F473054

General Info

Members Datasets Scaffolds Average Seq Length
656 225 1312 185

Family's Representative Sequence

Representative Sequence 3300049824|Ga0501045_0763748|Ga0501045_0763748_122_643
Length 173
Sequence MISATQMRPGMVIKFNNELHSVFTVNHRTPGNLRGFVQAKLRNLRSGSMFEHRFSSEDRVERAILEEHEMEYLYDDGEYYYFMNTETYDQMHLTKDLKVQVEFYEGKPISVELPPTVDMTVVETEPGLRGATVSNVTKPAKMETGLVVQVPPFIEQGEKIRVNTTEGTYQERA

Samples

Sample ID Description Type Environment
1 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
20 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
21 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
22 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
23 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
24 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
29 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
37 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
38 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
43 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
44 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
45 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
46 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
47 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
48 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
49 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
50 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
51 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
53 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
54 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
55 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
57 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
59 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
60 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
61 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
62 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
63 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
64 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
65 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
66 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
67 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
68 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
69 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
70 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
71 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
72 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
73 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
74 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
75 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
76 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
77 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
78 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
79 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
80 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
81 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
82 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
83 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
84 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
85 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
134 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
135 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
136 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
137 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
138 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
139 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
140 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
141 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
142 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
143 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
144 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
145 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
146 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
147 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
148 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
149 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
150 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
151 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
152 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
153 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
154 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
155 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
156 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
157 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
158 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
159 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
160 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
161 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
162 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
163 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
164 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
165 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
166 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
167 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
168 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
169 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
170 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
171 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
172 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
173 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
174 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
175 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
176 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
177 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
178 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
179 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
180 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
181 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
182 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
183 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
184 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
185 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
186 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
187 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
188 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
189 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
190 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
191 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
192 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
193 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
194 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
195 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
196 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
197 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
198 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
199 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
200 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
201 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
202 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
203 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
204 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
205 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
206 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
207 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
208 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
209 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
210 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
211 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
212 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
213 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
214 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
215 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
216 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
217 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
218 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
219 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
220 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
221 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
222 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
223 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
224 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
225 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.85
Metatranscriptomes 0.15
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.15
Nodule 0
Rhizoplane 0.15
Rhizosphere 93.45
Stem 0
Stem Tuber 0
Unclassified 16.77

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501045_0763748 3300049824 Bacteria 712
2 Ga0070658_10019232 3300005327 Bacteria 5470
3 Ga0070658_10209622 3300005327 Bacteria 1646
4 Ga0070658_10234701 3300005327 Bacteria 1554
5 Ga0070683_100000278 3300005329 Bacteria 35197
6 Ga0070683_100015819 3300005329 Bacteria 6634
7 Ga0070683_100045282 3300005329 Bacteria 4060
8 Ga0070683_100083285 3300005329 Unclassified 2996
9 Ga0070683_100163025 3300005329 Bacteria 2115
10 Ga0070683_100180147 3300005329 Bacteria 2005
11 Ga0070683_100233378 3300005329 Bacteria 1749
12 Ga0068869_100006789 3300005334 Bacteria 7276
13 Ga0068869_100185793 3300005334 Bacteria 1631
14 Ga0068869_100218006 3300005334 Bacteria 1511
15 Ga0070666_10010132 3300005335 Bacteria 5887
16 Ga0070680_100064791 3300005336 Bacteria 2995
17 Ga0070682_100406358 3300005337 Unclassified 1031
18 Ga0068868_100034420 3300005338 Bacteria 3911
19 Ga0068868_100036740 3300005338 Bacteria 3794
20 Ga0068868_100153823 3300005338 Bacteria 1896
21 Ga0070660_100027202 3300005339 Bacteria 4266
22 Ga0070660_100078704 3300005339 Bacteria 2585
23 Ga0070660_100249214 3300005339 Bacteria 1448
24 Ga0070660_100549793 3300005339 Bacteria 963
25 Ga0070689_100487459 3300005340 Unclassified 1054
26 Ga0070689_100782638 3300005340 Bacteria 838
27 Ga0070691_10003839 3300005341 Bacteria 6787
28 Ga0070661_100096999 3300005344 Unclassified 2188
29 Ga0070661_100713668 3300005344 Unclassified 818
30 Ga0070675_100651746 3300005354 Bacteria 957
31 Ga0070671_101009349 3300005355 Unclassified 729
32 Ga0070674_100487694 3300005356 Bacteria 1024
33 Ga0070674_100871321 3300005356 Unclassified 782
34 Ga0070673_100488116 3300005364 Bacteria 1113
35 Ga0070673_101299615 3300005364 Bacteria 683
36 Ga0070673_101438984 3300005364 Unclassified 649
37 Ga0070659_100180143 3300005366 Bacteria 1734
38 Ga0070667_100170677 3300005367 Bacteria 1920
39 Ga0070709_10415885 3300005434 Unclassified 1007
40 Ga0070714_100010222 3300005435 Bacteria 7408
41 Ga0070714_100333090 3300005435 Bacteria 1422
42 Ga0070714_100732497 3300005435 Bacteria 955
43 Ga0070713_100006806 3300005436 Bacteria 7965
44 Ga0070713_100150718 3300005436 Bacteria 2068
45 Ga0070713_101408462 3300005436 Unclassified 676
46 Ga0070710_10510649 3300005437 Unclassified 824
47 Ga0070711_100025199 3300005439 Unclassified 3888
48 Ga0070711_100364551 3300005439 Bacteria 1164
49 Ga0070711_100791574 3300005439 Bacteria 804
50 Ga0070705_100392682 3300005440 Unclassified 1025
51 Ga0070678_100304220 3300005456 Unclassified 1356
52 Ga0070678_100424436 3300005456 Bacteria 1160
53 Ga0070681_10002773 3300005458 Bacteria 16173
54 Ga0070681_10018505 3300005458 Bacteria 6963
55 Ga0070681_10019180 3300005458 Bacteria 6844
56 Ga0070681_10205108 3300005458 Bacteria 1889
57 Ga0070681_11283152 3300005458 Unclassified 655
58 Ga0068867_100252079 3300005459 Bacteria 1436
59 Ga0068867_100714497 3300005459 Unclassified 886
60 Ga0068867_100729548 3300005459 Bacteria 877
61 Ga0070706_100959556 3300005467 Bacteria 789
62 Ga0070698_100377405 3300005471 Bacteria 1350
63 Ga0070679_100002506 3300005530 Bacteria 16635
64 Ga0070679_100049733 3300005530 Bacteria 4176
65 Ga0070679_100097369 3300005530 Bacteria 2930
66 Ga0070679_100266040 3300005530 Bacteria 1669
67 Ga0070679_100381796 3300005530 Bacteria 1355
68 Ga0070684_100000138 3300005535 Bacteria 48577
69 Ga0070684_100104585 3300005535 Bacteria 2533
70 Ga0070684_100306546 3300005535 Unclassified 1458
71 Ga0070684_100324806 3300005535 Bacteria 1414
72 Ga0070684_100728058 3300005535 Unclassified 925
73 Ga0068853_100963360 3300005539 Unclassified 821
74 Ga0070693_100685744 3300005547 Bacteria 749
75 Ga0070665_100022494 3300005548 Bacteria 6345
76 Ga0070665_100098035 3300005548 Bacteria 2936
77 Ga0068855_100002278 3300005563 Bacteria 23709
78 Ga0068855_100030866 3300005563 Bacteria 6406
79 Ga0068855_100040478 3300005563 Bacteria 5531
80 Ga0068855_100086065 3300005563 Bacteria 3635
81 Ga0068855_100097951 3300005563 Bacteria 3378
82 Ga0068855_100478216 3300005563 Bacteria 1356
83 Ga0070664_100044730 3300005564 Bacteria 3738
84 Ga0068857_100000140 3300005577 Bacteria 44560
85 Ga0068857_100007226 3300005577 Bacteria 9564
86 Ga0068857_100008815 3300005577 Bacteria 8736
87 Ga0068857_100040887 3300005577 Bacteria 4110
88 Ga0068857_100417678 3300005577 Bacteria 1250
89 Ga0068857_101344843 3300005577 Bacteria 694
90 Ga0068857_101429473 3300005577 Bacteria 673
91 Ga0068854_100408484 3300005578 Unclassified 1125
92 Ga0068856_100001686 3300005614 Bacteria 23098
93 Ga0068856_100014834 3300005614 Bacteria 7521
94 Ga0068856_100679026 3300005614 Bacteria 1050
95 Ga0068856_100849461 3300005614 Bacteria 932
96 Ga0068856_100886461 3300005614 Unclassified 911
97 Ga0068852_100004181 3300005616 Bacteria 10172
98 Ga0068852_100214339 3300005616 Bacteria 1828
99 Ga0068852_101130321 3300005616 Bacteria 804
100 Ga0068852_101279559 3300005616 Bacteria 755
101 Ga0068859_100053529 3300005617 Bacteria 4059
102 Ga0068859_100371122 3300005617 Bacteria 1526
103 Ga0068859_100753401 3300005617 Bacteria 1063
104 Ga0068864_100004251 3300005618 Bacteria 11784
105 Ga0068864_100674680 3300005618 Bacteria 1008
106 Ga0068866_10108251 3300005718 Unclassified 1546
107 Ga0068866_10341699 3300005718 Bacteria 948
108 Ga0068861_101111692 3300005719 Bacteria 760
109 Ga0068863_100116175 3300005841 Bacteria 2550
110 Ga0068858_100004396 3300005842 Bacteria 13831
111 Ga0068858_100049459 3300005842 Bacteria 3894
112 Ga0068858_100302887 3300005842 Bacteria 1525
113 Ga0068858_100353462 3300005842 Unclassified 1408
114 Ga0068858_101040831 3300005842 Bacteria 803
115 Ga0068860_100011406 3300005843 Bacteria 8756
116 Ga0068860_100594866 3300005843 Bacteria 1111
117 Ga0068860_100685587 3300005843 Bacteria 1034
118 Ga0068860_100725154 3300005843 Bacteria 1005
119 Ga0068860_100947472 3300005843 Bacteria 878
120 Ga0068860_100950281 3300005843 Bacteria 877
121 Ga0068862_100728645 3300005844 Bacteria 963
122 Ga0070717_10049660 3300006028 Bacteria 3444
123 Ga0070716_100260343 3300006173 Bacteria 1187
124 Ga0097621_100012046 3300006237 Bacteria 6399
125 Ga0097621_100020172 3300006237 Bacteria 5134
126 Ga0097621_100044835 3300006237 Bacteria 3569
127 Ga0097621_100053827 3300006237 Bacteria 3280
128 Ga0097621_100058583 3300006237 Bacteria 3151
129 Ga0097621_100366958 3300006237 Unclassified 1284
130 Ga0097621_101193047 3300006237 Bacteria 717
131 Ga0097621_101263008 3300006237 Bacteria 697
132 Ga0068871_100025469 3300006358 Bacteria 4603
133 Ga0068871_100079643 3300006358 Bacteria 2711
134 Ga0068871_100080030 3300006358 Bacteria 2704
135 Ga0068871_100413733 3300006358 Bacteria 1203
136 Ga0068871_100563807 3300006358 Unclassified 1033
137 Ga0068871_100849774 3300006358 Bacteria 844
138 Ga0075430_100400254 3300006846 Unclassified 1133
139 Ga0075430_100593764 3300006846 Unclassified 913
140 Ga0068865_100020429 3300006881 Bacteria 4294
141 Ga0068865_100052880 3300006881 Unclassified 2816
142 Ga0068865_100206381 3300006881 Unclassified 1528
143 Ga0097620_100053527 3300006931 Bacteria 4059
144 Ga0097620_100371088 3300006931 Bacteria 1526
145 Ga0097620_100753369 3300006931 Bacteria 1063
146 Ga0105240_10002280 3300009093 Bacteria 31085
147 Ga0105240_10007712 3300009093 Bacteria 15573
148 Ga0105240_10039160 3300009093 Bacteria 6073
149 Ga0105240_10052533 3300009093 Bacteria 5122
150 Ga0105240_10126302 3300009093 Bacteria 3073
151 Ga0105240_10182348 3300009093 Bacteria 2476
152 Ga0105240_10323171 3300009093 Bacteria 1758
153 Ga0105240_10440068 3300009093 Bacteria 1461
154 Ga0105240_10506894 3300009093 Unclassified 1341
155 Ga0105240_10596166 3300009093 Bacteria 1217
156 Ga0111539_10341320 3300009094 Bacteria 1743
157 Ga0105245_10005517 3300009098 Bacteria 11112
158 Ga0105245_10005868 3300009098 Bacteria 10786
159 Ga0105245_10008601 3300009098 Bacteria 8905
160 Ga0105245_10009750 3300009098 Bacteria 8368
161 Ga0105245_10015634 3300009098 Bacteria 6619
162 Ga0105245_10029145 3300009098 Bacteria 4874
163 Ga0105245_10075087 3300009098 Bacteria 3077
164 Ga0105245_10143475 3300009098 Bacteria 2251
165 Ga0105245_10335468 3300009098 Bacteria 1494
166 Ga0105245_10989057 3300009098 Bacteria 885
167 Ga0105245_11345837 3300009098 Unclassified 763
168 Ga0105247_10052864 3300009101 Bacteria 2505
169 Ga0105243_10127810 3300009148 Bacteria 2152
170 Ga0105243_10138974 3300009148 Bacteria 2070
171 Ga0105241_10001620 3300009174 Bacteria 17161
172 Ga0105241_10014230 3300009174 Bacteria 5829
173 Ga0105241_10049187 3300009174 Unclassified 3210
174 Ga0105241_10067430 3300009174 Bacteria 2770
175 Ga0105241_10097700 3300009174 Bacteria 2329
176 Ga0105241_10277286 3300009174 Bacteria 1430
177 Ga0105241_10618767 3300009174 Bacteria 980
178 Ga0105241_11483022 3300009174 Bacteria 652
179 Ga0105242_10006026 3300009176 Bacteria 9348
180 Ga0105242_10017449 3300009176 Bacteria 5595
181 Ga0105242_10037171 3300009176 Bacteria 3911
182 Ga0105242_10223676 3300009176 Bacteria 1683
183 Ga0105242_10269712 3300009176 Bacteria 1541
184 Ga0105242_10334767 3300009176 Bacteria 1393
185 Ga0105242_11003829 3300009176 Viruses 842
186 Ga0105242_11224528 3300009176 Bacteria 771
187 Ga0105242_11394594 3300009176 Bacteria 728
188 Ga0105248_10067630 3300009177 Bacteria 4011
189 Ga0105248_10089491 3300009177 Unclassified 3465
190 Ga0105248_10120776 3300009177 Unclassified 2956
191 Ga0105248_10125226 3300009177 Bacteria 2899
192 Ga0105248_10309269 3300009177 Bacteria 1780
193 Ga0105248_10748069 3300009177 Bacteria 1103
194 Ga0105248_10872523 3300009177 Bacteria 1016
195 Ga0105248_11007602 3300009177 Unclassified 941
196 Ga0105237_10005244 3300009545 Bacteria 14666
197 Ga0105237_10010699 3300009545 Bacteria 9737
198 Ga0105237_10015449 3300009545 Bacteria 7945
199 Ga0105237_10019301 3300009545 Bacteria 7042
200 Ga0105237_10037113 3300009545 Unclassified 4927
201 Ga0105237_10127854 3300009545 Bacteria 2535
202 Ga0105237_10253816 3300009545 Bacteria 1761
203 Ga0105237_10444970 3300009545 Bacteria 1302
204 Ga0105237_10471621 3300009545 Bacteria 1261
205 Ga0105237_10506706 3300009545 Bacteria 1214
206 Ga0105237_11227791 3300009545 Bacteria 756
207 Ga0105238_10002113 3300009551 Bacteria 20072
208 Ga0105238_10007908 3300009551 Bacteria 10640
209 Ga0105238_10017459 3300009551 Bacteria 7293
210 Ga0105238_10030547 3300009551 Bacteria 5485
211 Ga0105238_10250719 3300009551 Bacteria 1749
212 Ga0105238_10432100 3300009551 Unclassified 1312
213 Ga0105238_10438739 3300009551 Unclassified 1302
214 Ga0105238_10462330 3300009551 Bacteria 1267
215 Ga0105238_10478489 3300009551 Unclassified 1244
216 Ga0105238_11143358 3300009551 Bacteria 802
217 Ga0105249_10012853 3300009553 Bacteria 7388
218 Ga0105239_10003681 3300010375 Bacteria 18699
219 Ga0105239_10003955 3300010375 Bacteria 17955
220 Ga0105239_10029098 3300010375 Bacteria 6073
221 Ga0105239_10045818 3300010375 Bacteria 4792
222 Ga0105239_10092099 3300010375 Bacteria 3345
223 Ga0105239_10136629 3300010375 Bacteria 2729
224 Ga0105239_10198299 3300010375 Bacteria 2248
225 Ga0105246_10002405 3300011119 Bacteria 11293
226 Ga0105246_10038420 3300011119 Bacteria 3219
227 Ga0105246_10070520 3300011119 Unclassified 2458
228 Ga0105246_10596189 3300011119 Bacteria 954
229 Ga0105246_10606900 3300011119 Bacteria 946
230 Ga0105246_10866867 3300011119 Unclassified 807
231 Ga0157373_10081876 3300013100 Bacteria 2275
232 Ga0157371_10123597 3300013102 Bacteria 1840
233 Ga0157370_10004304 3300013104 Bacteria 16362
234 Ga0157370_10007083 3300013104 Bacteria 12245
235 Ga0157370_10016052 3300013104 Bacteria 7591
236 Ga0157370_10075863 3300013104 Bacteria 3168
237 Ga0157370_10297894 3300013104 Bacteria 1489
238 Ga0157370_10358206 3300013104 Bacteria 1344
239 Ga0157370_10614575 3300013104 Unclassified 994
240 Ga0157369_10031267 3300013105 Bacteria 5863
241 Ga0157369_10077525 3300013105 Bacteria 3562
242 Ga0157369_10127523 3300013105 Bacteria 2697
243 Ga0157369_10172715 3300013105 Bacteria 2277
244 Ga0157369_10209440 3300013105 Bacteria 2044
245 Ga0157369_10521624 3300013105 Bacteria 1229
246 Ga0157374_10012188 3300013296 Bacteria 7471
247 Ga0157374_10057606 3300013296 Bacteria 3629
248 Ga0157374_10077168 3300013296 Bacteria 3152
249 Ga0157374_10094758 3300013296 Bacteria 2853
250 Ga0157374_10142864 3300013296 Bacteria 2324
251 Ga0157374_10430474 3300013296 Bacteria 1319
252 Ga0157374_10545372 3300013296 Bacteria 1167
253 Ga0157378_10036503 3300013297 Bacteria 4349
254 Ga0157378_10073427 3300013297 Bacteria 3075
255 Ga0157378_10258687 3300013297 Bacteria 1669
256 Ga0163162_10003509 3300013306 Bacteria 14999
257 Ga0163162_10146609 3300013306 Bacteria 2477
258 Ga0163162_10261402 3300013306 Bacteria 1863
259 Ga0163162_11988217 3300013306 Bacteria 666
260 Ga0157372_10030783 3300013307 Bacteria 5872
261 Ga0157372_10041726 3300013307 Bacteria 5072
262 Ga0157372_10105526 3300013307 Bacteria 3222
263 Ga0157372_10234490 3300013307 Bacteria 2128
264 Ga0157372_10937050 3300013307 Unclassified 1004
265 Ga0157372_11450454 3300013307 Bacteria 791
266 Ga0157375_10003703 3300013308 Bacteria 13272
267 Ga0157375_10006895 3300013308 Bacteria 9911
268 Ga0157375_10427047 3300013308 Bacteria 1491
269 Ga0157375_11329969 3300013308 Bacteria 845
270 Ga0163163_10026318 3300014325 Bacteria 5559
271 Ga0163163_10056323 3300014325 Bacteria 3886
272 Ga0163163_10163890 3300014325 Bacteria 2269
273 Ga0163163_10977739 3300014325 Bacteria 910
274 Ga0163163_11089996 3300014325 Bacteria 862
275 Ga0163163_11509842 3300014325 Bacteria 733
276 Ga0163163_11773689 3300014325 Unclassified 678
277 Ga0157380_10109209 3300014326 Unclassified 2320
278 Ga0157380_10364274 3300014326 Bacteria 1358
279 Ga0157379_10144837 3300014968 Unclassified 2142
280 Ga0157379_10679043 3300014968 Viruses 966
281 Ga0157376_10025975 3300014969 Bacteria 4621
282 Ga0157376_10070264 3300014969 Bacteria 2971
283 Ga0157376_10254741 3300014969 Bacteria 1641
284 Ga0157376_10373167 3300014969 Bacteria 1372
285 Ga0157376_10657391 3300014969 Bacteria 1049
286 Ga0206352_10631068 3300020078 Bacteria 1902
287 Ga0213876_10086249 3300021384 Bacteria 1661
288 Ga0213876_10086813 3300021384 Bacteria 1656
289 Ga0213875_10000008 3300021388 Bacteria 533344
290 Ga0213875_10000041 3300021388 Bacteria 155792
291 Ga0213875_10024846 3300021388 Bacteria 2856
292 Ga0213875_10035813 3300021388 Bacteria 2341
293 Ga0213875_10043502 3300021388 Bacteria 2109
294 Ga0213875_10071898 3300021388 Bacteria 1615
295 Ga0213875_10272147 3300021388 Unclassified 800
296 Ga0207642_10160131 3300025899 Bacteria 1208
297 Ga0207710_10013625 3300025900 Bacteria 3420
298 Ga0207699_10098778 3300025906 Bacteria 1848
299 Ga0207705_10049885 3300025909 Bacteria 3012
300 Ga0207705_10110444 3300025909 Bacteria 2031
301 Ga0207684_10909427 3300025910 Bacteria 739
302 Ga0207654_10015679 3300025911 Bacteria 3937
303 Ga0207654_10029448 3300025911 Bacteria 3006
304 Ga0207654_10051847 3300025911 Unclassified 2363
305 Ga0207654_10059599 3300025911 Bacteria 2227
306 Ga0207654_10069232 3300025911 Bacteria 2090
307 Ga0207654_11016631 3300025911 Bacteria 603
308 Ga0207707_10000567 3300025912 Bacteria 37470
309 Ga0207707_10003023 3300025912 Bacteria 14950
310 Ga0207707_10107097 3300025912 Bacteria 2444
311 Ga0207707_10297982 3300025912 Bacteria 1395
312 Ga0207695_10006097 3300025913 Bacteria 15729
313 Ga0207695_10009255 3300025913 Bacteria 12203
314 Ga0207695_10025208 3300025913 Bacteria 6664
315 Ga0207695_10037784 3300025913 Bacteria 5207
316 Ga0207695_10041235 3300025913 Bacteria 4942
317 Ga0207695_10100162 3300025913 Unclassified 2894
318 Ga0207695_10125800 3300025913 Bacteria 2526
319 Ga0207695_10152345 3300025913 Bacteria 2250
320 Ga0207671_10017205 3300025914 Bacteria 5585
321 Ga0207671_10030055 3300025914 Bacteria 4053
322 Ga0207671_10036791 3300025914 Unclassified 3630
323 Ga0207671_10075050 3300025914 Bacteria 2528
324 Ga0207671_10087994 3300025914 Bacteria 2336
325 Ga0207663_10073219 3300025916 Bacteria 2216
326 Ga0207663_10438495 3300025916 Bacteria 1005
327 Ga0207660_10006212 3300025917 Bacteria 7758
328 Ga0207660_10017094 3300025917 Bacteria 4814
329 Ga0207657_10002375 3300025919 Bacteria 20365
330 Ga0207657_10341117 3300025919 Bacteria 1182
331 Ga0207657_10474481 3300025919 Bacteria 981
332 Ga0207649_10016556 3300025920 Bacteria 4161
333 Ga0207649_10072405 3300025920 Unclassified 2205
334 Ga0207649_10955202 3300025920 Unclassified 673
335 Ga0207652_10019567 3300025921 Bacteria 5569
336 Ga0207652_10020122 3300025921 Bacteria 5496
337 Ga0207652_10293763 3300025921 Bacteria 1466
338 Ga0207652_10375205 3300025921 Bacteria 1284
339 Ga0207652_10443468 3300025921 Bacteria 1170
340 Ga0207694_10000348 3300025924 Bacteria 43729
341 Ga0207694_10001587 3300025924 Bacteria 19229
342 Ga0207694_10022059 3300025924 Bacteria 4829
343 Ga0207694_10024978 3300025924 Unclassified 4540
344 Ga0207694_10029852 3300025924 Bacteria 4162
345 Ga0207694_10057973 3300025924 Bacteria 3012
346 Ga0207694_10117512 3300025924 Bacteria 2120
347 Ga0207694_10234608 3300025924 Bacteria 1499
348 Ga0207694_10567913 3300025924 Unclassified 953
349 Ga0207694_10648042 3300025924 Bacteria 890
350 Ga0207659_10909957 3300025926 Bacteria 756
351 Ga0207687_10001112 3300025927 Bacteria 18273
352 Ga0207687_10006068 3300025927 Bacteria 7996
353 Ga0207687_10006976 3300025927 Bacteria 7441
354 Ga0207687_10007394 3300025927 Bacteria 7230
355 Ga0207687_10010718 3300025927 Bacteria 5987
356 Ga0207687_10089578 3300025927 Unclassified 2240
357 Ga0207687_10742500 3300025927 Bacteria 835
358 Ga0207687_10826710 3300025927 Bacteria 791
359 Ga0207700_10120197 3300025928 Bacteria 2129
360 Ga0207700_10122855 3300025928 Bacteria 2108
361 Ga0207700_10602642 3300025928 Bacteria 978
362 Ga0207700_11420854 3300025928 Unclassified 617
363 Ga0207664_10002025 3300025929 Bacteria 13339
364 Ga0207664_10126702 3300025929 Bacteria 2145
365 Ga0207664_10216911 3300025929 Unclassified 1658
366 Ga0207664_10533470 3300025929 Bacteria 1052
367 Ga0207664_10602547 3300025929 Bacteria 987
368 Ga0207644_10124421 3300025931 Bacteria 1967
369 Ga0207644_10899873 3300025931 Bacteria 742
370 Ga0207690_10163968 3300025932 Bacteria 1659
371 Ga0207686_10014694 3300025934 Bacteria 4365
372 Ga0207686_10018741 3300025934 Bacteria 3922
373 Ga0207686_10151034 3300025934 Bacteria 1617
374 Ga0207686_10378860 3300025934 Bacteria 1072
375 Ga0207686_10422806 3300025934 Bacteria 1020
376 Ga0207686_10486420 3300025934 Unclassified 955
377 Ga0207686_10554182 3300025934 Bacteria 899
378 Ga0207686_10882901 3300025934 Viruses 721
379 Ga0207709_10076188 3300025935 Bacteria 2146
380 Ga0207709_10110380 3300025935 Bacteria 1838
381 Ga0207670_10583989 3300025936 Bacteria 916
382 Ga0207704_10148156 3300025938 Bacteria 1652
383 Ga0207704_10302900 3300025938 Unclassified 1225
384 Ga0207691_10317970 3300025940 Bacteria 1335
385 Ga0207711_10000909 3300025941 Bacteria 28471
386 Ga0207711_10041536 3300025941 Bacteria 3917
387 Ga0207711_10090774 3300025941 Unclassified 2686
388 Ga0207711_10227671 3300025941 Bacteria 1707
389 Ga0207711_10433445 3300025941 Bacteria 1223
390 Ga0207711_10638099 3300025941 Bacteria 994
391 Ga0207711_10995046 3300025941 Bacteria 778
392 Ga0207689_10010863 3300025942 Bacteria 7832
393 Ga0207689_10164072 3300025942 Unclassified 1831
394 Ga0207689_10220977 3300025942 Unclassified 1565
395 Ga0207661_10005581 3300025944 Bacteria 8872
396 Ga0207661_10011798 3300025944 Bacteria 6344
397 Ga0207661_10038055 3300025944 Bacteria 3768
398 Ga0207661_10055867 3300025944 Bacteria 3168
399 Ga0207661_10335394 3300025944 Bacteria 1362
400 Ga0207679_10059332 3300025945 Bacteria 2838
401 Ga0207679_10861143 3300025945 Bacteria 828
402 Ga0207667_10000558 3300025949 Bacteria 48930
403 Ga0207667_10002416 3300025949 Bacteria 23398
404 Ga0207667_10004097 3300025949 Bacteria 17908
405 Ga0207667_10015798 3300025949 Bacteria 8557
406 Ga0207667_10021143 3300025949 Bacteria 7216
407 Ga0207667_10094747 3300025949 Bacteria 3082
408 Ga0207667_11184674 3300025949 Unclassified 744
409 Ga0207651_10495626 3300025960 Unclassified 1055
410 Ga0207651_10601287 3300025960 Bacteria 961
411 Ga0207651_11186035 3300025960 Unclassified 685
412 Ga0207712_10014602 3300025961 Bacteria 5057
413 Ga0207712_10329690 3300025961 Unclassified 1262
414 Ga0207640_10272265 3300025981 Bacteria 1325
415 Ga0207640_10436961 3300025981 Bacteria 1075
416 Ga0207640_10692398 3300025981 Unclassified 873
417 Ga0207658_10003899 3300025986 Bacteria 10492
418 Ga0207677_10021264 3300026023 Bacteria 3960
419 Ga0207677_10950400 3300026023 Bacteria 777
420 Ga0207703_10007421 3300026035 Bacteria 8709
421 Ga0207703_10037437 3300026035 Bacteria 3864
422 Ga0207703_10146260 3300026035 Bacteria 2056
423 Ga0207703_10324741 3300026035 Unclassified 1410
424 Ga0207639_10015036 3300026041 Bacteria 5451
425 Ga0207702_10003506 3300026078 Bacteria 14300
426 Ga0207702_10024089 3300026078 Bacteria 5050
427 Ga0207702_10044618 3300026078 Bacteria 3726
428 Ga0207702_10091786 3300026078 Bacteria 2660
429 Ga0207702_10139780 3300026078 Bacteria 2190
430 Ga0207702_10208221 3300026078 Bacteria 1817
431 Ga0207702_10461254 3300026078 Bacteria 1234
432 Ga0207702_10585848 3300026078 Unclassified 1093
433 Ga0207702_11116223 3300026078 Bacteria 782
434 Ga0207641_10021325 3300026088 Bacteria 5326
435 Ga0207641_10256276 3300026088 Bacteria 1636
436 Ga0207648_10019949 3300026089 Bacteria 6049
437 Ga0207648_10026035 3300026089 Bacteria 5202
438 Ga0207648_10384628 3300026089 Unclassified 1269
439 Ga0207648_10441537 3300026089 Bacteria 1184
440 Ga0207676_10007865 3300026095 Bacteria 7582
441 Ga0207676_10243763 3300026095 Bacteria 1614
442 Ga0207674_10000063 3300026116 Bacteria 110904
443 Ga0207674_10023592 3300026116 Bacteria 6587
444 Ga0207674_10045779 3300026116 Bacteria 4497
445 Ga0207674_10058486 3300026116 Bacteria 3904
446 Ga0207674_10086854 3300026116 Bacteria 3122
447 Ga0207674_10188920 3300026116 Bacteria 2010
448 Ga0207674_10731801 3300026116 Bacteria 955
449 Ga0207674_11233365 3300026116 Bacteria 717
450 Ga0207683_11075228 3300026121 Unclassified 746
451 Ga0207683_11083470 3300026121 Unclassified 743
452 Ga0207698_10007972 3300026142 Bacteria 6671
453 Ga0207698_10010343 3300026142 Bacteria 5986
454 Ga0207698_11205399 3300026142 Bacteria 771
455 Ga0268266_10019116 3300028379 Bacteria 5834
456 Ga0268266_10084449 3300028379 Bacteria 2772
457 Ga0268266_10128185 3300028379 Bacteria 2267
458 Ga0268266_10152249 3300028379 Bacteria 2086
459 Ga0268265_10859558 3300028380 Unclassified 888
460 Ga0268264_10003579 3300028381 Bacteria 13380
461 Ga0268264_10144473 3300028381 Unclassified 2125
462 Ga0268264_10644791 3300028381 Bacteria 1048
463 Ga0268264_11360163 3300028381 Unclassified 720
464 Ga0265319_1121509 3300028563 Unclassified 814
465 Ga0265323_10000335 3300028653 Bacteria 26788
466 Ga0265338_10079682 3300028800 Bacteria 2755
467 Ga0265324_10017492 3300029957 Bacteria 2607
468 Ga0265320_10022604 3300031240 Bacteria 3361
469 Ga0265340_10018431 3300031247 Bacteria 3601
470 Ga0265340_10025983 3300031247 Bacteria 2963
471 Ga0265339_10218436 3300031249 Bacteria 933
472 Ga0265331_10108212 3300031250 Bacteria 1276
473 Ga0265331_10154113 3300031250 Bacteria 1043
474 Ga0265331_10277271 3300031250 Bacteria 752
475 Ga0265316_10008502 3300031344 Bacteria 9520
476 Ga0265316_10009688 3300031344 Bacteria 8842
477 Ga0265316_10020598 3300031344 Bacteria 5612
478 Ga0265316_10030157 3300031344 Bacteria 4450
479 Ga0265316_10054150 3300031344 Bacteria 3141
480 Ga0265316_10057613 3300031344 Bacteria 3029
481 Ga0265316_10085710 3300031344 Bacteria 2409
482 Ga0265316_10129244 3300031344 Bacteria 1904
483 Ga0265316_10360615 3300031344 Bacteria 1051
484 Ga0265313_10000978 3300031595 Bacteria 28254
485 Ga0265314_10000576 3300031711 Bacteria 46453
486 Ga0265314_10001907 3300031711 Bacteria 22286
487 Ga0265314_10003842 3300031711 Bacteria 14324
488 Ga0265314_10086154 3300031711 Bacteria 2058
489 Ga0265314_10147920 3300031711 Bacteria 1444
490 Ga0265314_10199651 3300031711 Bacteria 1184
491 Ga0265342_10082501 3300031712 Bacteria 1855
492 Ga0307406_10375223 3300031901 Unclassified 1119
493 Ga0307412_10956458 3300031911 Unclassified 754
494 Ga0373934_0001005 3300035086 Bacteria 10193
495 Ga0373934_0074990 3300035086 Bacteria 1355
496 Ga0373934_0141255 3300035086 Bacteria 985
497 Ga0373923_0120708 3300035111 Bacteria 1171
498 Ga0373923_0156085 3300035111 Bacteria 1039
499 Ga0373936_0178047 3300035113 Bacteria 932
500 Ga0373945_0142853 3300035116 Unclassified 966
501 Ga0373954_0001020 3300035118 Bacteria 11091
502 Ga0373954_0001614 3300035118 Bacteria 9214
503 Ga0373954_0004717 3300035118 Bacteria 5876
504 Ga0373954_0476897 3300035118 Bacteria 618
505 Ga0373956_0008356 3300035119 Bacteria 4189
506 Ga0373955_0047458 3300035172 Bacteria 2325
507 Ga0373955_0314348 3300035172 Bacteria 946
508 Ga0373935_0088262 3300035692 Bacteria 2026
509 Ga0373935_0089319 3300035692 Bacteria 2015
510 Ga0373935_0098959 3300035692 Bacteria 1920
511 Ga0373935_0208362 3300035692 Unclassified 1353
512 Ga0373927_0001788 3300035695 Bacteria 16049
513 Ga0373927_0001822 3300035695 Bacteria 15836
514 Ga0373927_0067238 3300035695 Bacteria 2319
515 Ga0373927_0067891 3300035695 Bacteria 2307
516 Ga0373927_0540825 3300035695 Bacteria 770
517 Ga0373933_0007332 3300035724 Bacteria 6017
518 Ga0373933_0204040 3300035724 Unclassified 1266
519 Ga0373933_0279705 3300035724 Unclassified 1078
520 Ga0373947_0011437 3300035725 Bacteria 5092
521 Ga0373937_0007835 3300036401 Bacteria 9257
522 Ga0373937_0209924 3300036401 Bacteria 1832
523 Ga0373937_0471826 3300036401 Unclassified 1192
524 Ga0373925_0018427 3300037068 Bacteria 5074
525 Ga0373925_0025153 3300037068 Bacteria 4347
526 Ga0373925_0150478 3300037068 Bacteria 1827
527 Ga0373925_0334291 3300037068 Unclassified 1228
528 Ga0395899_0432596 3300037312 Bacteria 865
529 Ga0395900_0304090 3300037418 Bacteria 1580
530 Ga0395900_0337380 3300037418 Unclassified 1484
531 Ga0395898_0433181 3300037466 Bacteria 1253
532 Ga0436364_0149064 3300037853 Bacteria 5091
533 Ga0436364_0228801 3300037853 Bacteria 5627
534 Ga0436364_0266064 3300037853 Bacteria 20337
535 Ga0436364_0338988 3300037853 Bacteria 5377
536 Ga0436364_0422362 3300037853 Bacteria 3844
537 Ga0436364_0467758 3300037853 Bacteria 119174
538 Ga0436364_0480757 3300037853 Unclassified 3263
539 Ga0436364_0516252 3300037853 Unclassified 1847
540 Ga0436364_0754331 3300037853 Bacteria 1712
541 Ga0436364_0793116 3300037853 Bacteria 2783
542 Ga0436364_0965202 3300037853 Bacteria 3980
543 Ga0436364_0984372 3300037853 Bacteria 5266
544 Ga0436364_1026549 3300037853 Bacteria 3812
545 Ga0436364_1246285 3300037853 Unclassified 618
546 Ga0436364_1273586 3300037853 Bacteria 5773
547 Ga0436364_1362428 3300037853 Bacteria 1843
548 Ga0436364_1415525 3300037853 Bacteria 425173
549 Ga0436364_1446145 3300037853 Unclassified 655
550 Ga0436364_1519678 3300037853 Bacteria 1836
551 Ga0395901_0713612 3300038443 Bacteria 999
552 Ga0436365_0073541 3300039437 Bacteria 9857
553 Ga0436365_0116569 3300039437 Unclassified 1580
554 Ga0436365_0304726 3300039437 Bacteria 3154
555 Ga0436365_0305152 3300039437 Unclassified 572
556 Ga0436365_0471360 3300039437 Bacteria 2178
557 Ga0436365_1450328 3300039437 Unclassified 1663
558 Ga0436365_1708186 3300039437 Unclassified 1404
559 Ga0436365_1749208 3300039437 Bacteria 1656
560 Ga0436365_1897682 3300039437 Bacteria 1794
561 Ga0436360_1362467 3300039438 Unclassified 943
562 Ga0436361_1063016 3300039447 Bacteria 16793
563 Ga0436363_0300415 3300039450 Unclassified 788
564 Ga0436363_0390406 3300039450 Unclassified 2222
565 Ga0436363_1144537 3300039450 Bacteria 2010
566 Ga0451577_0355609 3300042876 Bacteria 1329
567 Ga0453683_0444247 3300044673 Bacteria 838
568 Ga0466966_0240629 3300044684 Bacteria 1091
569 Ga0466961_0109855 3300044693 Unclassified 1736
570 Ga0466963_1000255 3300044694 Bacteria 589
571 Ga0451576_0068037 3300045051 Bacteria 3707
572 Ga0451576_0236725 3300045051 Bacteria 1907
573 Ga0451576_1998120 3300045051 Unclassified 597
574 Ga0466958_0451916 3300045836 Bacteria 832
575 Ga0466967_0828197 3300045976 Bacteria 919
576 Ga0466967_1610927 3300045976 Unclassified 647
577 Ga0466967_1673546 3300045976 Bacteria 634
578 Ga0495592_0137697 3300046454 Unclassified 1701
579 Ga0495651_0003894 3300046462 Bacteria 11416
580 Ga0495651_0077838 3300046462 Bacteria 2510
581 Ga0495580_0034282 3300046472 Bacteria 3655
582 Ga0495580_0062147 3300046472 Bacteria 2621
583 Ga0495580_0368718 3300046472 Bacteria 971
584 Ga0495582_0040600 3300046473 Bacteria 2563
585 Ga0495639_0024700 3300046475 Bacteria 2647
586 Ga0495662_0016640 3300046476 Bacteria 3563
587 Ga0495664_0020852 3300046477 Bacteria 3783
588 Ga0495608_0339566 3300046511 Unclassified 926
589 Ga0495628_0056485 3300046516 Bacteria 3089
590 Ga0495628_0202800 3300046516 Bacteria 1494
591 Ga0495630_0040942 3300046517 Bacteria 3461
592 Ga0495630_0267203 3300046517 Bacteria 1307
593 Ga0495652_0060390 3300046529 Bacteria 3204
594 Ga0495652_0145615 3300046529 Bacteria 1857
595 Ga0495652_0501005 3300046529 Bacteria 842
596 Ga0495665_0069917 3300046531 Bacteria 1850
597 Ga0495665_0089857 3300046531 Bacteria 1614
598 Ga0495665_0136234 3300046531 Bacteria 1284
599 Ga0495640_0075208 3300046533 Bacteria 2256
600 Ga0495586_0015040 3300046535 Bacteria 4114
601 Ga0495586_0209139 3300046535 Bacteria 1107
602 Ga0495587_0003332 3300046536 Bacteria 10719
603 Ga0495587_0160924 3300046536 Bacteria 1277
604 Ga0495645_0003677 3300046543 Bacteria 10421
605 Ga0495645_0360256 3300046543 Bacteria 935
606 Ga0495645_0577802 3300046543 Bacteria 694
607 Ga0495667_0004331 3300046559 Bacteria 9578
608 Ga0495634_0092971 3300046642 Bacteria 1956
609 Ga0495635_0494485 3300046663 Bacteria 806
610 Ga0495599_0001189 3300046678 Bacteria 14769
611 Ga0495599_0006941 3300046678 Bacteria 6848
612 Ga0495623_0388330 3300046679 Bacteria 753
613 Ga0495613_0015333 3300046689 Bacteria 5697
614 Ga0495613_0048274 3300046689 Bacteria 3144
615 Ga0495600_0017146 3300046809 Bacteria 4605
616 Ga0495600_0632914 3300046809 Bacteria 648
617 Ga0495674_0050370 3300047319 Bacteria 3675
618 Ga0495674_0065871 3300047319 Bacteria 3145
619 Ga0495674_0667744 3300047319 Bacteria 818
620 Ga0495680_0069069 3300047322 Bacteria 2697
621 Ga0495680_0113239 3300047322 Bacteria 2009
622 Ga0495675_0096554 3300047444 Bacteria 1853
623 Ga0495675_0233489 3300047444 Bacteria 1109
624 Ga0495675_0449276 3300047444 Bacteria 746
625 Ga0495684_0054565 3300047471 Bacteria 3048
626 Ga0495684_0076455 3300047471 Bacteria 2543
627 Ga0495684_0120137 3300047471 Bacteria 1980
628 Ga0495684_0150371 3300047471 Bacteria 1741
629 Ga0495602_0374633 3300048088 Bacteria 1021
630 Ga0496115_0411692 3300048918 Bacteria 1096
631 Ga0496126_0170200 3300048929 Unclassified 1856
632 Ga0501032_0223702 3300049569 Bacteria 1224
633 Ga0501034_0067670 3300049571 Unclassified 3583
634 Ga0501036_0574999 3300049572 Bacteria 936
635 Ga0501037_0022617 3300049573 Unclassified 4649
636 Ga0501038_0068751 3300049574 Unclassified 3011
637 Ga0501043_0046623 3300049579 Unclassified 3409
638 Ga0501046_0196440 3300049580 Bacteria 1502
639 Ga0501047_0011596 3300049581 Bacteria 8341
640 Ga0501047_0026821 3300049581 Bacteria 5546
641 Ga0501048_0074420 3300049582 Unclassified 2397
642 Ga0501070_0004195 3300049586 Bacteria 12401
643 Ga0501073_0187385 3300049589 Bacteria 1432
644 Ga0501239_036430 3300049672 Unclassified 665
645 Ga0501249_004230 3300049679 Bacteria 2913
646 Ga0501035_0020758 3300049822 Bacteria 6036
647 Ga0501035_0057501 3300049822 Bacteria 3468
648 Ga0501044_0004730 3300049823 Bacteria 15214
649 Ga0501044_0010329 3300049823 Bacteria 10138
650 Ga0501044_0017258 3300049823 Bacteria 7743
651 Ga0501044_0037427 3300049823 Bacteria 5072
652 nmdc:mga0qj67_397685_c1 3300050509 Unclassified 1112
653 nmdc:mga0qj67_499599_c1 3300050509 Unclassified 978
654 nmdc:mga06r32_36346_c1 3300050510 Bacteria 4653
655 nmdc:mga08y16_265197_c1 3300050511 Bacteria 1773
656 Ga0500568_0002173 3300053139 Bacteria 11816
657 Ga0501045_0763748
658 Ga0070658_10019232
659 Ga0070658_10209622
660 Ga0070658_10234701
661 Ga0070683_100000278
662 Ga0070683_100015819
663 Ga0070683_100045282
664 Ga0070683_100083285
665 Ga0070683_100163025
666 Ga0070683_100180147
667 Ga0070683_100233378
668 Ga0068869_100006789
669 Ga0068869_100185793
670 Ga0068869_100218006
671 Ga0070666_10010132
672 Ga0070680_100064791
673 Ga0070682_100406358
674 Ga0068868_100034420
675 Ga0068868_100036740
676 Ga0068868_100153823
677 Ga0070660_100027202
678 Ga0070660_100078704
679 Ga0070660_100249214
680 Ga0070660_100549793
681 Ga0070689_100487459
682 Ga0070689_100782638
683 Ga0070691_10003839
684 Ga0070661_100096999
685 Ga0070661_100713668
686 Ga0070675_100651746
687 Ga0070671_101009349
688 Ga0070674_100487694
689 Ga0070674_100871321
690 Ga0070673_100488116
691 Ga0070673_101299615
692 Ga0070673_101438984
693 Ga0070659_100180143
694 Ga0070667_100170677
695 Ga0070709_10415885
696 Ga0070714_100010222
697 Ga0070714_100333090
698 Ga0070714_100732497
699 Ga0070713_100006806
700 Ga0070713_100150718
701 Ga0070713_101408462
702 Ga0070710_10510649
703 Ga0070711_100025199
704 Ga0070711_100364551
705 Ga0070711_100791574
706 Ga0070705_100392682
707 Ga0070678_100304220
708 Ga0070678_100424436
709 Ga0070681_10002773
710 Ga0070681_10018505
711 Ga0070681_10019180
712 Ga0070681_10205108
713 Ga0070681_11283152
714 Ga0068867_100252079
715 Ga0068867_100714497
716 Ga0068867_100729548
717 Ga0070706_100959556
718 Ga0070698_100377405
719 Ga0070679_100002506
720 Ga0070679_100049733
721 Ga0070679_100097369
722 Ga0070679_100266040
723 Ga0070679_100381796
724 Ga0070684_100000138
725 Ga0070684_100104585
726 Ga0070684_100306546
727 Ga0070684_100324806
728 Ga0070684_100728058
729 Ga0068853_100963360
730 Ga0070693_100685744
731 Ga0070665_100022494
732 Ga0070665_100098035
733 Ga0068855_100002278
734 Ga0068855_100030866
735 Ga0068855_100040478
736 Ga0068855_100086065
737 Ga0068855_100097951
738 Ga0068855_100478216
739 Ga0070664_100044730
740 Ga0068857_100000140
741 Ga0068857_100007226
742 Ga0068857_100008815
743 Ga0068857_100040887
744 Ga0068857_100417678
745 Ga0068857_101344843
746 Ga0068857_101429473
747 Ga0068854_100408484
748 Ga0068856_100001686
749 Ga0068856_100014834
750 Ga0068856_100679026
751 Ga0068856_100849461
752 Ga0068856_100886461
753 Ga0068852_100004181
754 Ga0068852_100214339
755 Ga0068852_101130321
756 Ga0068852_101279559
757 Ga0068859_100053529
758 Ga0068859_100371122
759 Ga0068859_100753401
760 Ga0068864_100004251
761 Ga0068864_100674680
762 Ga0068866_10108251
763 Ga0068866_10341699
764 Ga0068861_101111692
765 Ga0068863_100116175
766 Ga0068858_100004396
767 Ga0068858_100049459
768 Ga0068858_100302887
769 Ga0068858_100353462
770 Ga0068858_101040831
771 Ga0068860_100011406
772 Ga0068860_100594866
773 Ga0068860_100685587
774 Ga0068860_100725154
775 Ga0068860_100947472
776 Ga0068860_100950281
777 Ga0068862_100728645
778 Ga0070717_10049660
779 Ga0070716_100260343
780 Ga0097621_100012046
781 Ga0097621_100020172
782 Ga0097621_100044835
783 Ga0097621_100053827
784 Ga0097621_100058583
785 Ga0097621_100366958
786 Ga0097621_101193047
787 Ga0097621_101263008
788 Ga0068871_100025469
789 Ga0068871_100079643
790 Ga0068871_100080030
791 Ga0068871_100413733
792 Ga0068871_100563807
793 Ga0068871_100849774
794 Ga0075430_100400254
795 Ga0075430_100593764
796 Ga0068865_100020429
797 Ga0068865_100052880
798 Ga0068865_100206381
799 Ga0097620_100053527
800 Ga0097620_100371088
801 Ga0097620_100753369
802 Ga0105240_10002280
803 Ga0105240_10007712
804 Ga0105240_10039160
805 Ga0105240_10052533
806 Ga0105240_10126302
807 Ga0105240_10182348
808 Ga0105240_10323171
809 Ga0105240_10440068
810 Ga0105240_10506894
811 Ga0105240_10596166
812 Ga0111539_10341320
813 Ga0105245_10005517
814 Ga0105245_10005868
815 Ga0105245_10008601
816 Ga0105245_10009750
817 Ga0105245_10015634
818 Ga0105245_10029145
819 Ga0105245_10075087
820 Ga0105245_10143475
821 Ga0105245_10335468
822 Ga0105245_10989057
823 Ga0105245_11345837
824 Ga0105247_10052864
825 Ga0105243_10127810
826 Ga0105243_10138974
827 Ga0105241_10001620
828 Ga0105241_10014230
829 Ga0105241_10049187
830 Ga0105241_10067430
831 Ga0105241_10097700
832 Ga0105241_10277286
833 Ga0105241_10618767
834 Ga0105241_11483022
835 Ga0105242_10006026
836 Ga0105242_10017449
837 Ga0105242_10037171
838 Ga0105242_10223676
839 Ga0105242_10269712
840 Ga0105242_10334767
841 Ga0105242_11003829
842 Ga0105242_11224528
843 Ga0105242_11394594
844 Ga0105248_10067630
845 Ga0105248_10089491
846 Ga0105248_10120776
847 Ga0105248_10125226
848 Ga0105248_10309269
849 Ga0105248_10748069
850 Ga0105248_10872523
851 Ga0105248_11007602
852 Ga0105237_10005244
853 Ga0105237_10010699
854 Ga0105237_10015449
855 Ga0105237_10019301
856 Ga0105237_10037113
857 Ga0105237_10127854
858 Ga0105237_10253816
859 Ga0105237_10444970
860 Ga0105237_10471621
861 Ga0105237_10506706
862 Ga0105237_11227791
863 Ga0105238_10002113
864 Ga0105238_10007908
865 Ga0105238_10017459
866 Ga0105238_10030547
867 Ga0105238_10250719
868 Ga0105238_10432100
869 Ga0105238_10438739
870 Ga0105238_10462330
871 Ga0105238_10478489
872 Ga0105238_11143358
873 Ga0105249_10012853
874 Ga0105239_10003681
875 Ga0105239_10003955
876 Ga0105239_10029098
877 Ga0105239_10045818
878 Ga0105239_10092099
879 Ga0105239_10136629
880 Ga0105239_10198299
881 Ga0105246_10002405
882 Ga0105246_10038420
883 Ga0105246_10070520
884 Ga0105246_10596189
885 Ga0105246_10606900
886 Ga0105246_10866867
887 Ga0157373_10081876
888 Ga0157371_10123597
889 Ga0157370_10004304
890 Ga0157370_10007083
891 Ga0157370_10016052
892 Ga0157370_10075863
893 Ga0157370_10297894
894 Ga0157370_10358206
895 Ga0157370_10614575
896 Ga0157369_10031267
897 Ga0157369_10077525
898 Ga0157369_10127523
899 Ga0157369_10172715
900 Ga0157369_10209440
901 Ga0157369_10521624
902 Ga0157374_10012188
903 Ga0157374_10057606
904 Ga0157374_10077168
905 Ga0157374_10094758
906 Ga0157374_10142864
907 Ga0157374_10430474
908 Ga0157374_10545372
909 Ga0157378_10036503
910 Ga0157378_10073427
911 Ga0157378_10258687
912 Ga0163162_10003509
913 Ga0163162_10146609
914 Ga0163162_10261402
915 Ga0163162_11988217
916 Ga0157372_10030783
917 Ga0157372_10041726
918 Ga0157372_10105526
919 Ga0157372_10234490
920 Ga0157372_10937050
921 Ga0157372_11450454
922 Ga0157375_10003703
923 Ga0157375_10006895
924 Ga0157375_10427047
925 Ga0157375_11329969
926 Ga0163163_10026318
927 Ga0163163_10056323
928 Ga0163163_10163890
929 Ga0163163_10977739
930 Ga0163163_11089996
931 Ga0163163_11509842
932 Ga0163163_11773689
933 Ga0157380_10109209
934 Ga0157380_10364274
935 Ga0157379_10144837
936 Ga0157379_10679043
937 Ga0157376_10025975
938 Ga0157376_10070264
939 Ga0157376_10254741
940 Ga0157376_10373167
941 Ga0157376_10657391
942 Ga0206352_10631068
943 Ga0213876_10086249
944 Ga0213876_10086813
945 Ga0213875_10000008
946 Ga0213875_10000041
947 Ga0213875_10024846
948 Ga0213875_10035813
949 Ga0213875_10043502
950 Ga0213875_10071898
951 Ga0213875_10272147
952 Ga0207642_10160131
953 Ga0207710_10013625
954 Ga0207699_10098778
955 Ga0207705_10049885
956 Ga0207705_10110444
957 Ga0207684_10909427
958 Ga0207654_10015679
959 Ga0207654_10029448
960 Ga0207654_10051847
961 Ga0207654_10059599
962 Ga0207654_10069232
963 Ga0207654_11016631
964 Ga0207707_10000567
965 Ga0207707_10003023
966 Ga0207707_10107097
967 Ga0207707_10297982
968 Ga0207695_10006097
969 Ga0207695_10009255
970 Ga0207695_10025208
971 Ga0207695_10037784
972 Ga0207695_10041235
973 Ga0207695_10100162
974 Ga0207695_10125800
975 Ga0207695_10152345
976 Ga0207671_10017205
977 Ga0207671_10030055
978 Ga0207671_10036791
979 Ga0207671_10075050
980 Ga0207671_10087994
981 Ga0207663_10073219
982 Ga0207663_10438495
983 Ga0207660_10006212
984 Ga0207660_10017094
985 Ga0207657_10002375
986 Ga0207657_10341117
987 Ga0207657_10474481
988 Ga0207649_10016556
989 Ga0207649_10072405
990 Ga0207649_10955202
991 Ga0207652_10019567
992 Ga0207652_10020122
993 Ga0207652_10293763
994 Ga0207652_10375205
995 Ga0207652_10443468
996 Ga0207694_10000348
997 Ga0207694_10001587
998 Ga0207694_10022059
999 Ga0207694_10024978
1000 Ga0207694_10029852
1001 Ga0207694_10057973
1002 Ga0207694_10117512
1003 Ga0207694_10234608
1004 Ga0207694_10567913
1005 Ga0207694_10648042
1006 Ga0207659_10909957
1007 Ga0207687_10001112
1008 Ga0207687_10006068
1009 Ga0207687_10006976
1010 Ga0207687_10007394
1011 Ga0207687_10010718
1012 Ga0207687_10089578
1013 Ga0207687_10742500
1014 Ga0207687_10826710
1015 Ga0207700_10120197
1016 Ga0207700_10122855
1017 Ga0207700_10602642
1018 Ga0207700_11420854
1019 Ga0207664_10002025
1020 Ga0207664_10126702
1021 Ga0207664_10216911
1022 Ga0207664_10533470
1023 Ga0207664_10602547
1024 Ga0207644_10124421
1025 Ga0207644_10899873
1026 Ga0207690_10163968
1027 Ga0207686_10014694
1028 Ga0207686_10018741
1029 Ga0207686_10151034
1030 Ga0207686_10378860
1031 Ga0207686_10422806
1032 Ga0207686_10486420
1033 Ga0207686_10554182
1034 Ga0207686_10882901
1035 Ga0207709_10076188
1036 Ga0207709_10110380
1037 Ga0207670_10583989
1038 Ga0207704_10148156
1039 Ga0207704_10302900
1040 Ga0207691_10317970
1041 Ga0207711_10000909
1042 Ga0207711_10041536
1043 Ga0207711_10090774
1044 Ga0207711_10227671
1045 Ga0207711_10433445
1046 Ga0207711_10638099
1047 Ga0207711_10995046
1048 Ga0207689_10010863
1049 Ga0207689_10164072
1050 Ga0207689_10220977
1051 Ga0207661_10005581
1052 Ga0207661_10011798
1053 Ga0207661_10038055
1054 Ga0207661_10055867
1055 Ga0207661_10335394
1056 Ga0207679_10059332
1057 Ga0207679_10861143
1058 Ga0207667_10000558
1059 Ga0207667_10002416
1060 Ga0207667_10004097
1061 Ga0207667_10015798
1062 Ga0207667_10021143
1063 Ga0207667_10094747
1064 Ga0207667_11184674
1065 Ga0207651_10495626
1066 Ga0207651_10601287
1067 Ga0207651_11186035
1068 Ga0207712_10014602
1069 Ga0207712_10329690
1070 Ga0207640_10272265
1071 Ga0207640_10436961
1072 Ga0207640_10692398
1073 Ga0207658_10003899
1074 Ga0207677_10021264
1075 Ga0207677_10950400
1076 Ga0207703_10007421
1077 Ga0207703_10037437
1078 Ga0207703_10146260
1079 Ga0207703_10324741
1080 Ga0207639_10015036
1081 Ga0207702_10003506
1082 Ga0207702_10024089
1083 Ga0207702_10044618
1084 Ga0207702_10091786
1085 Ga0207702_10139780
1086 Ga0207702_10208221
1087 Ga0207702_10461254
1088 Ga0207702_10585848
1089 Ga0207702_11116223
1090 Ga0207641_10021325
1091 Ga0207641_10256276
1092 Ga0207648_10019949
1093 Ga0207648_10026035
1094 Ga0207648_10384628
1095 Ga0207648_10441537
1096 Ga0207676_10007865
1097 Ga0207676_10243763
1098 Ga0207674_10000063
1099 Ga0207674_10023592
1100 Ga0207674_10045779
1101 Ga0207674_10058486
1102 Ga0207674_10086854
1103 Ga0207674_10188920
1104 Ga0207674_10731801
1105 Ga0207674_11233365
1106 Ga0207683_11075228
1107 Ga0207683_11083470
1108 Ga0207698_10007972
1109 Ga0207698_10010343
1110 Ga0207698_11205399
1111 Ga0268266_10019116
1112 Ga0268266_10084449
1113 Ga0268266_10128185
1114 Ga0268266_10152249
1115 Ga0268265_10859558
1116 Ga0268264_10003579
1117 Ga0268264_10144473
1118 Ga0268264_10644791
1119 Ga0268264_11360163
1120 Ga0265319_1121509
1121 Ga0265323_10000335
1122 Ga0265338_10079682
1123 Ga0265324_10017492
1124 Ga0265320_10022604
1125 Ga0265340_10018431
1126 Ga0265340_10025983
1127 Ga0265339_10218436
1128 Ga0265331_10108212
1129 Ga0265331_10154113
1130 Ga0265331_10277271
1131 Ga0265316_10008502
1132 Ga0265316_10009688
1133 Ga0265316_10020598
1134 Ga0265316_10030157
1135 Ga0265316_10054150
1136 Ga0265316_10057613
1137 Ga0265316_10085710
1138 Ga0265316_10129244
1139 Ga0265316_10360615
1140 Ga0265313_10000978
1141 Ga0265314_10000576
1142 Ga0265314_10001907
1143 Ga0265314_10003842
1144 Ga0265314_10086154
1145 Ga0265314_10147920
1146 Ga0265314_10199651
1147 Ga0265342_10082501
1148 Ga0307406_10375223
1149 Ga0307412_10956458
1150 Ga0373934_0001005
1151 Ga0373934_0074990
1152 Ga0373934_0141255
1153 Ga0373923_0120708
1154 Ga0373923_0156085
1155 Ga0373936_0178047
1156 Ga0373945_0142853
1157 Ga0373954_0001020
1158 Ga0373954_0001614
1159 Ga0373954_0004717
1160 Ga0373954_0476897
1161 Ga0373956_0008356
1162 Ga0373955_0047458
1163 Ga0373955_0314348
1164 Ga0373935_0088262
1165 Ga0373935_0089319
1166 Ga0373935_0098959
1167 Ga0373935_0208362
1168 Ga0373927_0001788
1169 Ga0373927_0001822
1170 Ga0373927_0067238
1171 Ga0373927_0067891
1172 Ga0373927_0540825
1173 Ga0373933_0007332
1174 Ga0373933_0204040
1175 Ga0373933_0279705
1176 Ga0373947_0011437
1177 Ga0373937_0007835
1178 Ga0373937_0209924
1179 Ga0373937_0471826
1180 Ga0373925_0018427
1181 Ga0373925_0025153
1182 Ga0373925_0150478
1183 Ga0373925_0334291
1184 Ga0395899_0432596
1185 Ga0395900_0304090
1186 Ga0395900_0337380
1187 Ga0395898_0433181
1188 Ga0436364_0149064
1189 Ga0436364_0228801
1190 Ga0436364_0266064
1191 Ga0436364_0338988
1192 Ga0436364_0422362
1193 Ga0436364_0467758
1194 Ga0436364_0480757
1195 Ga0436364_0516252
1196 Ga0436364_0754331
1197 Ga0436364_0793116
1198 Ga0436364_0965202
1199 Ga0436364_0984372
1200 Ga0436364_1026549
1201 Ga0436364_1246285
1202 Ga0436364_1273586
1203 Ga0436364_1362428
1204 Ga0436364_1415525
1205 Ga0436364_1446145
1206 Ga0436364_1519678
1207 Ga0395901_0713612
1208 Ga0436365_0073541
1209 Ga0436365_0116569
1210 Ga0436365_0304726
1211 Ga0436365_0305152
1212 Ga0436365_0471360
1213 Ga0436365_1450328
1214 Ga0436365_1708186
1215 Ga0436365_1749208
1216 Ga0436365_1897682
1217 Ga0436360_1362467
1218 Ga0436361_1063016
1219 Ga0436363_0300415
1220 Ga0436363_0390406
1221 Ga0436363_1144537
1222 Ga0451577_0355609
1223 Ga0453683_0444247
1224 Ga0466966_0240629
1225 Ga0466961_0109855
1226 Ga0466963_1000255
1227 Ga0451576_0068037
1228 Ga0451576_0236725
1229 Ga0451576_1998120
1230 Ga0466958_0451916
1231 Ga0466967_0828197
1232 Ga0466967_1610927
1233 Ga0466967_1673546
1234 Ga0495592_0137697
1235 Ga0495651_0003894
1236 Ga0495651_0077838
1237 Ga0495580_0034282
1238 Ga0495580_0062147
1239 Ga0495580_0368718
1240 Ga0495582_0040600
1241 Ga0495639_0024700
1242 Ga0495662_0016640
1243 Ga0495664_0020852
1244 Ga0495608_0339566
1245 Ga0495628_0056485
1246 Ga0495628_0202800
1247 Ga0495630_0040942
1248 Ga0495630_0267203
1249 Ga0495652_0060390
1250 Ga0495652_0145615
1251 Ga0495652_0501005
1252 Ga0495665_0069917
1253 Ga0495665_0089857
1254 Ga0495665_0136234
1255 Ga0495640_0075208
1256 Ga0495586_0015040
1257 Ga0495586_0209139
1258 Ga0495587_0003332
1259 Ga0495587_0160924
1260 Ga0495645_0003677
1261 Ga0495645_0360256
1262 Ga0495645_0577802
1263 Ga0495667_0004331
1264 Ga0495634_0092971
1265 Ga0495635_0494485
1266 Ga0495599_0001189
1267 Ga0495599_0006941
1268 Ga0495623_0388330
1269 Ga0495613_0015333
1270 Ga0495613_0048274
1271 Ga0495600_0017146
1272 Ga0495600_0632914
1273 Ga0495674_0050370
1274 Ga0495674_0065871
1275 Ga0495674_0667744
1276 Ga0495680_0069069
1277 Ga0495680_0113239
1278 Ga0495675_0096554
1279 Ga0495675_0233489
1280 Ga0495675_0449276
1281 Ga0495684_0054565
1282 Ga0495684_0076455
1283 Ga0495684_0120137
1284 Ga0495684_0150371
1285 Ga0495602_0374633
1286 Ga0496115_0411692
1287 Ga0496126_0170200
1288 Ga0501032_0223702
1289 Ga0501034_0067670
1290 Ga0501036_0574999
1291 Ga0501037_0022617
1292 Ga0501038_0068751
1293 Ga0501043_0046623
1294 Ga0501046_0196440
1295 Ga0501047_0011596
1296 Ga0501047_0026821
1297 Ga0501048_0074420
1298 Ga0501070_0004195
1299 Ga0501073_0187385
1300 Ga0501239_036430
1301 Ga0501249_004230
1302 Ga0501035_0020758
1303 Ga0501035_0057501
1304 Ga0501044_0004730
1305 Ga0501044_0010329
1306 Ga0501044_0017258
1307 Ga0501044_0037427
1308 nmdc:mga0qj67_397685_c1
1309 nmdc:mga0qj67_499599_c1
1310 nmdc:mga06r32_36346_c1
1311 nmdc:mga08y16_265197_c1
1312 Ga0500568_0002173

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09285

Elong-fact-P_C

Elongation factor P, C-terminal

117

172

0.99

PF08207

EFP_N

Elongation factor P (EF-P) KOW-like domain

3

60

0.98

PF01132

EFP

Elongation factor P (EF-P) OB domain

68

109

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
5j3b-assembly1.cif.gz_A structure of translation elongation factor p from acinetobacter baumannii 0.9188 2 175
3a5z-assembly2.cif.gz_F crystal structure of escherichia coli genx in complex with elongation factor p 0.9069 1 49
6rk3-assembly1.cif.gz_A solution structure of the ribosome elongation factor p (ef-p) from staphylococcus aureus 0.9035 2 175
4v6a-assembly2.cif.gz_CV structure of ef-p bound to the 70s ribosome. 0.9005 2 175
3a5z-assembly2.cif.gz_H crystal structure of escherichia coli genx in complex with elongation factor p 0.8988 2 175
ID Description Score Start End Superfamily
af_Q2FY41_64_126_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9808 54 116 2.40.50.140
af_P9WNM3_64_126_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9743 54 116 2.40.50.140
5j3bA03 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9679 119 175 2.40.50.140
af_Q2FY41_64_126_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9657 54 116 2.40.50.140
af_I1L709_116_178_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9616 54 116 2.40.50.140
ID Description Score Start End GO Terms
AF-A0A2V9VCI0-F1-model_v4 Elongation factor P 0.9678 52 175 GO:0003746
GO:0005737
GO:0043043
AF-A0A7V5CXP3-F1-model_v4 Elongation factor P 0.9636 52 175 GO:0003746
GO:0005737
GO:0043043
AF-Q6MTF7-F1-model_v4 Elongation factor P (EF-P) 0.9624 2 175 GO:0003746
GO:0005737
GO:0043043
AF-A0A1Q7UMD9-F1-model_v4 Elongation factor P 0.9569 1 166 GO:0003746
GO:0005737
GO:0043043
AF-A0A3B8REI7-F1-model_v4 deleted 0.9563 51 175

Map