187
361	3300013306	Ga0163162_10063424	Ga0163162_100634243	187
362	3300013306	Ga0163162_10133202	Ga0163162_101332022	187
363	3300013307	Ga0157372_10122560	Ga0157372_101225603	187
364	3300013307	Ga0157372_10146045	Ga0157372_101460453	187
365	3300013307	Ga0157372_10309950	Ga0157372_103099501	187
366	3300013307	Ga0157372_11585912	Ga0157372_115859121	187
367	3300013308	Ga0157375_10611562	Ga0157375_106115621	187
368	3300014497	Ga0182008_10032529	Ga0182008_100325292	187
369	3300015261	Ga0182006_1001188	Ga0182006_100118818	187
370	3300015262	Ga0182007_10043706	Ga0182007_100437061	187
371	3300017792	Ga0163161_10007073	Ga0163161_100070735	187
372	3300025233	Ga0209437_100035	Ga0209437_100035204	187
373	3300025711	Ga0207696_1000070	Ga0207696_1000070187	187
374	3300025711	Ga0207696_1000521	Ga0207696_100052116	187
375	3300025711	Ga0207696_1000669	Ga0207696_10006699	187
376	3300025711	Ga0207696_1000764	Ga0207696_10007648	187
377	3300025728	Ga0207655_1000102	Ga0207655_100010280	187
378	3300025728	Ga0207655_1000280	Ga0207655_100028037	187
379	3300025728	Ga0207655_1014981	Ga0207655_10149816	187
380	3300025728	Ga0207655_1034340	Ga0207655_10343401	187
381	3300025728	Ga0207655_1043304	Ga0207655_10433041	187
382	3300025728	Ga0207655_1110386	Ga0207655_11103862	187
383	3300025735	Ga0207713_1000001	Ga0207713_1000001546	187
384	3300025735	Ga0207713_1000040	Ga0207713_1000040188	187
385	3300025735	Ga0207713_1031089	Ga0207713_10310891	187
386	3300025735	Ga0207713_1031187	Ga0207713_10311871	187
387	3300025735	Ga0207713_1053336	Ga0207713_10533362	187
388	3300025735	Ga0207713_1104500	Ga0207713_11045001	187
389	3300025923	Ga0207681_10582706	Ga0207681_105827061	187
390	3300025972	Ga0207668_10027644	Ga0207668_100276444	187
391	3300027111	Ga0209281_1000001	Ga0209281_10000011181	187
392	3300027111	Ga0209281_1002915	Ga0209281_10029154	187
393	3300027312	Ga0209371_1000010	Ga0209371_1000010314	187
394	3300027312	Ga0209371_1000413	Ga0209371_100041323	187
395	3300027312	Ga0209371_1000432	Ga0209371_100043222	187
396	3300027312	Ga0209371_1000454	Ga0209371_10004546	187
397	3300027312	Ga0209371_1002193	Ga0209371_10021938	187
398	3300027312	Ga0209371_1002371	Ga0209371_10023718	187
399	3300027312	Ga0209371_1002719	Ga0209371_10027195	187
400	3300027312	Ga0209371_1003319	Ga0209371_10033192	187
401	3300027312	Ga0209371_1003748	Ga0209371_10037487	187
402	3300027312	Ga0209371_1005589	Ga0209371_10055892	187
403	3300028379	Ga0268266_10037595	Ga0268266_100375952	187
404	3300030500	Ga0268256_1000092	Ga0268256_1000092108	187
405	3300030500	Ga0268256_1000124	Ga0268256_1000124119	187
406	3300030500	Ga0268256_1000371	Ga0268256_100037122	187
407	3300030500	Ga0268256_1003001	Ga0268256_10030012	187
408	3300030500	Ga0268256_1003191	Ga0268256_10031914	187
409	3300030500	Ga0268256_1005403	Ga0268256_10054035	187
410	3300030500	Ga0268256_1006184	Ga0268256_10061843	187
411	3300030500	Ga0268256_1027517	Ga0268256_10275172	187
412	3300030500	Ga0268256_1031965	Ga0268256_10319652	187
413	3300041405	Ga0439438_033877	Ga0439438_033877_440_1009	187
414	3300041407	Ga0439447_010010	Ga0439447_010010_1012_1581	187
415	3300041411	Ga0439466_0000003	Ga0439466_0000003_142442_143011	187
416	3300042016	Ga0439463_002199	Ga0439463_002199_4113_4682	187
417	3300042146	Ga0450907_000795	Ga0450907_000795_3413_3982	187
418	3300042439	Ga0439464_0003100	Ga0439464_0003100_2292_2861	187
419	3300046452	Ga0495617_136261	Ga0495617_136261_96_662	187
420	3300046458	Ga0495591_000014	Ga0495591_000014_119213_119779	187
421	3300046458	Ga0495591_009190	Ga0495591_009190_3352_3918	187
422	3300046458	Ga0495591_084986	Ga0495591_084986_178_747	187
423	3300046460	Ga0495638_0016862	Ga0495638_0016862_4121_4684	187
424	3300046461	Ga0495641_0171067	Ga0495641_0171067_346_912	187
425	3300046471	Ga0495650_0000032	Ga0495650_0000032_166962_167528	187
426	3300046471	Ga0495650_0125786	Ga0495650_0125786_255_818	187
427	3300046474	Ga0495605_0040761	Ga0495605_0040761_1340_1906	187
428	3300046492	Ga0495585_0014673	Ga0495585_0014673_3318_3887	187
429	3300046501	Ga0495607_0028131	Ga0495607_0028131_1551_2117	187
430	3300046507	Ga0495606_0000483	Ga0495606_0000483_38684_39250	187
431	3300046513	Ga0495616_0022488	Ga0495616_0022488_1730_2296	187
432	3300046515	Ga0495620_0051478	Ga0495620_0051478_802_1365	187
433	3300046522	Ga0495643_0025546	Ga0495643_0025546_1997_2563	187
434	3300046522	Ga0495643_0084378	Ga0495643_0084378_687_1256	187
435	3300046523	Ga0495644_0001036	Ga0495644_0001036_9614_10180	187
436	3300046524	Ga0495648_0003073	Ga0495648_0003073_10648_11217	187
437	3300046524	Ga0495648_0030680	Ga0495648_0030680_1417_1983	187
438	3300046530	Ga0495654_0000049	Ga0495654_0000049_3644_4210	187
439	3300046530	Ga0495654_0000052	Ga0495654_0000052_40708_41274	187
440	3300046542	Ga0495597_0000412	Ga0495597_0000412_9334_9897	187
441	3300046616	Ga0495668_0064565	Ga0495668_0064565_153_719	187
442	3300046648	Ga0495611_0246827	Ga0495611_0246827_27_593	187
443	3300046674	Ga0495588_0073243	Ga0495588_0073243_843_1406	187
444	3300046692	Ga0495671_0001475	Ga0495671_0001475_7569_8135	187
445	3300046692	Ga0495671_0056612	Ga0495671_0056612_1044_1607	187
446	3300046694	Ga0495649_0001822	Ga0495649_0001822_14902_15465	187
447	3300046694	Ga0495649_0012923	Ga0495649_0012923_102_668	187
448	3300046794	Ga0495589_0029835	Ga0495589_0029835_1825_2391	187
449	3300046810	Ga0495660_0000021	Ga0495660_0000021_17682_18248	187
450	3300046810	Ga0495660_0023974	Ga0495660_0023974_429_998	187
451	3300047320	Ga0495672_0000002	Ga0495672_0000002_130620_131186	187
452	3300047320	Ga0495672_0000012	Ga0495672_0000012_369193_369762	187
453	3300047323	Ga0495683_0002909	Ga0495683_0002909_2887_3453	187
454	3300047446	Ga0495679_071872	Ga0495679_071872_119_682	187
455	3300047446	Ga0495679_107744	Ga0495679_107744_166_729	187
456	3300047469	Ga0495673_0000095	Ga0495673_0000095_143718_144284	187
457	3300047470	Ga0495681_0012107	Ga0495681_0012107_1129_1692	187
458	3300048903	Ga0496100_0003630	Ga0496100_0003630_1210_1779	187
459	3300048903	Ga0496100_0251175	Ga0496100_0251175_206_769	187
460	3300048904	Ga0496101_0000316	Ga0496101_0000316_29939_30505	187
461	3300048904	Ga0496101_0454883	Ga0496101_0454883_400_963	187
462	3300048905	Ga0496102_0009593	Ga0496102_0009593_6783_7352	187
463	3300048905	Ga0496102_0168735	Ga0496102_0168735_1420_1989	187
464	3300048906	Ga0496103_0055325	Ga0496103_0055325_463_1032	187
465	3300048908	Ga0496105_0009036	Ga0496105_0009036_3586_4155	187
466	3300048908	Ga0496105_0355008	Ga0496105_0355008_56_625	187
467	3300048908	Ga0496105_0444650	Ga0496105_0444650_120_683	187
468	3300048919	Ga0496116_0006132	Ga0496116_0006132_4631_5197	187
469	3300048919	Ga0496116_0025772	Ga0496116_0025772_3393_3962	187
470	3300048920	Ga0496117_0000004	Ga0496117_0000004_443258_443827	187
471	3300048920	Ga0496117_0000795	Ga0496117_0000795_11246_11815	187
472	3300048920	Ga0496117_0077523	Ga0496117_0077523_502_1068	187
473	3300048920	Ga0496117_0137274	Ga0496117_0137274_54_617	187
474	3300048921	Ga0496118_0000072	Ga0496118_0000072_9970_10539	187
475	3300048921	Ga0496118_0000921	Ga0496118_0000921_353_922	187
476	3300048921	Ga0496118_0035711	Ga0496118_0035711_497_1060	187
477	3300048921	Ga0496118_0256061	Ga0496118_0256061_351_917	187
478	3300048922	Ga0496119_0000124	Ga0496119_0000124_59700_60269	187
479	3300048922	Ga0496119_0005184	Ga0496119_0005184_8503_9069	187
480	3300048922	Ga0496119_0023407	Ga0496119_0023407_904_1467	187
481	3300048922	Ga0496119_0050999	Ga0496119_0050999_1750_2316	187
482	3300048923	Ga0496120_0000040	Ga0496120_0000040_127504_128070	187
483	3300048923	Ga0496120_0000062	Ga0496120_0000062_46214_46783	187
484	3300048923	Ga0496120_0000252	Ga0496120_0000252_78218_78787	187
485	3300048923	Ga0496120_0001361	Ga0496120_0001361_223_789	187
486	3300048923	Ga0496120_0015621	Ga0496120_0015621_329_892	187
487	3300048925	Ga0496122_0002665	Ga0496122_0002665_20352_20921	187
488	3300048925	Ga0496122_0073615	Ga0496122_0073615_1522_2085	187
489	3300048926	Ga0496123_0001301	Ga0496123_0001301_350_919	187
490	3300048926	Ga0496123_0007189	Ga0496123_0007189_9135_9701	187
491	3300048926	Ga0496123_0308864	Ga0496123_0308864_50_613	187
492	3300048927	Ga0496124_0000399	Ga0496124_0000399_32762_33328	187
493	3300048927	Ga0496124_0000999	Ga0496124_0000999_40591_41157	187
494	3300048927	Ga0496124_0010470	Ga0496124_0010470_353_922	187
495	3300048927	Ga0496124_0014593	Ga0496124_0014593_773_1357	187
496	3300048927	Ga0496124_0030222	Ga0496124_0030222_2564_3133	187
497	3300048927	Ga0496124_0066620	Ga0496124_0066620_2201_2767	187
498	3300048927	Ga0496124_0090179	Ga0496124_0090179_1679_2248	187
499	3300048927	Ga0496124_0102712	Ga0496124_0102712_908_1471	187
500	3300048927	Ga0496124_0361659	Ga0496124_0361659_296_862	187
501	3300048928	Ga0496125_0000055	Ga0496125_0000055_54266_54829	187
502	3300048928	Ga0496125_0018728	Ga0496125_0018728_3474_4043	187
503	3300048929	Ga0496126_0087922	Ga0496126_0087922_732_1301	187
504	3300048929	Ga0496126_0496446	Ga0496126_0496446_171_734	187
505	3300049459	Ga0495678_000118	Ga0495678_000118_78662_79228	187
506	3300049460	Ga0495682_0000015	Ga0495682_0000015_107238_107804	187
507	3300050491	nmdc:mga00v17_210893_c1	nmdc:mga00v17_210893_c1_302_868	187
508	3300050491	nmdc:mga00v17_553609_c1	nmdc:mga00v17_553609_c1_73_642	187
509	3300050491	nmdc:mga00v17_88606_c1	nmdc:mga00v17_88606_c1_1020_1589	187
510	3300053126	Ga0500621_000001	Ga0500621_000001_766235_766801	187
511	2162886007	SwRhRL2b_contig_1387449	SwRhRL2b_0846.00005320	188
512	2162886007	SwRhRL2b_contig_244625	SwRhRL2b_0979.00001770	188
513	2162886007	SwRhRL2b_contig_3876119	SwRhRL2b_0858.00004750	188
514	2162886007	SwRhRL2b_contig_435514	SwRhRL2b_0792.00000200	188
515	3300003320	rootH2_10033826	rootH2_1003382616	188
516	3300003856	Ga0058692_1010323	Ga0058692_10103232	188
517	3300003856	Ga0058692_1010332	Ga0058692_10103321	188
518	3300005289	Ga0065704_10001725	Ga0065704_100017252	188
519	3300005289	Ga0065704_10002392	Ga0065704_100023924	188
520	3300005289	Ga0065704_10004405	Ga0065704_100044053	188
521	3300005289	Ga0065704_10072964	Ga0065704_100729642	188
522	3300005339	Ga0070660_100173763	Ga0070660_1001737631	188
523	3300005366	Ga0070659_100014398	Ga0070659_1000143984	188
524	3300005548	Ga0070665_100000345	Ga0070665_10000034533	188
525	3300005577	Ga0068857_100001550	Ga0068857_1000015503	188
526	3300005834	Ga0068851_10145912	Ga0068851_101459121	188
527	3300006051	Ga0075364_10002520	Ga0075364_100025207	188
528	3300006051	Ga0075364_10176920	Ga0075364_101769201	188
529	3300006195	Ga0075366_10016727	Ga0075366_100167272	188
530	3300006946	Ga0079104_1000114	Ga0079104_100011437	188
531	3300006946	Ga0079104_1001186	Ga0079104_100118615	188
532	3300006946	Ga0079104_1001217	Ga0079104_100121714	188
533	3300006946	Ga0079104_1004588	Ga0079104_10045882	188
534	3300006946	Ga0079104_1004734	Ga0079104_10047344	188
535	3300006946	Ga0079104_1012426	Ga0079104_10124261	188
536	3300009011	Ga0105251_10004164	Ga0105251_100041644	188
537	3300009011	Ga0105251_10023719	Ga0105251_100237192	188
538	3300009011	Ga0105251_10034009	Ga0105251_100340092	188
539	3300009011	Ga0105251_10063555	Ga0105251_100635552	188
540	3300009036	Ga0105244_10019646	Ga0105244_100196463	188
541	3300009036	Ga0105244_10075448	Ga0105244_100754482	188
542	3300009036	Ga0105244_10075471	Ga0105244_100754712	188
543	3300009036	Ga0105244_10109288	Ga0105244_101092882	188
544	3300009092	Ga0105250_10003403	Ga0105250_100034032	188
545	3300009092	Ga0105250_10007050	Ga0105250_100070503	188
546	3300009092	Ga0105250_10016320	Ga0105250_100163204	188
547	3300009092	Ga0105250_10073661	Ga0105250_100736611	188
548	3300009092	Ga0105250_10073833	Ga0105250_100738331	188
549	3300009148	Ga0105243_10282343	Ga0105243_102823431	188
550	3300013102	Ga0157371_10005654	Ga0157371_100056545	188
551	3300013102	Ga0157371_10037241	Ga0157371_100372412	188
552	3300013104	Ga0157370_10004546	Ga0157370_100045466	188
553	3300015261	Ga0182006_1054670	Ga0182006_10546702	188
554	3300015679	Ga0183366_1001	Ga0183366_1001723	188
555	3300015680	Ga0183370_1001	Ga0183370_1001723	188
556	3300015685	Ga0183369_1001	Ga0183369_1001723	188
557	3300015687	Ga0183368_1001	Ga0183368_1001723	188
558	3300025711	Ga0207696_1000535	Ga0207696_10005352	188
559	3300025711	Ga0207696_1002648	Ga0207696_10026485	188
560	3300025728	Ga0207655_1000001	Ga0207655_1000001805	188
561	3300025728	Ga0207655_1000009	Ga0207655_100000913	188
562	3300025728	Ga0207655_1001903	Ga0207655_10019031	188
563	3300025728	Ga0207655_1013649	Ga0207655_10136494	188
564	3300025728	Ga0207655_1060869	Ga0207655_10608692	188
565	3300025735	Ga0207713_1000012	Ga0207713_1000012404	188
566	3300025735	Ga0207713_1004859	Ga0207713_10048595	188
567	3300025735	Ga0207713_1018287	Ga0207713_10182872	188
568	3300025735	Ga0207713_1029592	Ga0207713_10295922	188
569	3300025735	Ga0207713_1065021	Ga0207713_10650212	188
570	3300025932	Ga0207690_10012840	Ga0207690_100128403	188
571	3300026116	Ga0207674_10003176	Ga0207674_1000317616	188
572	3300027111	Ga0209281_1000180	Ga0209281_100018035	188
573	3300027111	Ga0209281_1000234	Ga0209281_100023472	188
574	3300027111	Ga0209281_1000358	Ga0209281_10003587	188
575	3300027111	Ga0209281_1000525	Ga0209281_100052536	188
576	3300027111	Ga0209281_1000535	Ga0209281_10005355	188
577	3300027111	Ga0209281_1001835	Ga0209281_10018355	188
578	3300027111	Ga0209281_1002366	Ga0209281_10023665	188
579	3300027312	Ga0209371_1000001	Ga0209371_1000001676	188
580	3300027312	Ga0209371_1001802	Ga0209371_10018028	188
581	3300028379	Ga0268266_10002880	Ga0268266_100028802	188
582	3300030500	Ga0268256_1000001	Ga0268256_10000011965	188
583	3300030500	Ga0268256_1001573	Ga0268256_10015734	188
584	3300042010	Ga0439452_000061	Ga0439452_000061_56470_57036	188
585	3300042010	Ga0439452_001514	Ga0439452_001514_3895_4461	188
586	3300042439	Ga0439464_0004715	Ga0439464_0004715_2133_2699	188
587	3300044669	Ga0466981_0000005	Ga0466981_0000005_37525_38091	188
588	3300046458	Ga0495591_000022	Ga0495591_000022_131826_132392	188
589	3300046471	Ga0495650_0000021	Ga0495650_0000021_279885_280451	188
590	3300046522	Ga0495643_0077563	Ga0495643_0077563_1015_1581	188
591	3300046530	Ga0495654_0006559	Ga0495654_0006559_1129_1695	188
592	3300046530	Ga0495654_0020006	Ga0495654_0020006_1859_2425	188
593	3300046530	Ga0495654_0025354	Ga0495654_0025354_942_1508	188
594	3300046660	Ga0495625_0050971	Ga0495625_0050971_783_1349	188
595	3300047320	Ga0495672_0000199	Ga0495672_0000199_58061_58627	188
596	3300047446	Ga0495679_000020	Ga0495679_000020_127095_127661	188
597	3300047469	Ga0495673_0000022	Ga0495673_0000022_25458_26024	188
598	3300048907	Ga0496104_0000148	Ga0496104_0000148_16051_16617	188
599	3300048908	Ga0496105_0076142	Ga0496105_0076142_285_851	188
600	3300048919	Ga0496116_0001411	Ga0496116_0001411_25041_25607	188
601	3300048919	Ga0496116_0005250	Ga0496116_0005250_1583_2149	188
602	3300048919	Ga0496116_0066533	Ga0496116_0066533_57_623	188
603	3300048920	Ga0496117_0001185	Ga0496117_0001185_18846_19412	188
604	3300048920	Ga0496117_0002212	Ga0496117_0002212_4200_4766	188
605	3300048920	Ga0496117_0006143	Ga0496117_0006143_2760_3326	188
606	3300048920	Ga0496117_0069680	Ga0496117_0069680_290_856	188
607	3300048920	Ga0496117_0069728	Ga0496117_0069728_289_855	188
608	3300048920	Ga0496117_0336738	Ga0496117_0336738_185_751	188
609	3300048921	Ga0496118_0007651	Ga0496118_0007651_2853_3419	188
610	3300048921	Ga0496118_0034162	Ga0496118_0034162_2769_3335	188
611	3300048921	Ga0496118_0049484	Ga0496118_0049484_849_1415	188
612	3300048921	Ga0496118_0080179	Ga0496118_0080179_359_925	188
613	3300048922	Ga0496119_0005255	Ga0496119_0005255_4249_4815	188
614	3300048922	Ga0496119_0008650	Ga0496119_0008650_5542_6108	188
615	3300048922	Ga0496119_0030167	Ga0496119_0030167_2770_3336	188
616	3300048922	Ga0496119_0313594	Ga0496119_0313594_192_758	188
617	3300048923	Ga0496120_0004557	Ga0496120_0004557_2800_3366	188
618	3300048923	Ga0496120_0005672	Ga0496120_0005672_6497_7063	188
619	3300048923	Ga0496120_0007167	Ga0496120_0007167_945_1511	188
620	3300048923	Ga0496120_0023349	Ga0496120_0023349_479_1045	188
621	3300048923	Ga0496120_0085454	Ga0496120_0085454_763_1329	188
622	3300048923	Ga0496120_0280930	Ga0496120_0280930_12_578	188
623	3300048924	Ga0496121_0010375	Ga0496121_0010375_523_1089	188
624	3300048924	Ga0496121_0010647	Ga0496121_0010647_6687_7253	188
625	3300048924	Ga0496121_0026479	Ga0496121_0026479_3815_4381	188
626	3300048924	Ga0496121_0027279	Ga0496121_0027279_4539_5105	188
627	3300048924	Ga0496121_0046683	Ga0496121_0046683_290_856	188
628	3300048924	Ga0496121_0092164	Ga0496121_0092164_1592_2158	188
629	3300048924	Ga0496121_0188389	Ga0496121_0188389_205_771	188
630	3300048924	Ga0496121_0422692	Ga0496121_0422692_289_855	188
631	3300048925	Ga0496122_0000340	Ga0496122_0000340_56224_56790	188
632	3300048925	Ga0496122_0000645	Ga0496122_0000645_29237_29803	188
633	3300048925	Ga0496122_0020269	Ga0496122_0020269_937_1503	188
634	3300048925	Ga0496122_0022909	Ga0496122_0022909_4675_5241	188
635	3300048925	Ga0496122_0024600	Ga0496122_0024600_23_589	188
636	3300048925	Ga0496122_0268829	Ga0496122_0268829_298_864	188
637	3300048925	Ga0496122_0294200	Ga0496122_0294200_11_577	188
638	3300048925	Ga0496122_0489096	Ga0496122_0489096_12_578	188
639	3300048926	Ga0496123_0000005	Ga0496123_0000005_56104_56670	188
640	3300048926	Ga0496123_0000469	Ga0496123_0000469_40953_41519	188
641	3300048926	Ga0496123_0009714	Ga0496123_0009714_8030_8596	188
642	3300048926	Ga0496123_0011753	Ga0496123_0011753_6801_7367	188
643	3300048926	Ga0496123_0090324	Ga0496123_0090324_164_730	188
644	3300048926	Ga0496123_0422514	Ga0496123_0422514_23_589	188
645	3300048927	Ga0496124_0008744	Ga0496124_0008744_3074_3640	188
646	3300048927	Ga0496124_0096073	Ga0496124_0096073_331_897	188
647	3300048927	Ga0496124_0218162	Ga0496124_0218162_623_1189	188
648	3300048927	Ga0496124_0484863	Ga0496124_0484863_69_635	188
649	3300048928	Ga0496125_0007368	Ga0496125_0007368_6856_7422	188
650	3300048928	Ga0496125_0016182	Ga0496125_0016182_3805_4371	188
651	3300048928	Ga0496125_0028168	Ga0496125_0028168_3999_4565	188
652	3300048929	Ga0496126_0000650	Ga0496126_0000650_41055_41621	188
653	3300048929	Ga0496126_0001503	Ga0496126_0001503_22250_22816	188
654	3300048929	Ga0496126_0051047	Ga0496126_0051047_1870_2436	188
655	3300048929	Ga0496126_0168199	Ga0496126_0168199_1098_1664	188
656	3300048929	Ga0496126_0345754	Ga0496126_0345754_26_592	188
657	3300050491	nmdc:mga00v17_1412_c1	nmdc:mga00v17_1412_c1_4458_5024	188
658	3300050491	nmdc:mga00v17_4676_c1	nmdc:mga00v17_4676_c1_4002_4568	188
659	3300050493	nmdc:mga0k408_3619_c1	nmdc:mga0k408_3619_c1_655_1221	188

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03886

ABC_trans_aux

ABC-type transport auxiliary lipoprotein component

36

189

0.93 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
8q2d-assembly1.cif.gz_A	crystal structure of the e. coli pqic lipoprotein residues 17-187	0.907	23	188
6osx-assembly1.cif.gz_A	crystal structure of uncharacterized protein ecl_02694	0.8971	21	185
8q2d-assembly1.cif.gz_A	crystal structure of the e. coli pqic lipoprotein residues 17-187	0.8955	23	188
6osx-assembly1.cif.gz_A	crystal structure of uncharacterized protein ecl_02694	0.8914	21	185
8q2c-assembly1.cif.gz_B	crystal structure of the e. coli pqic lipoprotein	0.8895	24	188

ID	Description	Score	Start	End	Superfamily
af_P0AB10_20_185_3.40.50.10610	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;ABC-type transport auxiliary lipoprotein component	0.8754	23	186	3.40.50.10610
af_P0AB10_20_185_3.40.50.10610	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;ABC-type transport auxiliary lipoprotein component	0.8552	23	186	3.40.50.10610
af_I1M6D4_109_209_2.60.40.10	Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins	0.8191	131	155	2.60.40.10
af_A4IAG8_722_830_2.60.40.1230	Mainly Beta;Sandwich;Immunoglobulin-like;Gamma-adaptin ear (GAE) domain	0.7906	131	155	2.60.40.1230
af_A0A1D8PCX6_473_583_2.60.40.1230	Mainly Beta;Sandwich;Immunoglobulin-like;Gamma-adaptin ear (GAE) domain	0.7611	131	155	2.60.40.1230

ID	Description	Score	Start	End
AF-A0A2T4MMC9-F1-model_v4	deleted	1	94	188
AF-A0A2X1JGE6-F1-model_v4	Putative lipoprotein	0.999	81	188
AF-A0A2T4MMC9-F1-model_v4	deleted	0.9898	94	188
AF-A0A376KXF5-F1-model_v4	Putative lipoprotein	0.9879	106	188
AF-A0A255MWI2-F1-model_v4	deleted	0.9809	111	185

Feature Viewer

pLDDT	pTM	Quality
78.4	0.74	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F473236

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF03886

ABC_trans_aux

ABC-type transport auxiliary lipoprotein component

36

189

0.93

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map