F472994

General Info

Members Datasets Scaffolds Average Seq Length
656 264 1312 189

Family's Representative Sequence

Representative Sequence 3300005436|Ga0070713_100110859|Ga0070713_1001108592
Length 222
Sequence MFFDVLDNPSALVVTAKCATLNPTQDDSPAGACRMGSTISSLIGAAESGDSAAADTLFSTLYSELHRLAKRELARRGSPASLSVTTLLHEAYLDIASREGNRFPDQPRFMGYAARVMRGLIIDHARSRNAIKRGGEFEITSLKTDADQSPADPKELSAISDALDQLAKVDPKLAALVDMKFFCGFSFAEIAALENLSERTVQRRWEKARIYLHSNIRADLPL

Samples

Sample ID Description Type Environment
1 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
28 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
29 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
30 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
31 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
32 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
38 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
39 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
40 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
41 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
42 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
43 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
44 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
45 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
46 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
47 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
48 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
49 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
50 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
51 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
52 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
53 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
54 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
55 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
56 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
57 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
58 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
59 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
60 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
61 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
62 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
63 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
64 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
65 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
66 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
67 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
68 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
69 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
70 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
71 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
72 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
73 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
74 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
75 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
76 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
77 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
78 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
80 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
81 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
82 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
83 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
84 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
85 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
86 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
87 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
88 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
89 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
90 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
91 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
92 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
93 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
94 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
95 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
96 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
97 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
98 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
99 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
100 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
101 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
102 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
103 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
104 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
105 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
106 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
107 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
108 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
109 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
110 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
111 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
112 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
113 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
114 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
115 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
116 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
180 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
181 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
182 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
183 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
184 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
185 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
186 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
187 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
188 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
189 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
190 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
191 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
192 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
193 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
194 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
195 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
196 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
197 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
198 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
199 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
200 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
201 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
202 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
203 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
204 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
205 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
206 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
207 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
208 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
209 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
210 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
211 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
212 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
213 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
214 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
215 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
216 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
217 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
218 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
219 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
220 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
221 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
222 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
223 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
224 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
225 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
226 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
227 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
228 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
229 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
230 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
231 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
232 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
233 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
234 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
235 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
236 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
237 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
238 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
239 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
240 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
241 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
242 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
243 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
244 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
245 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
246 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
247 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
248 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
249 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
250 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
251 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
252 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
253 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
254 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
255 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
256 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
257 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
258 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
259 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
260 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
261 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
262 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
263 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
264 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.83
Nodule 0
Rhizoplane 5.18
Rhizosphere 92.68
Stem 0
Stem Tuber 0
Unclassified 22.71

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070713_100110859 3300005436 Bacteria 2392
2 MBSR1b_contig_2992478 2162886012 Unclassified 1910
3 JGI24749J21850_1026315 3300002076 Bacteria 830
4 Ga0065712_10001714 3300005290 Bacteria 8418
5 Ga0065715_10132167 3300005293 Unclassified 1995
6 Ga0065715_10243073 3300005293 Bacteria 1192
7 Ga0065715_10637865 3300005293 Bacteria 686
8 Ga0070676_10344633 3300005328 Unclassified 1023
9 Ga0070683_100073518 3300005329 Bacteria 3192
10 Ga0070683_100175812 3300005329 Unclassified 2032
11 Ga0070683_100276918 3300005329 Unclassified 1596
12 Ga0070690_100001518 3300005330 Bacteria 12159
13 Ga0070690_100653142 3300005330 Unclassified 803
14 Ga0070670_100002429 3300005331 Bacteria 15358
15 Ga0070670_100125697 3300005331 Unclassified 2213
16 Ga0070677_10000398 3300005333 Bacteria 15157
17 Ga0070666_10008672 3300005335 Bacteria 6323
18 Ga0070666_10155216 3300005335 Bacteria 1598
19 Ga0070680_100108975 3300005336 Bacteria 2304
20 Ga0070680_100114256 3300005336 Bacteria 2249
21 Ga0070680_100366728 3300005336 Bacteria 1225
22 Ga0068868_100007765 3300005338 Bacteria 7656
23 Ga0068868_100035095 3300005338 Bacteria 3875
24 Ga0068868_100128855 3300005338 Bacteria 2069
25 Ga0068868_100597513 3300005338 Unclassified 977
26 Ga0070660_100255034 3300005339 Bacteria 1431
27 Ga0070660_101020614 3300005339 Unclassified 699
28 Ga0070689_100018017 3300005340 Bacteria 5194
29 Ga0070689_100021925 3300005340 Bacteria 4762
30 Ga0070689_100316733 3300005340 Bacteria 1302
31 Ga0070689_100457083 3300005340 Unclassified 1087
32 Ga0070691_10224275 3300005341 Unclassified 997
33 Ga0070691_10321329 3300005341 Unclassified 851
34 Ga0070687_100212591 3300005343 Bacteria 1179
35 Ga0070661_100704098 3300005344 Bacteria 823
36 Ga0070668_100020964 3300005347 Bacteria 4937
37 Ga0070669_100163082 3300005353 Bacteria 1733
38 Ga0070675_100048152 3300005354 Bacteria 3494
39 Ga0070675_100300652 3300005354 Unclassified 1414
40 Ga0070675_101013529 3300005354 Eukaryota 762
41 Ga0070671_100173653 3300005355 Unclassified 1823
42 Ga0070674_100034123 3300005356 Bacteria 3395
43 Ga0070674_100133640 3300005356 Bacteria 1853
44 Ga0070673_100008463 3300005364 Bacteria 6841
45 Ga0070673_100122313 3300005364 Bacteria 2173
46 Ga0070673_100604052 3300005364 Bacteria 1001
47 Ga0070673_100943747 3300005364 Unclassified 801
48 Ga0070688_100065194 3300005365 Bacteria 2314
49 Ga0070688_100210996 3300005365 Bacteria 1363
50 Ga0070688_100404763 3300005365 Unclassified 1011
51 Ga0070667_100016495 3300005367 Bacteria 6113
52 Ga0070667_100225781 3300005367 Unclassified 1668
53 Ga0070709_10093088 3300005434 Bacteria 1992
54 Ga0070709_10245088 3300005434 Unclassified 1288
55 Ga0070714_100001116 3300005435 Bacteria 19278
56 Ga0070714_100012437 3300005435 Bacteria 6796
57 Ga0070714_100012452 3300005435 Bacteria 6792
58 Ga0070714_100222896 3300005435 Bacteria 1734
59 Ga0070713_100000412 3300005436 Bacteria 27523
60 Ga0070713_100101168 3300005436 Unclassified 2496
61 Ga0070713_100118493 3300005436 Bacteria 2318
62 Ga0070713_100152875 3300005436 Bacteria 2054
63 Ga0070713_100201624 3300005436 Bacteria 1797
64 Ga0070710_10197894 3300005437 Unclassified 1267
65 Ga0070701_10068477 3300005438 Bacteria 1891
66 Ga0070711_100017626 3300005439 Bacteria 4549
67 Ga0070711_100062422 3300005439 Bacteria 2597
68 Ga0070711_100213061 3300005439 Bacteria 1497
69 Ga0070711_100335078 3300005439 Unclassified 1212
70 Ga0070705_100014133 3300005440 Bacteria 4100
71 Ga0070705_100025909 3300005440 Unclassified 3186
72 Ga0070705_100038637 3300005440 Bacteria 2702
73 Ga0070663_100019190 3300005455 Bacteria 4500
74 Ga0070678_100013952 3300005456 Bacteria 5054
75 Ga0070678_100642606 3300005456 Unclassified 951
76 Ga0070681_10000180 3300005458 Bacteria 48456
77 Ga0070681_10001781 3300005458 Bacteria 19333
78 Ga0070681_10011906 3300005458 Bacteria 8626
79 Ga0068867_100074103 3300005459 Unclassified 2551
80 Ga0068867_100305624 3300005459 Unclassified 1313
81 Ga0070685_10780958 3300005466 Unclassified 702
82 Ga0070706_100014692 3300005467 Bacteria 7232
83 Ga0070706_100128024 3300005467 Unclassified 2369
84 Ga0070706_100202603 3300005467 Bacteria 1854
85 Ga0070707_100001541 3300005468 Bacteria 22412
86 Ga0070707_100057893 3300005468 Bacteria 3718
87 Ga0070707_100148059 3300005468 Unclassified 2285
88 Ga0070707_100404646 3300005468 Unclassified 1325
89 Ga0070699_100000005 3300005518 Bacteria 384287
90 Ga0070679_100001072 3300005530 Bacteria 23910
91 Ga0070679_100029846 3300005530 Bacteria 5380
92 Ga0070679_100038410 3300005530 Bacteria 4760
93 Ga0070684_100004594 3300005535 Bacteria 10526
94 Ga0070684_100009369 3300005535 Bacteria 7709
95 Ga0070684_100108408 3300005535 Bacteria 2488
96 Ga0070684_100236342 3300005535 Bacteria 1669
97 Ga0070697_100010042 3300005536 Bacteria 7387
98 Ga0070697_100082679 3300005536 Bacteria 2647
99 Ga0070697_100673525 3300005536 Bacteria 912
100 Ga0068853_100092547 3300005539 Bacteria 2660
101 Ga0068853_100283248 3300005539 Unclassified 1528
102 Ga0068853_100296576 3300005539 Bacteria 1493
103 Ga0068853_100485053 3300005539 Bacteria 1165
104 Ga0068853_100528926 3300005539 Bacteria 1115
105 Ga0070672_100001699 3300005543 Bacteria 13743
106 Ga0070672_100004189 3300005543 Bacteria 9418
107 Ga0070672_100100317 3300005543 Bacteria 2348
108 Ga0070672_100168624 3300005543 Bacteria 1820
109 Ga0070686_100111815 3300005544 Bacteria 1862
110 Ga0070695_100189048 3300005545 Unclassified 1464
111 Ga0070695_100516207 3300005545 Unclassified 926
112 Ga0070696_100216205 3300005546 Unclassified 1436
113 Ga0070693_100028988 3300005547 Bacteria 3015
114 Ga0070693_100273182 3300005547 Unclassified 1129
115 Ga0070693_100309643 3300005547 Unclassified 1067
116 Ga0070665_100005771 3300005548 Bacteria 12713
117 Ga0070665_100051982 3300005548 Bacteria 4110
118 Ga0070704_100078201 3300005549 Bacteria 2426
119 Ga0068855_100000723 3300005563 Bacteria 40551
120 Ga0068855_100002247 3300005563 Bacteria 23864
121 Ga0068855_100002637 3300005563 Bacteria 22119
122 Ga0068855_100014290 3300005563 Bacteria 9561
123 Ga0068855_100272672 3300005563 Unclassified 1881
124 Ga0068855_100395513 3300005563 Unclassified 1515
125 Ga0070664_100001617 3300005564 Bacteria 18030
126 Ga0070664_100027844 3300005564 Bacteria 4699
127 Ga0070664_100070277 3300005564 Unclassified 2998
128 Ga0068857_100002477 3300005577 Bacteria 15093
129 Ga0068857_100002862 3300005577 Bacteria 14187
130 Ga0068857_100004416 3300005577 Bacteria 11888
131 Ga0068857_100011971 3300005577 Bacteria 7546
132 Ga0068857_100146416 3300005577 Bacteria 2137
133 Ga0068857_100382013 3300005577 Unclassified 1308
134 Ga0068854_100033610 3300005578 Bacteria 3576
135 Ga0068854_100049508 3300005578 Unclassified 3001
136 Ga0068854_100051507 3300005578 Bacteria 2950
137 Ga0068854_100151688 3300005578 Unclassified 1788
138 Ga0068854_100215443 3300005578 Unclassified 1517
139 Ga0068856_100000916 3300005614 Bacteria 31561
140 Ga0068856_100001055 3300005614 Bacteria 29220
141 Ga0068856_100001843 3300005614 Bacteria 22170
142 Ga0068856_100003480 3300005614 Bacteria 15897
143 Ga0068856_100004532 3300005614 Bacteria 13816
144 Ga0068856_100045277 3300005614 Bacteria 4331
145 Ga0068856_100316412 3300005614 Unclassified 1578
146 Ga0068856_100786309 3300005614 Bacteria 971
147 Ga0070702_100024150 3300005615 Bacteria 3239
148 Ga0068852_100088940 3300005616 Bacteria 2759
149 Ga0068852_100891317 3300005616 Unclassified 906
150 Ga0068859_100000701 3300005617 Bacteria 33613
151 Ga0068859_100004147 3300005617 Bacteria 14801
152 Ga0068859_100008003 3300005617 Bacteria 10716
153 Ga0068859_100037697 3300005617 Bacteria 4851
154 Ga0068859_100147383 3300005617 Unclassified 2429
155 Ga0068859_100850408 3300005617 Unclassified 998
156 Ga0068864_100001365 3300005618 Bacteria 20291
157 Ga0068864_100002500 3300005618 Bacteria 15199
158 Ga0068864_100249266 3300005618 Unclassified 1648
159 Ga0068864_100373252 3300005618 Bacteria 1350
160 Ga0068864_100765153 3300005618 Bacteria 947
161 Ga0068864_101072292 3300005618 Bacteria 801
162 Ga0068866_10024812 3300005718 Unclassified 2811
163 Ga0068866_10030932 3300005718 Bacteria 2574
164 Ga0068866_10162233 3300005718 Unclassified 1304
165 Ga0068866_10417606 3300005718 Unclassified 869
166 Ga0068861_101257309 3300005719 Archaea 718
167 Ga0068870_10039857 3300005840 Bacteria 2433
168 Ga0068870_10086080 3300005840 Bacteria 1748
169 Ga0068870_10127228 3300005840 Unclassified 1475
170 Ga0068863_100001714 3300005841 Bacteria 21710
171 Ga0068863_100005915 3300005841 Bacteria 11997
172 Ga0068863_100006719 3300005841 Bacteria 11277
173 Ga0068863_100037621 3300005841 Unclassified 4607
174 Ga0068863_100254085 3300005841 Bacteria 1698
175 Ga0068863_100429463 3300005841 Bacteria 1295
176 Ga0068858_100001468 3300005842 Bacteria 24270
177 Ga0068858_100005604 3300005842 Bacteria 12278
178 Ga0068858_100017257 3300005842 Bacteria 6771
179 Ga0068858_100028379 3300005842 Bacteria 5200
180 Ga0068858_100052884 3300005842 Bacteria 3758
181 Ga0068858_100099307 3300005842 Unclassified 2714
182 Ga0068858_100110469 3300005842 Bacteria 2567
183 Ga0068858_100286113 3300005842 Bacteria 1570
184 Ga0068858_100451332 3300005842 Unclassified 1239
185 Ga0068860_100000069 3300005843 Bacteria 179064
186 Ga0068860_100002673 3300005843 Bacteria 18563
187 Ga0068860_100066666 3300005843 Unclassified 3420
188 Ga0068860_100176152 3300005843 Bacteria 2067
189 Ga0068860_100362121 3300005843 Bacteria 1429
190 Ga0068862_100037081 3300005844 Bacteria 4132
191 Ga0068862_100156700 3300005844 Unclassified 2030
192 Ga0068862_100921299 3300005844 Unclassified 860
193 Ga0081540_1007130 3300005983 Bacteria 8019
194 Ga0070717_10231437 3300006028 Bacteria 1627
195 Ga0070717_10460113 3300006028 Bacteria 1147
196 Ga0075368_10066487 3300006042 Unclassified 1450
197 Ga0075363_100269495 3300006048 Unclassified 983
198 Ga0075364_10017682 3300006051 Unclassified 4458
199 Ga0070715_10174538 3300006163 Bacteria 1073
200 Ga0070715_10227693 3300006163 Unclassified 962
201 Ga0070716_100014172 3300006173 Bacteria 4081
202 Ga0070716_100061761 3300006173 Bacteria 2170
203 Ga0070716_100258378 3300006173 Bacteria 1190
204 Ga0070712_100152454 3300006175 Bacteria 1776
205 Ga0075367_10013351 3300006178 Bacteria 4413
206 Ga0075366_10095645 3300006195 Bacteria 1781
207 Ga0097621_100000395 3300006237 Bacteria 30394
208 Ga0097621_100000842 3300006237 Bacteria 21621
209 Ga0097621_100001056 3300006237 Bacteria 19286
210 Ga0097621_100033048 3300006237 Bacteria 4117
211 Ga0097621_100034764 3300006237 Bacteria 4022
212 Ga0097621_100121034 3300006237 Bacteria 2220
213 Ga0097621_100227666 3300006237 Bacteria 1627
214 Ga0097621_100233905 3300006237 Bacteria 1605
215 Ga0068871_100000142 3300006358 Bacteria 46519
216 Ga0068871_100001376 3300006358 Bacteria 16272
217 Ga0068871_100003340 3300006358 Bacteria 11021
218 Ga0068871_100011383 3300006358 Bacteria 6521
219 Ga0068871_100028872 3300006358 Bacteria 4353
220 Ga0068871_100054556 3300006358 Unclassified 3243
221 Ga0068871_100210764 3300006358 Bacteria 1680
222 Ga0068871_100384538 3300006358 Bacteria 1247
223 Ga0068871_100469579 3300006358 Bacteria 1130
224 Ga0068871_100753035 3300006358 Bacteria 895
225 Ga0075428_100043980 3300006844 Bacteria 4909
226 Ga0075428_100065691 3300006844 Bacteria 3973
227 Ga0075431_100035861 3300006847 Bacteria 5106
228 Ga0075433_10040567 3300006852 Bacteria 4030
229 Ga0075433_10354622 3300006852 Bacteria 1296
230 Ga0075434_100009269 3300006871 Bacteria 9174
231 Ga0075434_100017762 3300006871 Bacteria 6859
232 Ga0075434_100020093 3300006871 Bacteria 6471
233 Ga0075434_101028617 3300006871 Bacteria 837
234 Ga0068865_100003417 3300006881 Bacteria 9499
235 Ga0068865_100013340 3300006881 Bacteria 5191
236 Ga0068865_100601408 3300006881 Bacteria 929
237 Ga0075436_100000123 3300006914 Bacteria 46136
238 Ga0075436_100033358 3300006914 Bacteria 3549
239 Ga0075436_100162671 3300006914 Bacteria 1574
240 Ga0097620_100000701 3300006931 Bacteria 33613
241 Ga0097620_100004147 3300006931 Bacteria 14801
242 Ga0097620_100008003 3300006931 Bacteria 10716
243 Ga0097620_100037694 3300006931 Bacteria 4851
244 Ga0097620_100147385 3300006931 Unclassified 2429
245 Ga0097620_100850391 3300006931 Unclassified 998
246 Ga0075435_100030521 3300007076 Bacteria 4240
247 Ga0075435_100031708 3300007076 Bacteria 4167
248 Ga0075435_100085877 3300007076 Bacteria 2590
249 Ga0075435_100119750 3300007076 Bacteria 2196
250 Ga0075435_100136514 3300007076 Unclassified 2055
251 Ga0075435_100457284 3300007076 Bacteria 1101
252 Ga0105240_10000084 3300009093 Bacteria 192787
253 Ga0105240_10009640 3300009093 Bacteria 13658
254 Ga0105240_10033770 3300009093 Bacteria 6605
255 Ga0105240_10041741 3300009093 Bacteria 5851
256 Ga0105240_10369357 3300009093 Bacteria 1622
257 Ga0105240_10542345 3300009093 Unclassified 1288
258 Ga0111539_10163102 3300009094 Bacteria 2607
259 Ga0111539_10331809 3300009094 Bacteria 1770
260 Ga0105245_10227062 3300009098 Bacteria 1804
261 Ga0105245_10341759 3300009098 Bacteria 1480
262 Ga0105247_10051361 3300009101 Bacteria 2539
263 Ga0114129_10003765 3300009147 Bacteria 21379
264 Ga0105243_10335951 3300009148 Bacteria 1382
265 Ga0105241_10001470 3300009174 Bacteria 18065
266 Ga0105241_10052164 3300009174 Bacteria 3121
267 Ga0105241_10052521 3300009174 Unclassified 3112
268 Ga0105242_10456958 3300009176 Unclassified 1205
269 Ga0105242_10760455 3300009176 Bacteria 955
270 Ga0105242_11253840 3300009176 Unclassified 763
271 Ga0105248_10011329 3300009177 Bacteria 9830
272 Ga0105248_10046351 3300009177 Bacteria 4872
273 Ga0105248_10086928 3300009177 Bacteria 3518
274 Ga0105248_10158607 3300009177 Bacteria 2553
275 Ga0105248_10179562 3300009177 Unclassified 2385
276 Ga0105248_10260467 3300009177 Bacteria 1952
277 Ga0105248_10496862 3300009177 Bacteria 1375
278 Ga0105237_10112915 3300009545 Unclassified 2709
279 Ga0105237_10214594 3300009545 Bacteria 1924
280 Ga0105237_10384424 3300009545 Bacteria 1408
281 Ga0105237_10573747 3300009545 Bacteria 1135
282 Ga0105238_10000503 3300009551 Bacteria 41108
283 Ga0105238_10000860 3300009551 Bacteria 31345
284 Ga0105238_10001772 3300009551 Bacteria 21641
285 Ga0105238_10058183 3300009551 Bacteria 3875
286 Ga0105249_10057504 3300009553 Unclassified 3563
287 Ga0105249_10927500 3300009553 Bacteria 938
288 Ga0105249_11642997 3300009553 Unclassified 715
289 Ga0099796_10114701 3300010159 Unclassified 1029
290 Ga0105239_10020041 3300010375 Bacteria 7379
291 Ga0105239_10021661 3300010375 Bacteria 7085
292 Ga0105239_10031930 3300010375 Bacteria 5786
293 Ga0105246_10007555 3300011119 Bacteria 6670
294 Ga0157371_10061395 3300013102 Bacteria 2665
295 Ga0157371_10428028 3300013102 Unclassified 971
296 Ga0157369_10000323 3300013105 Bacteria 64226
297 Ga0157369_10002182 3300013105 Bacteria 23582
298 Ga0157369_10114502 3300013105 Unclassified 2864
299 Ga0157369_10205484 3300013105 Bacteria 2066
300 Ga0157369_10507239 3300013105 Bacteria 1248
301 Ga0157374_10000131 3300013296 Bacteria 68526
302 Ga0157374_10000690 3300013296 Bacteria 29745
303 Ga0157374_10002155 3300013296 Bacteria 16590
304 Ga0157374_10003128 3300013296 Bacteria 13904
305 Ga0157374_10005168 3300013296 Bacteria 10946
306 Ga0157374_10044823 3300013296 Unclassified 4090
307 Ga0157378_10000114 3300013297 Bacteria 77298
308 Ga0157378_10000388 3300013297 Bacteria 43382
309 Ga0157378_10000672 3300013297 Bacteria 32242
310 Ga0157378_10000909 3300013297 Bacteria 27249
311 Ga0157378_10004120 3300013297 Bacteria 12840
312 Ga0157378_10032978 3300013297 Bacteria 4577
313 Ga0157378_10052158 3300013297 Bacteria 3639
314 Ga0157378_10223899 3300013297 Bacteria 1789
315 Ga0163162_10003632 3300013306 Bacteria 14791
316 Ga0163162_10321862 3300013306 Bacteria 1679
317 Ga0157372_10001913 3300013307 Bacteria 22590
318 Ga0157372_10001966 3300013307 Bacteria 22353
319 Ga0157372_10003577 3300013307 Bacteria 16725
320 Ga0157372_10003931 3300013307 Bacteria 15954
321 Ga0157372_10005073 3300013307 Bacteria 13996
322 Ga0157372_10062314 3300013307 Bacteria 4178
323 Ga0157375_10000370 3300013308 Bacteria 40795
324 Ga0157375_10064068 3300013308 Bacteria 3659
325 Ga0157375_10343183 3300013308 Bacteria 1659
326 Ga0157375_10554040 3300013308 Unclassified 1311
327 Ga0163163_10009558 3300014325 Archaea 8664
328 Ga0163163_10133277 3300014325 Bacteria 2525
329 Ga0163163_10337531 3300014325 Unclassified 1562
330 Ga0163163_10474097 3300014325 Bacteria 1312
331 Ga0157380_10034874 3300014326 Bacteria 3883
332 Ga0157377_10194728 3300014745 Bacteria 1283
333 Ga0157379_10008991 3300014968 Bacteria 8707
334 Ga0157379_10032308 3300014968 Bacteria 4666
335 Ga0157376_10001657 3300014969 Bacteria 14791
336 Ga0157376_10010837 3300014969 Bacteria 6692
337 Ga0157376_10017913 3300014969 Bacteria 5416
338 Ga0157376_10080377 3300014969 Bacteria 2796
339 Ga0163161_10069355 3300017792 Bacteria 2577
340 Ga0207697_10006831 3300025315 Bacteria 5126
341 Ga0207656_10004861 3300025321 Bacteria 4716
342 Ga0207682_10004098 3300025893 Bacteria 6186
343 Ga0207692_10155342 3300025898 Unclassified 1314
344 Ga0207642_10041277 3300025899 Unclassified 2019
345 Ga0207642_10456572 3300025899 Bacteria 775
346 Ga0207710_10000641 3300025900 Bacteria 19845
347 Ga0207710_10044529 3300025900 Bacteria 1976
348 Ga0207710_10074466 3300025900 Bacteria 1563
349 Ga0207688_10035282 3300025901 Bacteria 2771
350 Ga0207680_10001694 3300025903 Bacteria 10405
351 Ga0207680_10513638 3300025903 Unclassified 854
352 Ga0207647_10223718 3300025904 Bacteria 1084
353 Ga0207647_10293351 3300025904 Unclassified 927
354 Ga0207647_10429709 3300025904 Unclassified 742
355 Ga0207685_10458459 3300025905 Unclassified 664
356 Ga0207645_10144222 3300025907 Bacteria 1552
357 Ga0207705_10072440 3300025909 Unclassified 2499
358 Ga0207684_10026101 3300025910 Bacteria 4979
359 Ga0207684_10072330 3300025910 Unclassified 2929
360 Ga0207684_10327074 3300025910 Bacteria 1321
361 Ga0207684_10426664 3300025910 Unclassified 1139
362 Ga0207654_10000575 3300025911 Bacteria 20793
363 Ga0207654_10132057 3300025911 Bacteria 1581
364 Ga0207654_10406686 3300025911 Unclassified 947
365 Ga0207707_10002055 3300025912 Bacteria 18271
366 Ga0207707_10002392 3300025912 Bacteria 16887
367 Ga0207707_10029500 3300025912 Unclassified 4797
368 Ga0207695_10000306 3300025913 Bacteria 119113
369 Ga0207695_10013667 3300025913 Bacteria 9666
370 Ga0207695_10029158 3300025913 Bacteria 6105
371 Ga0207695_10354378 3300025913 Unclassified 1354
372 Ga0207671_10000076 3300025914 Bacteria 151211
373 Ga0207671_10279558 3300025914 Bacteria 1316
374 Ga0207671_10374785 3300025914 Bacteria 1130
375 Ga0207671_10873307 3300025914 Unclassified 712
376 Ga0207693_10129070 3300025915 Unclassified 1987
377 Ga0207663_10009362 3300025916 Bacteria 5171
378 Ga0207663_10058091 3300025916 Bacteria 2440
379 Ga0207663_10133522 3300025916 Bacteria 1719
380 Ga0207663_10294761 3300025916 Bacteria 1210
381 Ga0207660_10085179 3300025917 Bacteria 2331
382 Ga0207660_10121802 3300025917 Bacteria 1976
383 Ga0207660_10466774 3300025917 Bacteria 1022
384 Ga0207657_10280073 3300025919 Unclassified 1324
385 Ga0207652_10123743 3300025921 Unclassified 2303
386 Ga0207652_10135847 3300025921 Bacteria 2196
387 Ga0207646_10001196 3300025922 Bacteria 32674
388 Ga0207646_10144281 3300025922 Bacteria 2145
389 Ga0207646_10171262 3300025922 Unclassified 1961
390 Ga0207681_10086804 3300025923 Bacteria 2224
391 Ga0207694_10000029 3300025924 Bacteria 239107
392 Ga0207694_10002710 3300025924 Bacteria 14344
393 Ga0207694_10012665 3300025924 Bacteria 6354
394 Ga0207694_10272179 3300025924 Bacteria 1389
395 Ga0207650_10003130 3300025925 Bacteria 11396
396 Ga0207650_10009650 3300025925 Bacteria 6598
397 Ga0207650_10057087 3300025925 Unclassified 2903
398 Ga0207659_10004411 3300025926 Bacteria 8505
399 Ga0207687_10000715 3300025927 Bacteria 22524
400 Ga0207687_10191663 3300025927 Unclassified 1591
401 Ga0207687_10255011 3300025927 Bacteria 1396
402 Ga0207700_10004629 3300025928 Bacteria 8147
403 Ga0207700_10084069 3300025928 Bacteria 2494
404 Ga0207700_10112531 3300025928 Bacteria 2193
405 Ga0207700_10300159 3300025928 Bacteria 1387
406 Ga0207700_10475991 3300025928 Bacteria 1103
407 Ga0207700_10804667 3300025928 Unclassified 841
408 Ga0207664_10001573 3300025929 Bacteria 14982
409 Ga0207664_10360422 3300025929 Unclassified 1288
410 Ga0207664_10453163 3300025929 Unclassified 1145
411 Ga0207664_10463050 3300025929 Bacteria 1132
412 Ga0207644_10020340 3300025931 Bacteria 4513
413 Ga0207644_10070557 3300025931 Unclassified 2554
414 Ga0207706_10122901 3300025933 Bacteria 2283
415 Ga0207686_10119591 3300025934 Bacteria 1791
416 Ga0207709_10243131 3300025935 Bacteria 1310
417 Ga0207670_10037059 3300025936 Bacteria 3176
418 Ga0207670_10141687 3300025936 Bacteria 1774
419 Ga0207670_10160736 3300025936 Unclassified 1676
420 Ga0207670_10606874 3300025936 Unclassified 899
421 Ga0207669_10108187 3300025937 Bacteria 1856
422 Ga0207669_10133693 3300025937 Bacteria 1709
423 Ga0207704_10023840 3300025938 Unclassified 3306
424 Ga0207704_10045672 3300025938 Bacteria 2604
425 Ga0207704_10284098 3300025938 Bacteria 1259
426 Ga0207665_10028427 3300025939 Bacteria 3692
427 Ga0207665_10049405 3300025939 Unclassified 2826
428 Ga0207691_10001248 3300025940 Bacteria 25431
429 Ga0207691_10003018 3300025940 Bacteria 16429
430 Ga0207711_10014844 3300025941 Bacteria 6471
431 Ga0207711_10032337 3300025941 Bacteria 4423
432 Ga0207711_10184659 3300025941 Bacteria 1898
433 Ga0207689_10000698 3300025942 Bacteria 32186
434 Ga0207689_10026145 3300025942 Bacteria 4888
435 Ga0207661_10000237 3300025944 Bacteria 36327
436 Ga0207661_10041310 3300025944 Bacteria 3630
437 Ga0207661_10041412 3300025944 Bacteria 3626
438 Ga0207661_10187532 3300025944 Bacteria 1811
439 Ga0207679_10024019 3300025945 Bacteria 4176
440 Ga0207679_10174594 3300025945 Unclassified 1772
441 Ga0207679_10353300 3300025945 Unclassified 1282
442 Ga0207667_10000802 3300025949 Bacteria 40809
443 Ga0207667_10002103 3300025949 Bacteria 24977
444 Ga0207667_10003423 3300025949 Bacteria 19586
445 Ga0207667_10009617 3300025949 Bacteria 11372
446 Ga0207667_10083946 3300025949 Bacteria 3298
447 Ga0207667_10147728 3300025949 Viruses 2419
448 Ga0207651_10048620 3300025960 Bacteria 2868
449 Ga0207651_10453117 3300025960 Bacteria 1101
450 Ga0207651_10782449 3300025960 Bacteria 845
451 Ga0207640_10001895 3300025981 Bacteria 11229
452 Ga0207640_10022509 3300025981 Bacteria 3773
453 Ga0207640_10070809 3300025981 Bacteria 2347
454 Ga0207640_10281350 3300025981 Unclassified 1307
455 Ga0207658_10000198 3300025986 Bacteria 63044
456 Ga0207658_10004698 3300025986 Bacteria 9460
457 Ga0207658_10222641 3300025986 Unclassified 1588
458 Ga0207677_10000023 3300026023 Bacteria 128514
459 Ga0207677_10036798 3300026023 Bacteria 3193
460 Ga0207677_10087345 3300026023 Unclassified 2257
461 Ga0207677_10098819 3300026023 Bacteria 2142
462 Ga0207677_10105630 3300026023 Bacteria 2084
463 Ga0207677_10208159 3300026023 Bacteria 1560
464 Ga0207703_10000694 3300026035 Bacteria 33348
465 Ga0207703_10004024 3300026035 Bacteria 12159
466 Ga0207703_10009264 3300026035 Bacteria 7742
467 Ga0207703_10018124 3300026035 Bacteria 5500
468 Ga0207703_10080868 3300026035 Bacteria 2707
469 Ga0207703_10088607 3300026035 Bacteria 2598
470 Ga0207703_10124927 3300026035 Unclassified 2214
471 Ga0207703_10250852 3300026035 Bacteria 1595
472 Ga0207639_10077710 3300026041 Bacteria 2617
473 Ga0207639_10313427 3300026041 Unclassified 1391
474 Ga0207639_10603101 3300026041 Bacteria 1013
475 Ga0207639_10694457 3300026041 Unclassified 944
476 Ga0207678_10008145 3300026067 Bacteria 9241
477 Ga0207708_10290866 3300026075 Unclassified 1326
478 Ga0207702_10001549 3300026078 Bacteria 22740
479 Ga0207702_10003277 3300026078 Bacteria 14936
480 Ga0207702_10003755 3300026078 Bacteria 13722
481 Ga0207702_10008675 3300026078 Bacteria 8574
482 Ga0207702_10088838 3300026078 Bacteria 2701
483 Ga0207702_10089572 3300026078 Bacteria 2691
484 Ga0207641_10001403 3300026088 Bacteria 23729
485 Ga0207641_10003323 3300026088 Bacteria 14314
486 Ga0207641_10005549 3300026088 Bacteria 10751
487 Ga0207641_10029002 3300026088 Bacteria 4575
488 Ga0207641_10453049 3300026088 Bacteria 1240
489 Ga0207641_10542458 3300026088 Bacteria 1133
490 Ga0207648_10054793 3300026089 Unclassified 3482
491 Ga0207648_10058148 3300026089 Bacteria 3373
492 Ga0207648_10094997 3300026089 Unclassified 2607
493 Ga0207676_10007858 3300026095 Bacteria 7587
494 Ga0207676_10058946 3300026095 Unclassified 3030
495 Ga0207676_10263929 3300026095 Bacteria 1556
496 Ga0207676_10349223 3300026095 Unclassified 1367
497 Ga0207674_10000125 3300026116 Bacteria 89047
498 Ga0207674_10012847 3300026116 Bacteria 9348
499 Ga0207674_10018530 3300026116 Bacteria 7564
500 Ga0207674_10021961 3300026116 Bacteria 6864
501 Ga0207674_10060839 3300026116 Bacteria 3818
502 Ga0207674_10240380 3300026116 Unclassified 1758
503 Ga0207675_100093708 3300026118 Bacteria 2825
504 Ga0207675_100186339 3300026118 Bacteria 1989
505 Ga0207683_10006653 3300026121 Bacteria 9886
506 Ga0207683_10294315 3300026121 Bacteria 1485
507 Ga0207698_10027184 3300026142 Bacteria 4058
508 Ga0268266_10006089 3300028379 Bacteria 11113
509 Ga0268265_10053464 3300028380 Bacteria 3060
510 Ga0268265_10695054 3300028380 Unclassified 982
511 Ga0268264_10000086 3300028381 Bacteria 239021
512 Ga0268264_10009593 3300028381 Bacteria 8017
513 Ga0265338_10482538 3300028800 Unclassified 874
514 Ga0307408_101009743 3300031548 Bacteria 767
515 Ga0307409_100091336 3300031995 Bacteria 2495
516 Ga0307416_101810858 3300032002 Bacteria 714
517 Ga0307411_10058363 3300032005 Bacteria 2554
518 Ga0307411_10843914 3300032005 Bacteria 810
519 Ga0307415_100514726 3300032126 Bacteria 1049
520 Ga0307510_10304415 3300033180 Unclassified 1055
521 Ga0373926_0045659 3300035083 Bacteria 1571
522 Ga0373939_0089390 3300035114 Bacteria 1038
523 Ga0373945_0099146 3300035116 Bacteria 1138
524 Ga0373960_0082068 3300035121 Bacteria 1017
525 Ga0373943_0008126 3300035170 Bacteria 4707
526 Ga0373946_0004672 3300035171 Bacteria 4917
527 Ga0373924_0039596 3300035410 Unclassified 1926
528 Ga0373931_0313523 3300035691 Bacteria 972
529 Ga0373927_0624081 3300035695 Bacteria 712
530 Ga0373947_0125463 3300035725 Bacteria 1634
531 Ga0373947_0310884 3300035725 Unclassified 1052
532 Ga0373925_0000629 3300037068 Bacteria 33366
533 Ga0373925_0087892 3300037068 Bacteria 2373
534 Ga0373925_0135374 3300037068 Bacteria 1925
535 Ga0373925_0176324 3300037068 Bacteria 1690
536 Ga0436363_1260175 3300039450 Bacteria 2897
537 Ga0466961_0143473 3300044693 Bacteria 1494
538 Ga0466963_0056132 3300044694 Bacteria 2620
539 Ga0466970_0347237 3300044765 Bacteria 842
540 Ga0466959_0025287 3300045049 Bacteria 4400
541 Ga0451576_1201132 3300045051 Unclassified 792
542 Ga0495603_0020295 3300046455 Bacteria 4027
543 Ga0495603_0119054 3300046455 Bacteria 1539
544 Ga0495603_0224370 3300046455 Unclassified 1084
545 Ga0495629_0000003 3300046459 Bacteria 529162
546 Ga0495629_0046079 3300046459 Bacteria 3059
547 Ga0495638_0038216 3300046460 Unclassified 3052
548 Ga0495580_0009802 3300046472 Bacteria 7512
549 Ga0495582_0005018 3300046473 Bacteria 7418
550 Ga0495582_0046622 3300046473 Bacteria 2387
551 Ga0495639_0000005 3300046475 Bacteria 100787
552 Ga0495594_0069421 3300046499 Bacteria 1957
553 Ga0495594_0126864 3300046499 Bacteria 1444
554 Ga0495594_0206333 3300046499 Unclassified 1120
555 Ga0495630_0499822 3300046517 Bacteria 932
556 Ga0495632_0136416 3300046519 Bacteria 1140
557 Ga0495666_0000012 3300046526 Bacteria 86313
558 Ga0495665_0050668 3300046531 Bacteria 2201
559 Ga0495665_0109877 3300046531 Bacteria 1446
560 Ga0495640_0047295 3300046533 Bacteria 2977
561 Ga0495640_0124181 3300046533 Unclassified 1675
562 Ga0495586_0000232 3300046535 Bacteria 36961
563 Ga0495586_0059804 3300046535 Bacteria 2071
564 Ga0495587_0031982 3300046536 Bacteria 3183
565 Ga0495645_0023512 3300046543 Bacteria 4463
566 Ga0495622_0025383 3300046557 Bacteria 2768
567 Ga0495622_0084709 3300046557 Bacteria 1458
568 Ga0495625_0036945 3300046660 Bacteria 3586
569 Ga0495657_0228608 3300046675 Unclassified 1126
570 Ga0495599_0219243 3300046678 Unclassified 1164
571 Ga0495647_0122759 3300046681 Unclassified 1094
572 Ga0495658_0007239 3300046683 Bacteria 5483
573 Ga0495658_0029966 3300046683 Bacteria 2950
574 Ga0495658_0109230 3300046683 Bacteria 1661
575 Ga0495658_0655352 3300046683 Unclassified 672
576 Ga0495613_0037552 3300046689 Bacteria 3591
577 Ga0495613_0156624 3300046689 Bacteria 1622
578 Ga0495624_0104852 3300046690 Bacteria 1739
579 Ga0495671_0035900 3300046692 Bacteria 2515
580 Ga0495581_0042814 3300047315 Unclassified 2620
581 Ga0495581_0267098 3300047315 Bacteria 1000
582 Ga0495674_0007368 3300047319 Bacteria 10522
583 Ga0495674_0021314 3300047319 Bacteria 5995
584 Ga0495674_0355300 3300047319 Bacteria 1189
585 Ga0495676_0005033 3300047321 Bacteria 12121
586 Ga0495673_0028254 3300047469 Bacteria 2658
587 Ga0495684_0172284 3300047471 Bacteria 1609
588 Ga0495593_0279250 3300047673 Bacteria 835
589 Ga0496100_0108733 3300048903 Bacteria 1923
590 Ga0496100_0206069 3300048903 Bacteria 1436
591 Ga0496101_0018361 3300048904 Bacteria 4755
592 Ga0496101_0175993 3300048904 Unclassified 1646
593 Ga0496102_0023503 3300048905 Bacteria 5476
594 Ga0496102_0045351 3300048905 Bacteria 3992
595 Ga0496102_0079160 3300048905 Bacteria 3026
596 Ga0496103_0023847 3300048906 Bacteria 3691
597 Ga0496103_0067553 3300048906 Bacteria 2233
598 Ga0496103_0176219 3300048906 Unclassified 1374
599 Ga0496104_0254670 3300048907 Bacteria 1668
600 Ga0496104_0388581 3300048907 Bacteria 1308
601 Ga0496104_0495961 3300048907 Unclassified 1132
602 Ga0496106_0004386 3300048909 Bacteria 10479
603 Ga0496106_0011293 3300048909 Bacteria 6610
604 Ga0496106_0491405 3300048909 Unclassified 986
605 Ga0496107_0007080 3300048910 Bacteria 7724
606 Ga0496108_0164545 3300048911 Bacteria 1918
607 Ga0496109_0062838 3300048912 Bacteria 3396
608 Ga0496109_0522118 3300048912 Bacteria 1121
609 Ga0496112_0000962 3300048915 Bacteria 20935
610 Ga0496112_0020338 3300048915 Bacteria 6290
611 Ga0496112_0080628 3300048915 Unclassified 3218
612 Ga0496112_0861054 3300048915 Bacteria 829
613 Ga0496113_0063397 3300048916 Bacteria 2793
614 Ga0496113_0518136 3300048916 Bacteria 957
615 Ga0496113_0830683 3300048916 Unclassified 733
616 Ga0496114_0118490 3300048917 Bacteria 2275
617 Ga0496114_0304546 3300048917 Bacteria 1407
618 Ga0496114_0422684 3300048917 Bacteria 1180
619 Ga0496115_0019255 3300048918 Bacteria 5251
620 Ga0496115_0025193 3300048918 Unclassified 4630
621 Ga0496115_0053701 3300048918 Bacteria 3234
622 Ga0496115_0153001 3300048918 Bacteria 1905
623 Ga0495682_0004236 3300049460 Bacteria 6200
624 nmdc:mga03n38_223959_c1 3300050490 Unclassified 983
625 nmdc:mga00v17_407925_c1 3300050491 Bacteria 883
626 nmdc:mga0yw44_604475_c1 3300050492 Bacteria 745
627 nmdc:mga0k408_66276_c1 3300050493 Bacteria 2103
628 nmdc:mga06z11_13463_c1 3300050494 Bacteria 3593
629 nmdc:mga04h51_105546_c1 3300050495 Bacteria 1032
630 nmdc:mga05p37_2921_c1 3300050507 Bacteria 19832
631 nmdc:mga09592_306496_c2 3300050508 Unclassified 907
632 nmdc:mga06r32_14348_c1 3300050510 Bacteria 7190
633 nmdc:mga08y16_129846_c1 3300050511 Bacteria 2621
634 nmdc:mga08y16_333416_c1 3300050511 Bacteria 1560
635 nmdc:mga0n895_110584_c1 3300050512 Bacteria 2764
636 nmdc:mga0n895_146542_c1 3300050512 Bacteria 2391
637 nmdc:mga0n895_33198_c1 3300050512 Bacteria 4958
638 nmdc:mga0n895_55410_c1 3300050512 Unclassified 3902
639 nmdc:mga0n895_9175_c1 3300050512 Bacteria 8638
640 nmdc:mga0rr50_1042794_c1 3300050513 Bacteria 696
641 nmdc:mga0rr50_13632_c1 3300050513 Bacteria 5301
642 nmdc:mga0rr50_21960_c1 3300050513 Unclassified 4369
643 nmdc:mga0rr50_29951_c1 3300050513 Bacteria 3846
644 nmdc:mga0rr50_442921_c1 3300050513 Bacteria 1101
645 nmdc:mga0rr50_59243_c1 3300050513 Bacteria 2874
646 nmdc:mga08x19_124_c1 3300050514 Bacteria 67978
647 nmdc:mga08x19_174765_c1 3300050514 Bacteria 1464
648 nmdc:mga08x19_334245_c1 3300050514 Bacteria 1056
649 nmdc:mga0a205_11647_c1 3300050515 Bacteria 8109
650 nmdc:mga0a205_28592_c1 3300050515 Bacteria 5331
651 nmdc:mga0a205_349028_c1 3300050515 Unclassified 1347
652 nmdc:mga0a205_48148_c1 3300050515 Bacteria 4114
653 Ga0495601_0045658 3300053077 Bacteria 2756
654 Ga0495612_0171895 3300053078 Unclassified 949
655 Ga0500556_0213290 3300053104 Unclassified 762
656 Ga0466962_0125820 3300061719 Bacteria 1238
657 Ga0070713_100110859
658 MBSR1b_contig_2992478
659 JGI24749J21850_1026315
660 Ga0065712_10001714
661 Ga0065715_10132167
662 Ga0065715_10243073
663 Ga0065715_10637865
664 Ga0070676_10344633
665 Ga0070683_100073518
666 Ga0070683_100175812
667 Ga0070683_100276918
668 Ga0070690_100001518
669 Ga0070690_100653142
670 Ga0070670_100002429
671 Ga0070670_100125697
672 Ga0070677_10000398
673 Ga0070666_10008672
674 Ga0070666_10155216
675 Ga0070680_100108975
676 Ga0070680_100114256
677 Ga0070680_100366728
678 Ga0068868_100007765
679 Ga0068868_100035095
680 Ga0068868_100128855
681 Ga0068868_100597513
682 Ga0070660_100255034
683 Ga0070660_101020614
684 Ga0070689_100018017
685 Ga0070689_100021925
686 Ga0070689_100316733
687 Ga0070689_100457083
688 Ga0070691_10224275
689 Ga0070691_10321329
690 Ga0070687_100212591
691 Ga0070661_100704098
692 Ga0070668_100020964
693 Ga0070669_100163082
694 Ga0070675_100048152
695 Ga0070675_100300652
696 Ga0070675_101013529
697 Ga0070671_100173653
698 Ga0070674_100034123
699 Ga0070674_100133640
700 Ga0070673_100008463
701 Ga0070673_100122313
702 Ga0070673_100604052
703 Ga0070673_100943747
704 Ga0070688_100065194
705 Ga0070688_100210996
706 Ga0070688_100404763
707 Ga0070667_100016495
708 Ga0070667_100225781
709 Ga0070709_10093088
710 Ga0070709_10245088
711 Ga0070714_100001116
712 Ga0070714_100012437
713 Ga0070714_100012452
714 Ga0070714_100222896
715 Ga0070713_100000412
716 Ga0070713_100101168
717 Ga0070713_100118493
718 Ga0070713_100152875
719 Ga0070713_100201624
720 Ga0070710_10197894
721 Ga0070701_10068477
722 Ga0070711_100017626
723 Ga0070711_100062422
724 Ga0070711_100213061
725 Ga0070711_100335078
726 Ga0070705_100014133
727 Ga0070705_100025909
728 Ga0070705_100038637
729 Ga0070663_100019190
730 Ga0070678_100013952
731 Ga0070678_100642606
732 Ga0070681_10000180
733 Ga0070681_10001781
734 Ga0070681_10011906
735 Ga0068867_100074103
736 Ga0068867_100305624
737 Ga0070685_10780958
738 Ga0070706_100014692
739 Ga0070706_100128024
740 Ga0070706_100202603
741 Ga0070707_100001541
742 Ga0070707_100057893
743 Ga0070707_100148059
744 Ga0070707_100404646
745 Ga0070699_100000005
746 Ga0070679_100001072
747 Ga0070679_100029846
748 Ga0070679_100038410
749 Ga0070684_100004594
750 Ga0070684_100009369
751 Ga0070684_100108408
752 Ga0070684_100236342
753 Ga0070697_100010042
754 Ga0070697_100082679
755 Ga0070697_100673525
756 Ga0068853_100092547
757 Ga0068853_100283248
758 Ga0068853_100296576
759 Ga0068853_100485053
760 Ga0068853_100528926
761 Ga0070672_100001699
762 Ga0070672_100004189
763 Ga0070672_100100317
764 Ga0070672_100168624
765 Ga0070686_100111815
766 Ga0070695_100189048
767 Ga0070695_100516207
768 Ga0070696_100216205
769 Ga0070693_100028988
770 Ga0070693_100273182
771 Ga0070693_100309643
772 Ga0070665_100005771
773 Ga0070665_100051982
774 Ga0070704_100078201
775 Ga0068855_100000723
776 Ga0068855_100002247
777 Ga0068855_100002637
778 Ga0068855_100014290
779 Ga0068855_100272672
780 Ga0068855_100395513
781 Ga0070664_100001617
782 Ga0070664_100027844
783 Ga0070664_100070277
784 Ga0068857_100002477
785 Ga0068857_100002862
786 Ga0068857_100004416
787 Ga0068857_100011971
788 Ga0068857_100146416
789 Ga0068857_100382013
790 Ga0068854_100033610
791 Ga0068854_100049508
792 Ga0068854_100051507
793 Ga0068854_100151688
794 Ga0068854_100215443
795 Ga0068856_100000916
796 Ga0068856_100001055
797 Ga0068856_100001843
798 Ga0068856_100003480
799 Ga0068856_100004532
800 Ga0068856_100045277
801 Ga0068856_100316412
802 Ga0068856_100786309
803 Ga0070702_100024150
804 Ga0068852_100088940
805 Ga0068852_100891317
806 Ga0068859_100000701
807 Ga0068859_100004147
808 Ga0068859_100008003
809 Ga0068859_100037697
810 Ga0068859_100147383
811 Ga0068859_100850408
812 Ga0068864_100001365
813 Ga0068864_100002500
814 Ga0068864_100249266
815 Ga0068864_100373252
816 Ga0068864_100765153
817 Ga0068864_101072292
818 Ga0068866_10024812
819 Ga0068866_10030932
820 Ga0068866_10162233
821 Ga0068866_10417606
822 Ga0068861_101257309
823 Ga0068870_10039857
824 Ga0068870_10086080
825 Ga0068870_10127228
826 Ga0068863_100001714
827 Ga0068863_100005915
828 Ga0068863_100006719
829 Ga0068863_100037621
830 Ga0068863_100254085
831 Ga0068863_100429463
832 Ga0068858_100001468
833 Ga0068858_100005604
834 Ga0068858_100017257
835 Ga0068858_100028379
836 Ga0068858_100052884
837 Ga0068858_100099307
838 Ga0068858_100110469
839 Ga0068858_100286113
840 Ga0068858_100451332
841 Ga0068860_100000069
842 Ga0068860_100002673
843 Ga0068860_100066666
844 Ga0068860_100176152
845 Ga0068860_100362121
846 Ga0068862_100037081
847 Ga0068862_100156700
848 Ga0068862_100921299
849 Ga0081540_1007130
850 Ga0070717_10231437
851 Ga0070717_10460113
852 Ga0075368_10066487
853 Ga0075363_100269495
854 Ga0075364_10017682
855 Ga0070715_10174538
856 Ga0070715_10227693
857 Ga0070716_100014172
858 Ga0070716_100061761
859 Ga0070716_100258378
860 Ga0070712_100152454
861 Ga0075367_10013351
862 Ga0075366_10095645
863 Ga0097621_100000395
864 Ga0097621_100000842
865 Ga0097621_100001056
866 Ga0097621_100033048
867 Ga0097621_100034764
868 Ga0097621_100121034
869 Ga0097621_100227666
870 Ga0097621_100233905
871 Ga0068871_100000142
872 Ga0068871_100001376
873 Ga0068871_100003340
874 Ga0068871_100011383
875 Ga0068871_100028872
876 Ga0068871_100054556
877 Ga0068871_100210764
878 Ga0068871_100384538
879 Ga0068871_100469579
880 Ga0068871_100753035
881 Ga0075428_100043980
882 Ga0075428_100065691
883 Ga0075431_100035861
884 Ga0075433_10040567
885 Ga0075433_10354622
886 Ga0075434_100009269
887 Ga0075434_100017762
888 Ga0075434_100020093
889 Ga0075434_101028617
890 Ga0068865_100003417
891 Ga0068865_100013340
892 Ga0068865_100601408
893 Ga0075436_100000123
894 Ga0075436_100033358
895 Ga0075436_100162671
896 Ga0097620_100000701
897 Ga0097620_100004147
898 Ga0097620_100008003
899 Ga0097620_100037694
900 Ga0097620_100147385
901 Ga0097620_100850391
902 Ga0075435_100030521
903 Ga0075435_100031708
904 Ga0075435_100085877
905 Ga0075435_100119750
906 Ga0075435_100136514
907 Ga0075435_100457284
908 Ga0105240_10000084
909 Ga0105240_10009640
910 Ga0105240_10033770
911 Ga0105240_10041741
912 Ga0105240_10369357
913 Ga0105240_10542345
914 Ga0111539_10163102
915 Ga0111539_10331809
916 Ga0105245_10227062
917 Ga0105245_10341759
918 Ga0105247_10051361
919 Ga0114129_10003765
920 Ga0105243_10335951
921 Ga0105241_10001470
922 Ga0105241_10052164
923 Ga0105241_10052521
924 Ga0105242_10456958
925 Ga0105242_10760455
926 Ga0105242_11253840
927 Ga0105248_10011329
928 Ga0105248_10046351
929 Ga0105248_10086928
930 Ga0105248_10158607
931 Ga0105248_10179562
932 Ga0105248_10260467
933 Ga0105248_10496862
934 Ga0105237_10112915
935 Ga0105237_10214594
936 Ga0105237_10384424
937 Ga0105237_10573747
938 Ga0105238_10000503
939 Ga0105238_10000860
940 Ga0105238_10001772
941 Ga0105238_10058183
942 Ga0105249_10057504
943 Ga0105249_10927500
944 Ga0105249_11642997
945 Ga0099796_10114701
946 Ga0105239_10020041
947 Ga0105239_10021661
948 Ga0105239_10031930
949 Ga0105246_10007555
950 Ga0157371_10061395
951 Ga0157371_10428028
952 Ga0157369_10000323
953 Ga0157369_10002182
954 Ga0157369_10114502
955 Ga0157369_10205484
956 Ga0157369_10507239
957 Ga0157374_10000131
958 Ga0157374_10000690
959 Ga0157374_10002155
960 Ga0157374_10003128
961 Ga0157374_10005168
962 Ga0157374_10044823
963 Ga0157378_10000114
964 Ga0157378_10000388
965 Ga0157378_10000672
966 Ga0157378_10000909
967 Ga0157378_10004120
968 Ga0157378_10032978
969 Ga0157378_10052158
970 Ga0157378_10223899
971 Ga0163162_10003632
972 Ga0163162_10321862
973 Ga0157372_10001913
974 Ga0157372_10001966
975 Ga0157372_10003577
976 Ga0157372_10003931
977 Ga0157372_10005073
978 Ga0157372_10062314
979 Ga0157375_10000370
980 Ga0157375_10064068
981 Ga0157375_10343183
982 Ga0157375_10554040
983 Ga0163163_10009558
984 Ga0163163_10133277
985 Ga0163163_10337531
986 Ga0163163_10474097
987 Ga0157380_10034874
988 Ga0157377_10194728
989 Ga0157379_10008991
990 Ga0157379_10032308
991 Ga0157376_10001657
992 Ga0157376_10010837
993 Ga0157376_10017913
994 Ga0157376_10080377
995 Ga0163161_10069355
996 Ga0207697_10006831
997 Ga0207656_10004861
998 Ga0207682_10004098
999 Ga0207692_10155342
1000 Ga0207642_10041277
1001 Ga0207642_10456572
1002 Ga0207710_10000641
1003 Ga0207710_10044529
1004 Ga0207710_10074466
1005 Ga0207688_10035282
1006 Ga0207680_10001694
1007 Ga0207680_10513638
1008 Ga0207647_10223718
1009 Ga0207647_10293351
1010 Ga0207647_10429709
1011 Ga0207685_10458459
1012 Ga0207645_10144222
1013 Ga0207705_10072440
1014 Ga0207684_10026101
1015 Ga0207684_10072330
1016 Ga0207684_10327074
1017 Ga0207684_10426664
1018 Ga0207654_10000575
1019 Ga0207654_10132057
1020 Ga0207654_10406686
1021 Ga0207707_10002055
1022 Ga0207707_10002392
1023 Ga0207707_10029500
1024 Ga0207695_10000306
1025 Ga0207695_10013667
1026 Ga0207695_10029158
1027 Ga0207695_10354378
1028 Ga0207671_10000076
1029 Ga0207671_10279558
1030 Ga0207671_10374785
1031 Ga0207671_10873307
1032 Ga0207693_10129070
1033 Ga0207663_10009362
1034 Ga0207663_10058091
1035 Ga0207663_10133522
1036 Ga0207663_10294761
1037 Ga0207660_10085179
1038 Ga0207660_10121802
1039 Ga0207660_10466774
1040 Ga0207657_10280073
1041 Ga0207652_10123743
1042 Ga0207652_10135847
1043 Ga0207646_10001196
1044 Ga0207646_10144281
1045 Ga0207646_10171262
1046 Ga0207681_10086804
1047 Ga0207694_10000029
1048 Ga0207694_10002710
1049 Ga0207694_10012665
1050 Ga0207694_10272179
1051 Ga0207650_10003130
1052 Ga0207650_10009650
1053 Ga0207650_10057087
1054 Ga0207659_10004411
1055 Ga0207687_10000715
1056 Ga0207687_10191663
1057 Ga0207687_10255011
1058 Ga0207700_10004629
1059 Ga0207700_10084069
1060 Ga0207700_10112531
1061 Ga0207700_10300159
1062 Ga0207700_10475991
1063 Ga0207700_10804667
1064 Ga0207664_10001573
1065 Ga0207664_10360422
1066 Ga0207664_10453163
1067 Ga0207664_10463050
1068 Ga0207644_10020340
1069 Ga0207644_10070557
1070 Ga0207706_10122901
1071 Ga0207686_10119591
1072 Ga0207709_10243131
1073 Ga0207670_10037059
1074 Ga0207670_10141687
1075 Ga0207670_10160736
1076 Ga0207670_10606874
1077 Ga0207669_10108187
1078 Ga0207669_10133693
1079 Ga0207704_10023840
1080 Ga0207704_10045672
1081 Ga0207704_10284098
1082 Ga0207665_10028427
1083 Ga0207665_10049405
1084 Ga0207691_10001248
1085 Ga0207691_10003018
1086 Ga0207711_10014844
1087 Ga0207711_10032337
1088 Ga0207711_10184659
1089 Ga0207689_10000698
1090 Ga0207689_10026145
1091 Ga0207661_10000237
1092 Ga0207661_10041310
1093 Ga0207661_10041412
1094 Ga0207661_10187532
1095 Ga0207679_10024019
1096 Ga0207679_10174594
1097 Ga0207679_10353300
1098 Ga0207667_10000802
1099 Ga0207667_10002103
1100 Ga0207667_10003423
1101 Ga0207667_10009617
1102 Ga0207667_10083946
1103 Ga0207667_10147728
1104 Ga0207651_10048620
1105 Ga0207651_10453117
1106 Ga0207651_10782449
1107 Ga0207640_10001895
1108 Ga0207640_10022509
1109 Ga0207640_10070809
1110 Ga0207640_10281350
1111 Ga0207658_10000198
1112 Ga0207658_10004698
1113 Ga0207658_10222641
1114 Ga0207677_10000023
1115 Ga0207677_10036798
1116 Ga0207677_10087345
1117 Ga0207677_10098819
1118 Ga0207677_10105630
1119 Ga0207677_10208159
1120 Ga0207703_10000694
1121 Ga0207703_10004024
1122 Ga0207703_10009264
1123 Ga0207703_10018124
1124 Ga0207703_10080868
1125 Ga0207703_10088607
1126 Ga0207703_10124927
1127 Ga0207703_10250852
1128 Ga0207639_10077710
1129 Ga0207639_10313427
1130 Ga0207639_10603101
1131 Ga0207639_10694457
1132 Ga0207678_10008145
1133 Ga0207708_10290866
1134 Ga0207702_10001549
1135 Ga0207702_10003277
1136 Ga0207702_10003755
1137 Ga0207702_10008675
1138 Ga0207702_10088838
1139 Ga0207702_10089572
1140 Ga0207641_10001403
1141 Ga0207641_10003323
1142 Ga0207641_10005549
1143 Ga0207641_10029002
1144 Ga0207641_10453049
1145 Ga0207641_10542458
1146 Ga0207648_10054793
1147 Ga0207648_10058148
1148 Ga0207648_10094997
1149 Ga0207676_10007858
1150 Ga0207676_10058946
1151 Ga0207676_10263929
1152 Ga0207676_10349223
1153 Ga0207674_10000125
1154 Ga0207674_10012847
1155 Ga0207674_10018530
1156 Ga0207674_10021961
1157 Ga0207674_10060839
1158 Ga0207674_10240380
1159 Ga0207675_100093708
1160 Ga0207675_100186339
1161 Ga0207683_10006653
1162 Ga0207683_10294315
1163 Ga0207698_10027184
1164 Ga0268266_10006089
1165 Ga0268265_10053464
1166 Ga0268265_10695054
1167 Ga0268264_10000086
1168 Ga0268264_10009593
1169 Ga0265338_10482538
1170 Ga0307408_101009743
1171 Ga0307409_100091336
1172 Ga0307416_101810858
1173 Ga0307411_10058363
1174 Ga0307411_10843914
1175 Ga0307415_100514726
1176 Ga0307510_10304415
1177 Ga0373926_0045659
1178 Ga0373939_0089390
1179 Ga0373945_0099146
1180 Ga0373960_0082068
1181 Ga0373943_0008126
1182 Ga0373946_0004672
1183 Ga0373924_0039596
1184 Ga0373931_0313523
1185 Ga0373927_0624081
1186 Ga0373947_0125463
1187 Ga0373947_0310884
1188 Ga0373925_0000629
1189 Ga0373925_0087892
1190 Ga0373925_0135374
1191 Ga0373925_0176324
1192 Ga0436363_1260175
1193 Ga0466961_0143473
1194 Ga0466963_0056132
1195 Ga0466970_0347237
1196 Ga0466959_0025287
1197 Ga0451576_1201132
1198 Ga0495603_0020295
1199 Ga0495603_0119054
1200 Ga0495603_0224370
1201 Ga0495629_0000003
1202 Ga0495629_0046079
1203 Ga0495638_0038216
1204 Ga0495580_0009802
1205 Ga0495582_0005018
1206 Ga0495582_0046622
1207 Ga0495639_0000005
1208 Ga0495594_0069421
1209 Ga0495594_0126864
1210 Ga0495594_0206333
1211 Ga0495630_0499822
1212 Ga0495632_0136416
1213 Ga0495666_0000012
1214 Ga0495665_0050668
1215 Ga0495665_0109877
1216 Ga0495640_0047295
1217 Ga0495640_0124181
1218 Ga0495586_0000232
1219 Ga0495586_0059804
1220 Ga0495587_0031982
1221 Ga0495645_0023512
1222 Ga0495622_0025383
1223 Ga0495622_0084709
1224 Ga0495625_0036945
1225 Ga0495657_0228608
1226 Ga0495599_0219243
1227 Ga0495647_0122759
1228 Ga0495658_0007239
1229 Ga0495658_0029966
1230 Ga0495658_0109230
1231 Ga0495658_0655352
1232 Ga0495613_0037552
1233 Ga0495613_0156624
1234 Ga0495624_0104852
1235 Ga0495671_0035900
1236 Ga0495581_0042814
1237 Ga0495581_0267098
1238 Ga0495674_0007368
1239 Ga0495674_0021314
1240 Ga0495674_0355300
1241 Ga0495676_0005033
1242 Ga0495673_0028254
1243 Ga0495684_0172284
1244 Ga0495593_0279250
1245 Ga0496100_0108733
1246 Ga0496100_0206069
1247 Ga0496101_0018361
1248 Ga0496101_0175993
1249 Ga0496102_0023503
1250 Ga0496102_0045351
1251 Ga0496102_0079160
1252 Ga0496103_0023847
1253 Ga0496103_0067553
1254 Ga0496103_0176219
1255 Ga0496104_0254670
1256 Ga0496104_0388581
1257 Ga0496104_0495961
1258 Ga0496106_0004386
1259 Ga0496106_0011293
1260 Ga0496106_0491405
1261 Ga0496107_0007080
1262 Ga0496108_0164545
1263 Ga0496109_0062838
1264 Ga0496109_0522118
1265 Ga0496112_0000962
1266 Ga0496112_0020338
1267 Ga0496112_0080628
1268 Ga0496112_0861054
1269 Ga0496113_0063397
1270 Ga0496113_0518136
1271 Ga0496113_0830683
1272 Ga0496114_0118490
1273 Ga0496114_0304546
1274 Ga0496114_0422684
1275 Ga0496115_0019255
1276 Ga0496115_0025193
1277 Ga0496115_0053701
1278 Ga0496115_0153001
1279 Ga0495682_0004236
1280 nmdc:mga03n38_223959_c1
1281 nmdc:mga00v17_407925_c1
1282 nmdc:mga0yw44_604475_c1
1283 nmdc:mga0k408_66276_c1
1284 nmdc:mga06z11_13463_c1
1285 nmdc:mga04h51_105546_c1
1286 nmdc:mga05p37_2921_c1
1287 nmdc:mga09592_306496_c2
1288 nmdc:mga06r32_14348_c1
1289 nmdc:mga08y16_129846_c1
1290 nmdc:mga08y16_333416_c1
1291 nmdc:mga0n895_110584_c1
1292 nmdc:mga0n895_146542_c1
1293 nmdc:mga0n895_33198_c1
1294 nmdc:mga0n895_55410_c1
1295 nmdc:mga0n895_9175_c1
1296 nmdc:mga0rr50_1042794_c1
1297 nmdc:mga0rr50_13632_c1
1298 nmdc:mga0rr50_21960_c1
1299 nmdc:mga0rr50_29951_c1
1300 nmdc:mga0rr50_442921_c1
1301 nmdc:mga0rr50_59243_c1
1302 nmdc:mga08x19_124_c1
1303 nmdc:mga08x19_174765_c1
1304 nmdc:mga08x19_334245_c1
1305 nmdc:mga0a205_11647_c1
1306 nmdc:mga0a205_28592_c1
1307 nmdc:mga0a205_349028_c1
1308 nmdc:mga0a205_48148_c1
1309 Ga0495601_0045658
1310 Ga0495612_0171895
1311 Ga0500556_0213290
1312 Ga0466962_0125820

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07638

Sigma70_ECF

ECF sigma factor

36

218

0.95

PF08281

Sigma70_r4_2

Sigma-70, region 4

159

212

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
4go1-assembly1.cif.gz_B-2 crystal structure of full length transcription repressor lsrr from e. coli. 0.9762 146 182
3hug-assembly1.cif.gz_C crystal structure of mycobacterium tuberculosis anti-sigma factor rsla in complex with -35 promoter binding domain of sigl 0.951 127 191
6jhe-assembly1.cif.gz_A crystal structure of bacillus subtilis sigw domain 4 in complexed with -35 element dna 0.9457 146 190
3hug-assembly2.cif.gz_E crystal structure of mycobacterium tuberculosis anti-sigma factor rsla in complex with -35 promoter binding domain of sigl 0.9401 127 191
2o8x-assembly1.cif.gz_B "crystal structure of the ""-35 element"" promoter recognition domain of mycobacterium tuberculosis sigc" 0.9219 127 185
ID Description Score Start End Superfamily
4go1B01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9762 146 182 1.10.10.10
3hugK00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9574 130 191 1.10.10.10
af_Q47274_1_118_1.20.140.160 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;PhyR, sigma-like (SL) domain 0.9525 129 191 1.20.140.160
3hugG00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.952 127 191 1.10.10.10
3hugC00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.951 127 191 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A2W0B3S9-F1-model_v4 RNA polymerase sigma-70 ECF-like HTH domain-containing protein 0.7558 69 195 GO:0003700
GO:0006352
AF-M5SUV5-F1-model_v4 ECF subfamily RNA polymerase sigma-24 factor 0.7175 72 193 GO:0006352
GO:0016987
AF-A0A7W1R9X3-F1-model_v4 Sigma-70 family RNA polymerase sigma factor 0.706 76 192 GO:0003700
GO:0006352
AF-A0A2V6PHA6-F1-model_v4 RNA polymerase subunit sigma 0.7053 70 191 GO:0006352
GO:0016987
AF-A0A3C1V9D8-F1-model_v4 RNA polymerase subunit sigma-24 0.7002 79 193 GO:0003700
GO:0006352

Map