F472960

General Info

Members Datasets Scaffolds Average Seq Length
655 279 541 190

Family's Representative Sequence

Representative Sequence 3300047320|Ga0495672_0001345|Ga0495672_0001345_22187_22834
Length 215
Sequence MNTSEAGMHAALFQERYRKEYRMLVVSLSGSPALKSRSGVVLEHARLWLQNHGVDVTTLRIRDFNAEDLLFAHFDSPQVLDFIEAVKQADGLLIGTPVYKASFSGALKTLLDLLPERSLHGKVVLPLATGGSIAHMLAVDYALKPVLSALKCQEVLHGIFAIDTQISYADNEQGGELDEILTERLQEGLEHFYLGLQHRLQARLKQAGGHLRLAL

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2510065053 Pseudomonas sp. MOIL14HWK12:I1 Isolate Rhizosphere
3 2510065055 Pseudomonas sp. MOIL14HWK12:I2 Isolate Rhizosphere
4 2510065058 Pseudomonas oleovorans MOIL14HWK12 Isolate Rhizosphere
5 2511231035 Pantoea sp. GM01 Isolate Rhizosphere
6 2554235234 Klebsiella michiganensis SA2 Isolate Unclassified
7 2585427591 Rahnella aquatilis OV744 Isolate Rhizosphere
8 2585427592 Rahnella aquatilis OV588 Isolate Rhizosphere
9 2599185155 Pseudomonas sp. NFACC10-1 Isolate Rhizoplane
10 2599185169 Klebsiella quasipneumoniae NFPP35 Isolate Rhizoplane
11 2599185307 Pseudomonas sp. NFACC02 Isolate Rhizoplane
12 2600255254 Klebsiella quasipneumoniae NFIX15 Isolate Rhizoplane
13 2600255255 Klebsiella quasipneumoniae NFIX23 Isolate Rhizoplane
14 2600255280 Klebsiella quasipneumoniae NFIX42 Isolate Rhizoplane
15 2600255281 Klebsiella quasipneumoniae NFIX43 Isolate Rhizoplane
16 2600255283 Pseudomonas sp. NFR16 Isolate Rhizoplane
17 2600255287 Klebsiella quasipneumoniae NFIX11 Isolate Rhizoplane
18 2600255288 Klebsiella quasipneumoniae NFIX14 Isolate Rhizoplane
19 2600255289 Klebsiella quasipneumoniae NFIX16 Isolate Rhizoplane
20 2600255290 Klebsiella quasipneumoniae NFIX17 Isolate Rhizoplane
21 2600255291 Klebsiella quasipneumoniae NFIX19 Isolate Rhizoplane
22 2600255298 Klebsiella quasipneumoniae NFIX21 Isolate Rhizoplane
23 2600255299 Klebsiella quasipneumoniae NFIX22 Isolate Rhizoplane
24 2600255300 Klebsiella quasipneumoniae NFIX30 Isolate Rhizoplane
25 2600255301 Klebsiella quasipneumoniae NFIX33 Isolate Rhizoplane
26 2600255302 Klebsiella quasipneumoniae NFIX35 Isolate Rhizoplane
27 2600255303 Klebsiella quasipneumoniae NFIX36 Isolate Rhizoplane
28 2600255304 Klebsiella quasipneumoniae NFIX37 Isolate Rhizoplane
29 2600255305 Klebsiella quasipneumoniae NFIX41 Isolate Rhizoplane
30 2600255306 Klebsiella quasipneumoniae NFIX44 Isolate Rhizoplane
31 2600255307 Klebsiella quasipneumoniae NFIX56 Isolate Rhizoplane
32 2600255309 Klebsiella sp. NFIX53 Isolate Rhizoplane
33 2600255392 Klebsiella quasipneumoniae NFIX54 Isolate Rhizoplane
34 2602042047 Enterobacter sp. NFIX59 Isolate Rhizoplane
35 2602042052 Klebsiella quasipneumoniae NFIX18 Isolate Rhizoplane
36 2602042053 Klebsiella quasipneumoniae NFIX12 Isolate Rhizoplane
37 2602042103 Klebsiella quasipneumoniae NFIX29 Isolate Rhizoplane
38 2602042104 Klebsiella quasipneumoniae NFIX26 Isolate Rhizoplane
39 2602042105 Klebsiella quasipneumoniae NFIX25 Isolate Rhizoplane
40 2602042106 Klebsiella quasipneumoniae NFIX13 Isolate Rhizoplane
41 2602042109 Klebsiella aerogenes NFIX39 Isolate Rhizoplane
42 2602042110 Klebsiella quasipneumoniae NFIX40 Isolate Rhizoplane
43 2602042111 Klebsiella quasipneumoniae NFIX20 Isolate Rhizoplane
44 2603880178 Klebsiella quasipneumoniae NFIX34 Isolate Rhizoplane
45 2603880184 Klebsiella quasipneumoniae NFIX27 Isolate Rhizoplane
46 2603880202 Klebsiella quasipneumoniae NFIX38 Isolate Rhizoplane
47 2603880211 Klebsiella quasipneumoniae NFIX24 Isolate Rhizoplane
48 2609459761 Enterobacter sp. NFR05 Isolate Rhizoplane
49 2636415599 Klebsiella variicola DX120E Isolate Unclassified
50 2667528172 Enterobacteriaceae bacterium NFIX31 Isolate Rhizoplane
51 2667528173 Rahnella sp. NFIX50 Isolate Rhizoplane
52 2675903046 Klebsiella quasipneumoniae NFIX52 Isolate Rhizoplane
53 2681812866 Enterobacter asburiae NFIX55 Isolate Rhizoplane
54 2681812869 Enterobacter ludwigii NFPP41 Isolate Rhizoplane
55 2706794495 Dickeya zeae ZJU1202 Isolate Unclassified
56 2711768156 Atlantibacter hermannii DDE1 Isolate Unclassified
57 2738541271 Pseudomonas sp. GV021 Isolate Unclassified
58 2738543016 Pseudomonas sp. GV012 Isolate Unclassified
59 2751185917 Enterobacter sp. HK169 Isolate Unclassified
60 2765235842 Enterobacter ludwigii AA4 Isolate Unclassified
61 2773857672 Pseudomonas sp. 1766 Isolate Unclassified
62 2775506706 Enterobacter asburiae 1216 Isolate Unclassified
63 2775507074 Klebsiella sp. D5A Isolate Unclassified
64 2791355275 Enterobacter sp. Sa187 Isolate Unclassified
65 2821118458 Enterobacter asburiae 609 Isolate Unclassified
66 2823373977 Enterobacter ludwigii NCR3 Isolate Rhizosphere
67 2826581358 Pseudomonas viridiflava CDRTc14 Isolate Unclassified
68 2842815866 Pseudomonas sp. R-72210 Isolate Unclassified
69 2842849001 Pseudomonas sp. R-72008 Isolate Unclassified
70 2844425489 Enterobacter cloacae SBP-8 Isolate Rhizosphere
71 2854601825 Dickeya dianthicola SS70 Isolate Stem Tuber
72 2881609920 Pantoea sp. ARC607 Isolate Rhizosphere
73 2884086401 Kluyvera sp. PO2S7 Isolate Rhizosphere
74 2891670763 Buttiauxella sp. B2 Isolate Rhizosphere
75 2904474040 Rahnella aquatilis 4485 Isolate Rhizosphere
76 2904504865 Serratia marcescens 1822 Isolate Unclassified
77 2904513164 Klebsiella variicola 1431 Isolate Rhizosphere
78 2908669403 Pantoea coffeiphila 1480 Isolate Rhizosphere
79 2917832318 Pseudomonas rhizoryzae RY24 Isolate Unclassified
80 2919108558 Klebsiella sp. 1400 Isolate Rhizosphere
81 2919125081 Pseudomonas psychrotolerans 1545 Isolate Rhizosphere
82 2919150387 Rahnella aceris 1817 Isolate Unclassified
83 2923634449 Enterobacter kobei SLBN-76 Isolate Rhizosphere
84 2927143783 Rahnella sp. 2050 Isolate Unclassified
85 2927833300 Enterobacter sp. SLBN-59 Isolate Rhizosphere
86 2937539931 Pantoea sp. LS15 Isolate Unclassified
87 2939568625 Lelliottia sp. 489 Isolate Rhizosphere
88 2939573065 Citrobacter sp. 506 Isolate Rhizosphere
89 2939602548 Pantoea dispersa 1175 Isolate Rhizosphere
90 2939607340 Leclercia sp. 1548 Isolate Rhizosphere
91 2939642701 Lelliottia nimipressuralis 2756 Isolate Rhizosphere
92 2945874760 Phytobacter diazotrophicus UAEU22 Isolate Rhizosphere
93 2969079654 Klebsiella variicola E57-7 Isolate Unclassified
94 2971820967 Klebsiella sp. MPUS7 Isolate Rhizosphere
95 2974298342 Pseudomonas sp. SORGH_AS 211 Isolate Unclassified
96 2974310843 Enterobacter sp. SORGH_AS 287 Isolate Unclassified
97 2978975091 Pantoea anthophila SORGH_AS 797 Isolate Unclassified
98 2984499530 Pseudomonas sp. SORGH_AS199 Isolate Aerial Root
99 2984504281 Pseudomonas psychrotolerans SORGH_AS201 Isolate Aerial Root
100 2984559226 Klebsiella variicola SORGH_AS834 Isolate Aerial Root
101 2984595703 Klebsiella variicola SORGH_AS1070 Isolate Aerial Root
102 3000376612 Enterobacteriaceae bacterium 4M9 Isolate Rhizosphere
103 3007803356 Pseudomonas sp. CM27 Isolate Unclassified
104 3007872151 Pseudomonas sp. SWRI51 Isolate Rhizosphere
105 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
106 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
107 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
108 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
109 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
110 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
111 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
112 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
113 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
114 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
115 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
116 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
117 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
118 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
119 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
120 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
121 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
122 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
123 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
124 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
125 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
126 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
127 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
128 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
129 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
130 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
131 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
132 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
133 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
134 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
135 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
136 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
137 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
138 3300015679 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.4_F08 Metagenome Unclassified
139 3300015680 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.2_H03 Metagenome Rhizosphere
140 3300015685 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 Metagenome Unclassified
141 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
142 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
143 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
144 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
145 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
146 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
147 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
148 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
149 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
150 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
151 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
152 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
153 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
161 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
162 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
164 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
165 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
166 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
167 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
168 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
169 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
170 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
171 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
172 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
173 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
174 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
175 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
176 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
177 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
178 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
179 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
180 3300042124 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 Metagenome Rhizosphere
181 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
182 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
183 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
184 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
185 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
186 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
187 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
188 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
189 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
190 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
191 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
192 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
193 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
194 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
195 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
196 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
197 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
198 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
199 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
200 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
201 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
202 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
203 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
204 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
205 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
206 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
207 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
208 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
209 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
210 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
211 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
212 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
213 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
214 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
215 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
216 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
217 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
218 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
219 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
220 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
221 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
222 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
223 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
224 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
225 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
226 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
227 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
228 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
229 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
230 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
231 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
232 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
233 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
234 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
235 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
236 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
237 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
238 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
239 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
240 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
241 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
242 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
243 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
244 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
245 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
246 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
247 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
248 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
249 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
250 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
251 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
252 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
253 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
254 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
255 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
256 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
257 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
258 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
259 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
260 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
261 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
262 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
263 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
264 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
265 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
266 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
267 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
268 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
269 651053060 Stutzerimonas stutzeri CMT.A.9 Isolate Rhizosphere
270 8016728285 Pseudomonas psychrotolerans SORGH_AS 227 Isolate Unclassified
271 8018221730 Enterobacter sp. CM29 Isolate Unclassified
272 8018405270 Enterobacter sp. 198 Isolate Rhizosphere
273 8054844752 Dryocola boscaweniae H18W14 Isolate Rhizosphere
274 8054849141 Dryocola clanedunensis H11S18 Isolate Rhizosphere
275 8055087960 Silvania hatchlandensis H19S6 Isolate Rhizosphere
276 8055092621 Silvania confinis H4N4 Isolate Rhizosphere
277 8055097453 Leclercia tamurae H6W5 Isolate Rhizosphere
278 8056137416 Pseudomonas fakonensis COW40 Isolate Rhizosphere
279 8057304971 Scandinavium manionii H17S15 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 82.6
Metatranscriptomes 0
Isolates 17.4

Biome Distribution

Category Percentage (%)
Aerial Root 0.61
Bulb 0
Endosphere 3.97
Nodule 1.98
Rhizoplane 9.16
Rhizosphere 63.82
Stem 0
Stem Tuber 0.15
Unclassified 20.31

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_2924103 2162886007 Bacteria 2627
2 SwRhRL2b_contig_3649351 2162886007 Bacteria 1365
3 SwRhRL2b_contig_39667 2162886007 Bacteria 5607
4 JGI25162J39368_1000035 3300002737 Bacteria 180993
5 JGI25163J39215_1000010 3300002771 Bacteria 91462
6 JGI25164J39214_1000019 3300002772 Bacteria 180993
7 JGI25152J39213_1000040 3300002773 Bacteria 88322
8 Ga0055538_1000039 3300003751 Bacteria 180993
9 Ga0055539_1000050 3300003752 Bacteria 180993
10 Ga0055533_1000062 3300003756 Bacteria 180993
11 Ga0055525_1000072 3300003759 Bacteria 180993
12 Ga0055541_1000038 3300003841 Bacteria 180993
13 Ga0058692_1000076 3300003856 Bacteria 75166
14 Ga0058692_1000189 3300003856 Bacteria 37488
15 Ga0058692_1000725 3300003856 Bacteria 13427
16 Ga0058692_1001176 3300003856 Bacteria 10046
17 Ga0058692_1002444 3300003856 Bacteria 6223
18 Ga0058692_1003145 3300003856 Bacteria 5236
19 Ga0058692_1019694 3300003856 Bacteria 1433
20 Ga0065714_10156385 3300005288 Bacteria 1076
21 Ga0065704_10000483 3300005289 Bacteria 67975
22 Ga0065704_10000557 3300005289 Bacteria 36666
23 Ga0065704_10000899 3300005289 Bacteria 11121
24 Ga0065704_10002477 3300005289 Bacteria 7996
25 Ga0065704_10004239 3300005289 Bacteria 6253
26 Ga0065704_10078280 3300005289 Bacteria 4473
27 Ga0065712_10067899 3300005290 Bacteria 22104
28 Ga0070668_100025152 3300005347 Bacteria 4513
29 Ga0070665_100000345 3300005548 Bacteria 70001
30 Ga0068857_100003546 3300005577 Bacteria 13047
31 Ga0075364_10007020 3300006051 Bacteria 6654
32 Ga0075364_10022858 3300006051 Bacteria 3954
33 Ga0075364_10124252 3300006051 Bacteria 1729
34 Ga0075436_100526954 3300006914 Bacteria 866
35 Ga0079104_1000114 3300006946 Bacteria 115700
36 Ga0079104_1001186 3300006946 Bacteria 18726
37 Ga0079104_1001217 3300006946 Bacteria 18222
38 Ga0079104_1002871 3300006946 Bacteria 8608
39 Ga0079104_1003033 3300006946 Bacteria 8238
40 Ga0079104_1006119 3300006946 Bacteria 4644
41 Ga0079104_1006977 3300006946 Bacteria 4167
42 Ga0105251_10000031 3300009011 Bacteria 124114
43 Ga0105251_10000274 3300009011 Bacteria 51694
44 Ga0105251_10000351 3300009011 Bacteria 45565
45 Ga0105251_10002740 3300009011 Bacteria 13490
46 Ga0105251_10002892 3300009011 Bacteria 12913
47 Ga0105251_10006083 3300009011 Bacteria 7776
48 Ga0105251_10006092 3300009011 Bacteria 7768
49 Ga0105251_10008034 3300009011 Bacteria 6399
50 Ga0105251_10032550 3300009011 Bacteria 2597
51 Ga0105251_10040111 3300009011 Bacteria 2284
52 Ga0105251_10041591 3300009011 Bacteria 2236
53 Ga0105251_10042821 3300009011 Bacteria 2195
54 Ga0105251_10195820 3300009011 Bacteria 911
55 Ga0105244_10000034 3300009036 Bacteria 168462
56 Ga0105244_10000085 3300009036 Bacteria 102531
57 Ga0105244_10000094 3300009036 Bacteria 94550
58 Ga0105244_10000231 3300009036 Bacteria 57614
59 Ga0105244_10000796 3300009036 Bacteria 26866
60 Ga0105244_10002948 3300009036 Bacteria 12546
61 Ga0105244_10003209 3300009036 Bacteria 11842
62 Ga0105244_10003792 3300009036 Bacteria 10665
63 Ga0105244_10010495 3300009036 Bacteria 5615
64 Ga0105244_10013511 3300009036 Bacteria 4769
65 Ga0105244_10069077 3300009036 Bacteria 1764
66 Ga0105244_10162343 3300009036 Bacteria 1066
67 Ga0105244_10163958 3300009036 Bacteria 1060
68 Ga0105250_10000003 3300009092 Bacteria 547770
69 Ga0105250_10000168 3300009092 Bacteria 56841
70 Ga0105250_10000191 3300009092 Bacteria 52429
71 Ga0105250_10000206 3300009092 Bacteria 49617
72 Ga0105250_10000360 3300009092 Bacteria 34622
73 Ga0105250_10004217 3300009092 Bacteria 6659
74 Ga0105250_10040936 3300009092 Bacteria 1858
75 Ga0105250_10169501 3300009092 Bacteria 913
76 Ga0105240_10442088 3300009093 Bacteria 1457
77 Ga0105243_10030328 3300009148 Bacteria 4162
78 Ga0105243_10063927 3300009148 Bacteria 2951
79 Ga0105246_10719663 3300011119 Bacteria 877
80 Ga0157373_10003817 3300013100 Bacteria 11396
81 Ga0157373_10017933 3300013100 Bacteria 5154
82 Ga0157373_10089056 3300013100 Bacteria 2174
83 Ga0157373_10649040 3300013100 Bacteria 771
84 Ga0157373_10922147 3300013100 Bacteria 649
85 Ga0157371_10000045 3300013102 Bacteria 189065
86 Ga0157371_10000177 3300013102 Bacteria 92877
87 Ga0157371_10002856 3300013102 Bacteria 16142
88 Ga0157371_10030360 3300013102 Bacteria 3899
89 Ga0157371_10120140 3300013102 Bacteria 1868
90 Ga0157371_10314839 3300013102 Bacteria 1135
91 Ga0157371_10315461 3300013102 Bacteria 1134
92 Ga0157371_10676903 3300013102 Bacteria 771
93 Ga0157370_10001685 3300013104 Bacteria 27219
94 Ga0157370_10002205 3300013104 Bacteria 23774
95 Ga0157370_10064044 3300013104 Bacteria 3481
96 Ga0157370_10466185 3300013104 Bacteria 1161
97 Ga0157370_11352603 3300013104 Bacteria 641
98 Ga0157369_10006552 3300013105 Bacteria 13479
99 Ga0157369_10296998 3300013105 Bacteria 1681
100 Ga0157369_10781434 3300013105 Bacteria 981
101 Ga0157369_11208684 3300013105 Bacteria 771
102 Ga0157372_10005067 3300013307 Bacteria 14002
103 Ga0157372_10058038 3300013307 Bacteria 4326
104 Ga0157372_10091487 3300013307 Bacteria 3460
105 Ga0157372_10162192 3300013307 Bacteria 2584
106 Ga0182008_10011124 3300014497 Bacteria 4800
107 Ga0182006_1000022 3300015261 Bacteria 275350
108 Ga0182005_1026147 3300015265 Bacteria 1592
109 Ga0183366_1001 3300015679 Bacteria 2743932
110 Ga0183370_1001 3300015680 Bacteria 2743932
111 Ga0183369_1001 3300015685 Bacteria 2743932
112 Ga0183368_1001 3300015687 Bacteria 2743932
113 Ga0163161_10063986 3300017792 Bacteria 2682
114 Ga0163161_10834418 3300017792 Bacteria 777
115 Ga0213876_10000016 3300021384 Bacteria 300175
116 Ga0209760_100002 3300025207 Bacteria 274743
117 Ga0209784_100001 3300025224 Bacteria 3600592
118 Ga0209566_100001 3300025225 Bacteria 3600765
119 Ga0209674_100002 3300025226 Bacteria 3600592
120 Ga0209563_100002 3300025230 Bacteria 2045675
121 Ga0207427_100012 3300025231 Bacteria 585657
122 Ga0209437_100001 3300025233 Bacteria 2045675
123 Ga0209677_100002 3300025253 Bacteria 2045675
124 Ga0209233_1006689 3300025261 Bacteria 3696
125 Ga0207696_1000003 3300025711 Bacteria 860639
126 Ga0207696_1000004 3300025711 Bacteria 671626
127 Ga0207696_1000077 3300025711 Bacteria 209611
128 Ga0207696_1000078 3300025711 Bacteria 207623
129 Ga0207696_1000287 3300025711 Bacteria 59175
130 Ga0207696_1000521 3300025711 Bacteria 31832
131 Ga0207696_1000535 3300025711 Bacteria 30862
132 Ga0207696_1004393 3300025711 Bacteria 6091
133 Ga0207655_1000001 3300025728 Bacteria 1866413
134 Ga0207655_1000009 3300025728 Bacteria 664676
135 Ga0207655_1000046 3300025728 Bacteria 309474
136 Ga0207655_1000102 3300025728 Bacteria 185859
137 Ga0207655_1000454 3300025728 Bacteria 53716
138 Ga0207655_1001903 3300025728 Bacteria 17914
139 Ga0207655_1001930 3300025728 Bacteria 17745
140 Ga0207655_1006840 3300025728 Bacteria 7492
141 Ga0207655_1018917 3300025728 Bacteria 3629
142 Ga0207655_1039982 3300025728 Bacteria 2030
143 Ga0207655_1083897 3300025728 Bacteria 1140
144 Ga0207713_1000010 3300025735 Bacteria 528374
145 Ga0207713_1000012 3300025735 Bacteria 501860
146 Ga0207713_1000040 3300025735 Bacteria 245322
147 Ga0207713_1000042 3300025735 Bacteria 242199
148 Ga0207713_1000346 3300025735 Bacteria 50868
149 Ga0207713_1011725 3300025735 Bacteria 4738
150 Ga0207713_1032943 3300025735 Bacteria 2269
151 Ga0207713_1038166 3300025735 Bacteria 2041
152 Ga0207713_1053169 3300025735 Bacteria 1597
153 Ga0207713_1156838 3300025735 Bacteria 729
154 Ga0207695_10456149 3300025913 Bacteria 1161
155 Ga0207709_10030120 3300025935 Bacteria 3154
156 Ga0207668_10020978 3300025972 Bacteria 4160
157 Ga0207674_10013066 3300026116 Bacteria 9243
158 Ga0209281_1000525 3300027111 Bacteria 49178
159 Ga0209281_1000535 3300027111 Bacteria 48029
160 Ga0209281_1001624 3300027111 Bacteria 12092
161 Ga0209281_1001638 3300027111 Bacteria 11952
162 Ga0209281_1003368 3300027111 Bacteria 5340
163 Ga0209281_1012801 3300027111 Bacteria 1829
164 Ga0209371_1000085 3300027312 Bacteria 179586
165 Ga0209371_1000413 3300027312 Bacteria 44119
166 Ga0209371_1000432 3300027312 Bacteria 42626
167 Ga0209371_1002398 3300027312 Bacteria 10538
168 Ga0209371_1002951 3300027312 Bacteria 8855
169 Ga0209371_1003717 3300027312 Bacteria 7166
170 Ga0268266_10000100 3300028379 Bacteria 180900
171 Ga0268256_1000048 3300030500 Bacteria 312298
172 Ga0268256_1000371 3300030500 Bacteria 42627
173 Ga0268256_1001557 3300030500 Bacteria 13479
174 Ga0268256_1001825 3300030500 Bacteria 11964
175 Ga0268256_1002171 3300030500 Bacteria 10407
176 Ga0268256_1002653 3300030500 Bacteria 8855
177 Ga0268256_1009169 3300030500 Bacteria 3319
178 Ga0307510_10148015 3300033180 Bacteria 1975
179 Ga0436365_1910565 3300039437 Bacteria 475219
180 Ga0439438_000001 3300041405 Bacteria 1263568
181 Ga0439438_002245 3300041405 Bacteria 8292
182 Ga0439438_002649 3300041405 Bacteria 7553
183 Ga0439438_008704 3300041405 Bacteria 3340
184 Ga0439438_033426 3300041405 Bacteria 1358
185 Ga0439447_002866 3300041407 Bacteria 6183
186 Ga0439447_004487 3300041407 Bacteria 4788
187 Ga0439447_005610 3300041407 Bacteria 4153
188 Ga0439461_0042778 3300041410 Bacteria 983
189 Ga0439466_0005745 3300041411 Bacteria 4732
190 Ga0439466_0059819 3300041411 Bacteria 1229
191 Ga0439465_0015721 3300041413 Bacteria 2360
192 Ga0451835_0220099 3300041492 Bacteria 785
193 Ga0451853_1608294 3300041512 Bacteria 7586
194 Ga0439432_007820 3300042006 Bacteria 3771
195 Ga0439432_011476 3300042006 Bacteria 3053
196 Ga0439432_042271 3300042006 Bacteria 1440
197 Ga0439432_062706 3300042006 Bacteria 1143
198 Ga0439451_001405 3300042009 Bacteria 4759
199 Ga0439452_000003 3300042010 Bacteria 942815
200 Ga0439452_000061 3300042010 Bacteria 101240
201 Ga0439452_000416 3300042010 Bacteria 24960
202 Ga0439452_007542 3300042010 Bacteria 3330
203 Ga0439456_000444 3300042013 Bacteria 9140
204 Ga0439463_001239 3300042016 Bacteria 6828
205 Ga0439463_048858 3300042016 Bacteria 1078
206 Ga0450911_000943 3300042115 Bacteria 7611
207 Ga0450919_006145 3300042121 Bacteria 1426
208 Ga0450922_003440 3300042124 Bacteria 1458
209 Ga0450890_000259 3300042127 Bacteria 7780
210 Ga0450902_009683 3300042137 Bacteria 1520
211 Ga0450902_028130 3300042137 Bacteria 943
212 Ga0450903_001100 3300042138 Bacteria 5135
213 Ga0450903_016753 3300042138 Bacteria 1149
214 Ga0450906_000802 3300042145 Bacteria 6878
215 Ga0450907_001362 3300042146 Bacteria 5388
216 Ga0450910_005296 3300042147 Bacteria 1756
217 Ga0439446_0002703 3300042156 Bacteria 4288
218 Ga0450908_000612 3300042184 Bacteria 6837
219 Ga0450909_001520 3300042185 Bacteria 3233
220 Ga0439434_0016456 3300042435 Bacteria 2209
221 Ga0439459_0000801 3300042438 Bacteria 4364
222 Ga0439464_0006499 3300042439 Bacteria 3048
223 Ga0439460_0000521 3300042461 Bacteria 8350
224 Ga0450918_019202 3300042531 Bacteria 1192
225 Ga0450893_0004391 3300042532 Bacteria 2247
226 Ga0450893_0038705 3300042532 Bacteria 868
227 Ga0451577_0312915 3300042876 Bacteria 1423
228 Ga0439440_0000802 3300042993 Bacteria 5441
229 Ga0495617_003609 3300046452 Bacteria 5780
230 Ga0495627_000013 3300046453 Bacteria 332765
231 Ga0495627_006105 3300046453 Bacteria 4755
232 Ga0495603_0134093 3300046455 Bacteria 1441
233 Ga0495591_000014 3300046458 Bacteria 254281
234 Ga0495591_000022 3300046458 Bacteria 199449
235 Ga0495591_000041 3300046458 Bacteria 155639
236 Ga0495591_000064 3300046458 Bacteria 123820
237 Ga0495591_000481 3300046458 Bacteria 31694
238 Ga0495591_000956 3300046458 Bacteria 19754
239 Ga0495591_002529 3300046458 Bacteria 10087
240 Ga0495591_003090 3300046458 Bacteria 8818
241 Ga0495591_035827 3300046458 Bacteria 1448
242 Ga0495638_0035749 3300046460 Bacteria 3165
243 Ga0495638_0090485 3300046460 Bacteria 1844
244 Ga0495641_0131769 3300046461 Bacteria 1116
245 Ga0495653_0005988 3300046463 Bacteria 9953
246 Ga0495650_0000018 3300046471 Bacteria 538888
247 Ga0495650_0000021 3300046471 Bacteria 531242
248 Ga0495650_0000032 3300046471 Bacteria 425389
249 Ga0495650_0001462 3300046471 Bacteria 22659
250 Ga0495650_0006670 3300046471 Bacteria 7155
251 Ga0495650_0018606 3300046471 Bacteria 3446
252 Ga0495650_0032841 3300046471 Bacteria 2316
253 Ga0495650_0056040 3300046471 Bacteria 1601
254 Ga0495605_0000212 3300046474 Bacteria 71789
255 Ga0495605_0000690 3300046474 Bacteria 25276
256 Ga0495605_0014803 3300046474 Bacteria 4258
257 Ga0495605_0026940 3300046474 Bacteria 2982
258 Ga0495605_0027322 3300046474 Bacteria 2958
259 Ga0495605_0029904 3300046474 Bacteria 2797
260 Ga0495605_0042767 3300046474 Bacteria 2249
261 Ga0495605_0087917 3300046474 Bacteria 1444
262 Ga0495584_0002883 3300046491 Bacteria 9603
263 Ga0495584_0065592 3300046491 Bacteria 1826
264 Ga0495585_0008461 3300046492 Bacteria 6236
265 Ga0495585_0044648 3300046492 Bacteria 2475
266 Ga0495585_0096834 3300046492 Bacteria 1583
267 Ga0495594_0000125 3300046499 Bacteria 35944
268 Ga0495596_0005144 3300046500 Bacteria 6228
269 Ga0495607_0000058 3300046501 Bacteria 109864
270 Ga0495607_0000936 3300046501 Bacteria 27159
271 Ga0495607_0003334 3300046501 Bacteria 12327
272 Ga0495607_0006103 3300046501 Bacteria 8522
273 Ga0495607_0022298 3300046501 Bacteria 3979
274 Ga0495607_0027621 3300046501 Bacteria 3506
275 Ga0495607_0028560 3300046501 Bacteria 3441
276 Ga0495607_0075573 3300046501 Bacteria 1866
277 Ga0495607_0091229 3300046501 Bacteria 1650
278 Ga0495607_0117964 3300046501 Bacteria 1397
279 Ga0495583_0000036 3300046506 Bacteria 246077
280 Ga0495583_0000465 3300046506 Bacteria 59902
281 Ga0495583_0001061 3300046506 Bacteria 30742
282 Ga0495583_0001532 3300046506 Bacteria 22912
283 Ga0495583_0006784 3300046506 Bacteria 7399
284 Ga0495606_0000483 3300046507 Bacteria 65224
285 Ga0495606_0000691 3300046507 Bacteria 52384
286 Ga0495606_0000810 3300046507 Bacteria 47559
287 Ga0495606_0009768 3300046507 Bacteria 8067
288 Ga0495606_0013017 3300046507 Bacteria 6613
289 Ga0495610_0003532 3300046512 Bacteria 12113
290 Ga0495610_0010542 3300046512 Bacteria 5731
291 Ga0495610_0066358 3300046512 Bacteria 1699
292 Ga0495616_0073533 3300046513 Bacteria 1649
293 Ga0495620_0000022 3300046515 Bacteria 136531
294 Ga0495620_0000039 3300046515 Bacteria 112877
295 Ga0495620_0004194 3300046515 Bacteria 8154
296 Ga0495620_0007145 3300046515 Bacteria 6086
297 Ga0495620_0008745 3300046515 Bacteria 5419
298 Ga0495620_0030834 3300046515 Bacteria 2463
299 Ga0495631_0002196 3300046518 Bacteria 11235
300 Ga0495631_0040559 3300046518 Bacteria 2062
301 Ga0495632_0000162 3300046519 Bacteria 69536
302 Ga0495632_0003351 3300046519 Bacteria 11416
303 Ga0495632_0009083 3300046519 Bacteria 6018
304 Ga0495632_0057031 3300046519 Bacteria 1907
305 Ga0495632_0073457 3300046519 Bacteria 1640
306 Ga0495637_0000284 3300046520 Bacteria 39651
307 Ga0495637_0003136 3300046520 Bacteria 8823
308 Ga0495637_0003862 3300046520 Bacteria 7862
309 Ga0495637_0031963 3300046520 Bacteria 2323
310 Ga0495637_0034847 3300046520 Bacteria 2202
311 Ga0495637_0036173 3300046520 Bacteria 2152
312 Ga0495637_0047833 3300046520 Bacteria 1803
313 Ga0495637_0163268 3300046520 Bacteria 834
314 Ga0495643_0001673 3300046522 Bacteria 19405
315 Ga0495643_0016669 3300046522 Bacteria 4314
316 Ga0495643_0021960 3300046522 Bacteria 3650
317 Ga0495643_0242661 3300046522 Bacteria 844
318 Ga0495643_0377084 3300046522 Bacteria 630
319 Ga0495644_0003494 3300046523 Bacteria 6215
320 Ga0495648_0001829 3300046524 Bacteria 20469
321 Ga0495648_0003030 3300046524 Bacteria 15039
322 Ga0495648_0009690 3300046524 Bacteria 7424
323 Ga0495648_0019565 3300046524 Bacteria 4756
324 Ga0495648_0028082 3300046524 Bacteria 3752
325 Ga0495654_0000049 3300046530 Bacteria 147151
326 Ga0495654_0000052 3300046530 Bacteria 145382
327 Ga0495654_0002862 3300046530 Bacteria 10841
328 Ga0495654_0009602 3300046530 Bacteria 5298
329 Ga0495654_0012320 3300046530 Bacteria 4596
330 Ga0495654_0028295 3300046530 Bacteria 2867
331 Ga0495654_0040231 3300046530 Bacteria 2330
332 Ga0495654_0042568 3300046530 Bacteria 2253
333 Ga0495654_0137147 3300046530 Bacteria 1093
334 Ga0495609_0000448 3300046538 Bacteria 33805
335 Ga0495609_0000631 3300046538 Bacteria 27394
336 Ga0495609_0019639 3300046538 Bacteria 3124
337 Ga0495609_0043051 3300046538 Bacteria 2027
338 Ga0495597_0000004 3300046542 Bacteria 307496
339 Ga0495597_0001194 3300046542 Bacteria 19448
340 Ga0495597_0039126 3300046542 Bacteria 2124
341 Ga0495597_0159990 3300046542 Bacteria 919
342 Ga0495645_0366783 3300046543 Bacteria 924
343 Ga0495633_0000140 3300046558 Bacteria 96787
344 Ga0495633_0207675 3300046558 Bacteria 898
345 Ga0495668_0107933 3300046616 Bacteria 1522
346 Ga0495668_0142785 3300046616 Bacteria 1310
347 Ga0495611_0000369 3300046648 Bacteria 29153
348 Ga0495611_0001100 3300046648 Bacteria 14250
349 Ga0495611_0011168 3300046648 Bacteria 3806
350 Ga0495625_0000089 3300046660 Bacteria 147075
351 Ga0495625_0003417 3300046660 Bacteria 15856
352 Ga0495661_0000004 3300046665 Bacteria 555340
353 Ga0495661_0000018 3300046665 Bacteria 200787
354 Ga0495661_0000061 3300046665 Bacteria 130811
355 Ga0495661_0000210 3300046665 Bacteria 67496
356 Ga0495661_0014169 3300046665 Bacteria 5341
357 Ga0495661_0051854 3300046665 Bacteria 2475
358 Ga0495588_0008577 3300046674 Bacteria 4695
359 Ga0495671_0002068 3300046692 Bacteria 12876
360 Ga0495671_0010219 3300046692 Bacteria 5212
361 Ga0495671_0018371 3300046692 Bacteria 3712
362 Ga0495671_0032565 3300046692 Bacteria 2662
363 Ga0495671_0081856 3300046692 Bacteria 1581
364 Ga0495649_0001245 3300046694 Bacteria 19590
365 Ga0495649_0001822 3300046694 Bacteria 15655
366 Ga0495649_0005503 3300046694 Bacteria 8034
367 Ga0495649_0005595 3300046694 Bacteria 7952
368 Ga0495649_0101593 3300046694 Bacteria 1528
369 Ga0495589_0002566 3300046794 Bacteria 10102
370 Ga0495589_0161773 3300046794 Bacteria 1066
371 Ga0495660_0000004 3300046810 Bacteria 1003183
372 Ga0495660_0000021 3300046810 Bacteria 293250
373 Ga0495660_0003946 3300046810 Bacteria 9066
374 Ga0495660_0004322 3300046810 Bacteria 8607
375 Ga0495660_0005400 3300046810 Bacteria 7651
376 Ga0495660_0031278 3300046810 Bacteria 2992
377 Ga0495660_0035826 3300046810 Bacteria 2769
378 Ga0495660_0059662 3300046810 Bacteria 2051
379 Ga0495660_0061629 3300046810 Bacteria 2012
380 Ga0495660_0135807 3300046810 Bacteria 1229
381 Ga0495660_0173311 3300046810 Bacteria 1049
382 Ga0495672_0000002 3300047320 Bacteria 740116
383 Ga0495672_0000199 3300047320 Bacteria 85658
384 Ga0495672_0001345 3300047320 Bacteria 24376
385 Ga0495672_0013732 3300047320 Bacteria 5573
386 Ga0495672_0057085 3300047320 Bacteria 2268
387 Ga0495672_0075530 3300047320 Bacteria 1895
388 Ga0495676_0000020 3300047321 Bacteria 166813
389 Ga0495676_0008681 3300047321 Bacteria 9302
390 Ga0495683_0000045 3300047323 Bacteria 131634
391 Ga0495683_0000207 3300047323 Bacteria 55998
392 Ga0495683_0054086 3300047323 Bacteria 2001
393 Ga0495683_0147011 3300047323 Bacteria 1100
394 Ga0495679_000020 3300047446 Bacteria 228413
395 Ga0495679_000211 3300047446 Bacteria 50030
396 Ga0495679_000397 3300047446 Bacteria 32816
397 Ga0495679_003027 3300047446 Bacteria 8261
398 Ga0495679_008660 3300047446 Bacteria 4118
399 Ga0495673_0000022 3300047469 Bacteria 544086
400 Ga0495673_0000095 3300047469 Bacteria 183429
401 Ga0495673_0000183 3300047469 Bacteria 101083
402 Ga0495673_0002454 3300047469 Bacteria 13031
403 Ga0495673_0013390 3300047469 Bacteria 4310
404 Ga0495673_0016714 3300047469 Bacteria 3744
405 Ga0495673_0073449 3300047469 Bacteria 1433
406 Ga0495673_0076950 3300047469 Bacteria 1390
407 Ga0495673_0091415 3300047469 Bacteria 1243
408 Ga0495681_0010664 3300047470 Bacteria 5549
409 Ga0495681_0017672 3300047470 Bacteria 3951
410 Ga0495681_0077050 3300047470 Bacteria 1497
411 Ga0495686_0145305 3300047472 Bacteria 1396
412 Ga0495686_0200605 3300047472 Bacteria 1145
413 Ga0495626_0000041 3300048091 Bacteria 172663
414 Ga0496100_0156295 3300048903 Bacteria 1631
415 Ga0496100_0428534 3300048903 Bacteria 1011
416 Ga0496101_0259544 3300048904 Bacteria 1355
417 Ga0496102_0118909 3300048905 Bacteria 2467
418 Ga0496102_0446190 3300048905 Bacteria 1214
419 Ga0496102_0479438 3300048905 Bacteria 1165
420 Ga0496104_0000148 3300048907 Bacteria 64805
421 Ga0496104_0001540 3300048907 Bacteria 19900
422 Ga0496104_0173424 3300048907 Bacteria 2067
423 Ga0496105_0007411 3300048908 Bacteria 8491
424 Ga0496105_0046644 3300048908 Bacteria 3576
425 Ga0496111_0716233 3300048914 Bacteria 727
426 Ga0496112_0618461 3300048915 Bacteria 1014
427 Ga0496112_0665890 3300048915 Bacteria 970
428 Ga0496113_0206716 3300048916 Bacteria 1562
429 Ga0496116_0000083 3300048919 Bacteria 220955
430 Ga0496116_0000797 3300048919 Bacteria 39955
431 Ga0496116_0001411 3300048919 Bacteria 27010
432 Ga0496116_0028002 3300048919 Bacteria 4091
433 Ga0496116_0044412 3300048919 Bacteria 3018
434 Ga0496116_0072323 3300048919 Bacteria 2180
435 Ga0496116_0095299 3300048919 Bacteria 1796
436 Ga0496116_0246466 3300048919 Bacteria 893
437 Ga0496117_0001185 3300048920 Bacteria 39192
438 Ga0496117_0002212 3300048920 Bacteria 25193
439 Ga0496117_0023687 3300048920 Bacteria 4881
440 Ga0496117_0080809 3300048920 Bacteria 2136
441 Ga0496117_0083261 3300048920 Bacteria 2092
442 Ga0496117_0113721 3300048920 Bacteria 1680
443 Ga0496117_0315567 3300048920 Bacteria 821
444 Ga0496117_0332506 3300048920 Bacteria 791
445 Ga0496118_0000456 3300048921 Bacteria 67691
446 Ga0496118_0001831 3300048921 Bacteria 30465
447 Ga0496118_0001995 3300048921 Bacteria 28933
448 Ga0496118_0018703 3300048921 Bacteria 6228
449 Ga0496118_0037516 3300048921 Bacteria 3898
450 Ga0496118_0116469 3300048921 Bacteria 1756
451 Ga0496118_0195172 3300048921 Bacteria 1206
452 Ga0496119_0000229 3300048922 Bacteria 78634
453 Ga0496119_0001404 3300048922 Bacteria 29156
454 Ga0496119_0015348 3300048922 Bacteria 5906
455 Ga0496119_0019215 3300048922 Bacteria 5045
456 Ga0496120_0000128 3300048923 Bacteria 127855
457 Ga0496120_0001476 3300048923 Bacteria 27987
458 Ga0496120_0005730 3300048923 Bacteria 9784
459 Ga0496120_0005864 3300048923 Bacteria 9600
460 Ga0496120_0022008 3300048923 Bacteria 4015
461 Ga0496120_0053907 3300048923 Bacteria 2283
462 Ga0496120_0078809 3300048923 Bacteria 1789
463 Ga0496120_0159581 3300048923 Bacteria 1125
464 Ga0496121_0002620 3300048924 Bacteria 27128
465 Ga0496121_0006978 3300048924 Bacteria 13743
466 Ga0496121_0010125 3300048924 Bacteria 10683
467 Ga0496121_0011082 3300048924 Bacteria 10059
468 Ga0496121_0023419 3300048924 Bacteria 5947
469 Ga0496121_0031729 3300048924 Bacteria 4819
470 Ga0496121_0058960 3300048924 Bacteria 3169
471 Ga0496121_0084228 3300048924 Bacteria 2507
472 Ga0496122_0000007 3300048925 Bacteria 606493
473 Ga0496122_0000285 3300048925 Bacteria 113073
474 Ga0496122_0000340 3300048925 Bacteria 100894
475 Ga0496122_0000623 3300048925 Bacteria 72623
476 Ga0496122_0000645 3300048925 Bacteria 70755
477 Ga0496122_0002556 3300048925 Bacteria 25569
478 Ga0496122_0022668 3300048925 Bacteria 5573
479 Ga0496122_0036052 3300048925 Bacteria 4009
480 Ga0496122_0084045 3300048925 Bacteria 2204
481 Ga0496122_0152180 3300048925 Bacteria 1426
482 Ga0496122_0164340 3300048925 Bacteria 1348
483 Ga0496122_0219675 3300048925 Bacteria 1092
484 Ga0496122_0232695 3300048925 Bacteria 1046
485 Ga0496123_0000004 3300048926 Bacteria 777230
486 Ga0496123_0000005 3300048926 Bacteria 658131
487 Ga0496123_0000232 3300048926 Bacteria 113073
488 Ga0496123_0000425 3300048926 Bacteria 76122
489 Ga0496123_0000469 3300048926 Bacteria 70755
490 Ga0496123_0004929 3300048926 Bacteria 13689
491 Ga0496123_0011036 3300048926 Bacteria 7887
492 Ga0496123_0027257 3300048926 Bacteria 4259
493 Ga0496123_0027994 3300048926 Bacteria 4182
494 Ga0496123_0047498 3300048926 Bacteria 2899
495 Ga0496123_0152172 3300048926 Bacteria 1246
496 Ga0496123_0199333 3300048926 Bacteria 1027
497 Ga0496123_0223071 3300048926 Bacteria 949
498 Ga0496123_0236353 3300048926 Bacteria 910
499 Ga0496124_0000280 3300048927 Bacteria 97221
500 Ga0496124_0000369 3300048927 Bacteria 82290
501 Ga0496124_0000845 3300048927 Bacteria 49946
502 Ga0496124_0000999 3300048927 Bacteria 44845
503 Ga0496124_0005182 3300048927 Bacteria 14820
504 Ga0496124_0008272 3300048927 Bacteria 10904
505 Ga0496124_0024045 3300048927 Bacteria 5547
506 Ga0496124_0029892 3300048927 Bacteria 4846
507 Ga0496124_0117519 3300048927 Bacteria 2130
508 Ga0496124_0119403 3300048927 Bacteria 2109
509 Ga0496124_0207705 3300048927 Bacteria 1484
510 Ga0496124_0263851 3300048927 Bacteria 1265
511 Ga0496124_0290820 3300048927 Bacteria 1186
512 Ga0496125_0000013 3300048928 Bacteria 628761
513 Ga0496125_0000055 3300048928 Bacteria 278140
514 Ga0496125_0009303 3300048928 Bacteria 10135
515 Ga0496125_0012898 3300048928 Bacteria 8252
516 Ga0496125_0020587 3300048928 Bacteria 6189
517 Ga0496125_0071432 3300048928 Bacteria 2711
518 Ga0496126_0000562 3300048929 Bacteria 71336
519 Ga0496126_0000650 3300048929 Bacteria 64468
520 Ga0496126_0001503 3300048929 Bacteria 36077
521 Ga0496126_0022456 3300048929 Bacteria 6139
522 Ga0496126_0032356 3300048929 Bacteria 4927
523 Ga0496126_0167730 3300048929 Bacteria 1872
524 Ga0496126_0372270 3300048929 Bacteria 1164
525 Ga0496126_0392929 3300048929 Bacteria 1126
526 Ga0496126_0774435 3300048929 Bacteria 738
527 Ga0495678_000037 3300049459 Bacteria 197851
528 Ga0495678_000118 3300049459 Bacteria 93371
529 Ga0495678_001777 3300049459 Bacteria 15961
530 Ga0495678_005047 3300049459 Bacteria 7423
531 Ga0495678_014182 3300049459 Bacteria 3713
532 Ga0495678_066398 3300049459 Bacteria 1336
533 Ga0495678_069075 3300049459 Bacteria 1300
534 Ga0495678_093781 3300049459 Bacteria 1052
535 Ga0495682_0000015 3300049460 Bacteria 235048
536 Ga0495682_0000467 3300049460 Bacteria 27926
537 nmdc:mga00v17_26657_c1 3300050491 Bacteria 3370
538 nmdc:mga00v17_27575_c1 3300050491 Bacteria 3318
539 nmdc:mga00v17_83135_c1 3300050491 Bacteria 2002
540 Ga0500618_002135 3300053125 Bacteria 7802
541 Ga0500621_000001 3300053126 Bacteria 1049698

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046543 Ga0495645_0366783 Ga0495645_0366783_38_565 165
2 3300009011 Ga0105251_10195820 Ga0105251_101958201 166
3 3300046458 Ga0495591_000064 Ga0495591_000064_15535_16065 166
4 3300046460 Ga0495638_0035749 Ga0495638_0035749_875_1405 166
5 3300048914 Ga0496111_0716233 Ga0496111_0716233_120_650 166
6 3300048926 Ga0496123_0011036 Ga0496123_0011036_16_546 166
7 3300048927 Ga0496124_0000845 Ga0496124_0000845_48728_49258 166
8 3300048927 Ga0496124_0263851 Ga0496124_0263851_176_727 169
9 3300041405 Ga0439438_033426 Ga0439438_033426_300_839 172
10 3300041407 Ga0439447_004487 Ga0439447_004487_93_632 172
11 3300041410 Ga0439461_0042778 Ga0439461_0042778_277_816 172
12 3300041411 Ga0439466_0059819 Ga0439466_0059819_171_710 172
13 3300041413 Ga0439465_0015721 Ga0439465_0015721_665_1204 172
14 3300042006 Ga0439432_042271 Ga0439432_042271_688_1227 172
15 3300042009 Ga0439451_001405 Ga0439451_001405_2298_2837 172
16 3300042013 Ga0439456_000444 Ga0439456_000444_6489_7028 172
17 3300042016 Ga0439463_001239 Ga0439463_001239_922_1461 172
18 3300042115 Ga0450911_000943 Ga0450911_000943_942_1481 172
19 3300042121 Ga0450919_006145 Ga0450919_006145_298_837 172
20 3300042124 Ga0450922_003440 Ga0450922_003440_631_1170 172
21 3300042127 Ga0450890_000259 Ga0450890_000259_912_1451 172
22 3300042137 Ga0450902_028130 Ga0450902_028130_331_870 172
23 3300042138 Ga0450903_001100 Ga0450903_001100_4087_4626 172
24 3300042145 Ga0450906_000802 Ga0450906_000802_1301_1840 172
25 3300042146 Ga0450907_001362 Ga0450907_001362_1188_1727 172
26 3300042147 Ga0450910_005296 Ga0450910_005296_686_1225 172
27 3300042156 Ga0439446_0002703 Ga0439446_0002703_352_891 172
28 3300042184 Ga0450908_000612 Ga0450908_000612_642_1181 172
29 3300042185 Ga0450909_001520 Ga0450909_001520_2338_2877 172
30 3300042435 Ga0439434_0016456 Ga0439434_0016456_1323_1862 172
31 3300042461 Ga0439460_0000521 Ga0439460_0000521_6890_7429 172
32 3300042531 Ga0450918_019202 Ga0450918_019202_140_679 172
33 3300042532 Ga0450893_0004391 Ga0450893_0004391_1314_1853 172
34 3300042993 Ga0439440_0000802 Ga0439440_0000802_992_1531 172
35 3300046520 Ga0495637_0003136 Ga0495637_0003136_1199_1738 172
36 3300046692 Ga0495671_0032565 Ga0495671_0032565_45_584 172
37 3300047323 Ga0495683_0000207 Ga0495683_0000207_51222_51761 172
38 3300049459 Ga0495678_005047 Ga0495678_005047_1199_1738 172
39 3300009148 Ga0105243_10030328 Ga0105243_100303283 173
40 3300013104 Ga0157370_10064044 Ga0157370_100640444 173
41 3300013307 Ga0157372_10058038 Ga0157372_100580381 173
42 3300046471 Ga0495650_0056040 Ga0495650_0056040_494_1036 173
43 3300046515 Ga0495620_0000039 Ga0495620_0000039_21525_22067 173
44 3300046519 Ga0495632_0003351 Ga0495632_0003351_8235_8777 173
45 3300046519 Ga0495632_0057031 Ga0495632_0057031_1213_1755 173
46 3300046522 Ga0495643_0001673 Ga0495643_0001673_1836_2378 173
47 3300046524 Ga0495648_0028082 Ga0495648_0028082_2667_3209 173
48 3300046692 Ga0495671_0018371 Ga0495671_0018371_530_1072 173
49 3300046810 Ga0495660_0059662 Ga0495660_0059662_1495_2037 173
50 3300048922 Ga0496119_0000229 Ga0496119_0000229_63066_63608 173
51 3300048923 Ga0496120_0001476 Ga0496120_0001476_11031_11573 173
52 3300048925 Ga0496122_0232695 Ga0496122_0232695_198_740 173
53 3300048926 Ga0496123_0223071 Ga0496123_0223071_195_737 173
54 3300048927 Ga0496124_0117519 Ga0496124_0117519_442_984 173
55 3300048927 Ga0496124_0290820 Ga0496124_0290820_175_717 173
56 iso_pu_bacteria 2511231035 2511434146 176
57 iso_pu_bacteria 2706794495 2707098520 176
58 iso_pu_bacteria 2854601825 2854604447 176
59 iso_pu_bacteria 2908669403 2908670760 176
60 iso_pu_bacteria 2939602548 2939602648 176
61 iso_pu_bacteria 2881609920 2881613221 177
62 iso_pu_bacteria 2978975091 2978976074 177
63 iso_pu_bacteria 2599185155 2599330645 179
64 iso_pu_bacteria 2599185307 2599973710 179
65 iso_pu_bacteria 2600255283 2601623488 179
66 iso_pu_bacteria 2711768156 2712469163 179
67 iso_pu_bacteria 2738541271 2738690705 179
68 iso_pu_bacteria 2738543016 2739266479 179
69 iso_pu_bacteria 2826581358 2826585119 179
70 iso_pu_bacteria 2842815866 2842818654 179
71 iso_pu_bacteria 2842849001 2842854249 179
72 3300003856 Ga0058692_1000076 Ga0058692_10000768 180
73 3300003856 Ga0058692_1000725 Ga0058692_10007257 180
74 3300003856 Ga0058692_1001176 Ga0058692_10011768 180
75 3300003856 Ga0058692_1019694 Ga0058692_10196941 180
76 3300005347 Ga0070668_100025152 Ga0070668_1000251522 180
77 3300006051 Ga0075364_10124252 Ga0075364_101242522 180
78 3300009011 Ga0105251_10002740 Ga0105251_100027406 180
79 3300011119 Ga0105246_10719663 Ga0105246_107196632 180
80 3300013100 Ga0157373_10003817 Ga0157373_100038178 180
81 3300013100 Ga0157373_10649040 Ga0157373_106490401 180
82 3300013102 Ga0157371_10002856 Ga0157371_100028567 180
83 3300013102 Ga0157371_10676903 Ga0157371_106769031 180
84 3300013104 Ga0157370_11352603 Ga0157370_113526031 180
85 3300013105 Ga0157369_10296998 Ga0157369_102969982 180
86 3300013105 Ga0157369_11208684 Ga0157369_112086841 180
87 3300013307 Ga0157372_10005067 Ga0157372_100050673 180
88 3300017792 Ga0163161_10834418 Ga0163161_108344181 180
89 3300025972 Ga0207668_10020978 Ga0207668_100209782 180
90 3300027312 Ga0209371_1000085 Ga0209371_100008528 180
91 3300027312 Ga0209371_1000413 Ga0209371_100041313 180
92 3300027312 Ga0209371_1002398 Ga0209371_10023987 180
93 3300027312 Ga0209371_1002951 Ga0209371_10029515 180
94 3300030500 Ga0268256_1000048 Ga0268256_100004828 180
95 3300030500 Ga0268256_1001557 Ga0268256_10015577 180
96 3300030500 Ga0268256_1002171 Ga0268256_10021715 180
97 3300030500 Ga0268256_1002653 Ga0268256_10026535 180
98 3300030500 Ga0268256_1009169 Ga0268256_10091692 180
99 3300041405 Ga0439438_000001 Ga0439438_000001_340640_341191 180
100 3300041405 Ga0439438_002245 Ga0439438_002245_5259_5813 180
101 3300041407 Ga0439447_002866 Ga0439447_002866_5135_5689 180
102 3300041407 Ga0439447_005610 Ga0439447_005610_1596_2147 180
103 3300042006 Ga0439432_007820 Ga0439432_007820_2098_2649 180
104 3300042006 Ga0439432_011476 Ga0439432_011476_2116_2670 180
105 3300042439 Ga0439464_0006499 Ga0439464_0006499_1578_2132 180
106 3300046452 Ga0495617_003609 Ga0495617_003609_2753_3304 180
107 3300046458 Ga0495591_000014 Ga0495591_000014_104485_105036 180
108 3300046458 Ga0495591_002529 Ga0495591_002529_1256_1807 180
109 3300046461 Ga0495641_0131769 Ga0495641_0131769_425_976 180
110 3300046471 Ga0495650_0000032 Ga0495650_0000032_156092_156643 180
111 3300046474 Ga0495605_0014803 Ga0495605_0014803_30_581 180
112 3300046474 Ga0495605_0026940 Ga0495605_0026940_969_1520 180
113 3300046491 Ga0495584_0002883 Ga0495584_0002883_6922_7473 180
114 3300046500 Ga0495596_0005144 Ga0495596_0005144_5326_5880 180
115 3300046501 Ga0495607_0091229 Ga0495607_0091229_499_1050 180
116 3300046507 Ga0495606_0000483 Ga0495606_0000483_49569_50120 180
117 3300046522 Ga0495643_0021960 Ga0495643_0021960_1320_1871 180
118 3300046524 Ga0495648_0009690 Ga0495648_0009690_3049_3600 180
119 3300046530 Ga0495654_0000049 Ga0495654_0000049_18387_18938 180
120 3300046530 Ga0495654_0000052 Ga0495654_0000052_51593_52144 180
121 3300046530 Ga0495654_0028295 Ga0495654_0028295_582_1133 180
122 3300046692 Ga0495671_0010219 Ga0495671_0010219_2922_3473 180
123 3300046810 Ga0495660_0000021 Ga0495660_0000021_6812_7363 180
124 3300047320 Ga0495672_0000002 Ga0495672_0000002_119750_120301 180
125 3300047323 Ga0495683_0054086 Ga0495683_0054086_1322_1873 180
126 3300047469 Ga0495673_0000095 Ga0495673_0000095_132848_133399 180
127 3300048905 Ga0496102_0446190 Ga0496102_0446190_159_731 180
128 3300048905 Ga0496102_0479438 Ga0496102_0479438_194_748 180
129 3300048919 Ga0496116_0000797 Ga0496116_0000797_6621_7172 180
130 3300048919 Ga0496116_0044412 Ga0496116_0044412_350_904 180
131 3300048922 Ga0496119_0001404 Ga0496119_0001404_26204_26755 180
132 3300048923 Ga0496120_0000128 Ga0496120_0000128_120496_121047 180
133 3300048929 Ga0496126_0167730 Ga0496126_0167730_671_1222 180
134 3300049459 Ga0495678_000118 Ga0495678_000118_67792_68343 180
135 3300049460 Ga0495682_0000015 Ga0495682_0000015_118123_118674 180
136 3300050491 nmdc:mga00v17_83135_c1 nmdc:mga00v17_83135_c1_786_1340 180
137 3300053126 Ga0500621_000001 Ga0500621_000001_755365_755916 180
138 3300005288 Ga0065714_10156385 Ga0065714_101563852 183
139 3300005290 Ga0065712_10067899 Ga0065712_100678999 183
140 3300006914 Ga0075436_100526954 Ga0075436_1005269541 183
141 3300009011 Ga0105251_10000031 Ga0105251_1000003120 183
142 3300009011 Ga0105251_10042821 Ga0105251_100428213 183
143 3300009036 Ga0105244_10000796 Ga0105244_1000079617 183
144 3300013100 Ga0157373_10017933 Ga0157373_100179331 183
145 3300013105 Ga0157369_10781434 Ga0157369_107814341 183
146 3300014497 Ga0182008_10011124 Ga0182008_100111243 183
147 3300015265 Ga0182005_1026147 Ga0182005_10261471 183
148 3300025728 Ga0207655_1001930 Ga0207655_100193014 183
149 3300025735 Ga0207713_1000042 Ga0207713_100004220 183
150 3300025735 Ga0207713_1156838 Ga0207713_11568381 183
151 3300033180 Ga0307510_10148015 Ga0307510_101480152 183
152 3300041411 Ga0439466_0005745 Ga0439466_0005745_296_877 183
153 3300042016 Ga0439463_048858 Ga0439463_048858_423_1004 183
154 3300046453 Ga0495627_000013 Ga0495627_000013_23521_24102 183
155 3300046453 Ga0495627_006105 Ga0495627_006105_2720_3301 183
156 3300046458 Ga0495591_000041 Ga0495591_000041_129924_130547 183
157 3300046458 Ga0495591_000481 Ga0495591_000481_23339_23920 183
158 3300046458 Ga0495591_003090 Ga0495591_003090_5011_5592 183
159 3300046458 Ga0495591_035827 Ga0495591_035827_362_943 183
160 3300046471 Ga0495650_0001462 Ga0495650_0001462_2097_2681 183
161 3300046471 Ga0495650_0006670 Ga0495650_0006670_4808_5389 183
162 3300046471 Ga0495650_0032841 Ga0495650_0032841_1304_1885 183
163 3300046474 Ga0495605_0000212 Ga0495605_0000212_46247_46828 183
164 3300046474 Ga0495605_0000690 Ga0495605_0000690_24609_25232 183
165 3300046474 Ga0495605_0027322 Ga0495605_0027322_1563_2144 183
166 3300046474 Ga0495605_0029904 Ga0495605_0029904_648_1229 183
167 3300046474 Ga0495605_0042767 Ga0495605_0042767_641_1222 183
168 3300046474 Ga0495605_0087917 Ga0495605_0087917_408_992 183
169 3300046491 Ga0495584_0065592 Ga0495584_0065592_976_1557 183
170 3300046492 Ga0495585_0044648 Ga0495585_0044648_1365_1946 183
171 3300046499 Ga0495594_0000125 Ga0495594_0000125_14116_14697 183
172 3300046501 Ga0495607_0000058 Ga0495607_0000058_2148_2729 183
173 3300046501 Ga0495607_0000936 Ga0495607_0000936_1420_2043 183
174 3300046501 Ga0495607_0003334 Ga0495607_0003334_3853_4434 183
175 3300046501 Ga0495607_0006103 Ga0495607_0006103_47_628 183
176 3300046501 Ga0495607_0022298 Ga0495607_0022298_329_910 183
177 3300046501 Ga0495607_0028560 Ga0495607_0028560_2704_3285 183
178 3300046501 Ga0495607_0075573 Ga0495607_0075573_1068_1652 183
179 3300046501 Ga0495607_0117964 Ga0495607_0117964_401_982 183
180 3300046506 Ga0495583_0000036 Ga0495583_0000036_220632_221213 183
181 3300046506 Ga0495583_0000465 Ga0495583_0000465_35510_36094 183
182 3300046506 Ga0495583_0001061 Ga0495583_0001061_4896_5501 183
183 3300046506 Ga0495583_0001532 Ga0495583_0001532_1461_2042 183
184 3300046506 Ga0495583_0006784 Ga0495583_0006784_425_1006 183
185 3300046507 Ga0495606_0000691 Ga0495606_0000691_25634_26215 183
186 3300046507 Ga0495606_0000810 Ga0495606_0000810_21788_22369 183
187 3300046507 Ga0495606_0013017 Ga0495606_0013017_846_1427 183
188 3300046512 Ga0495610_0003532 Ga0495610_0003532_1047_1631 183
189 3300046512 Ga0495610_0010542 Ga0495610_0010542_2572_3153 183
190 3300046512 Ga0495610_0066358 Ga0495610_0066358_48_629 183
191 3300046515 Ga0495620_0000022 Ga0495620_0000022_110939_111520 183
192 3300046515 Ga0495620_0004194 Ga0495620_0004194_1110_1691 183
193 3300046515 Ga0495620_0008745 Ga0495620_0008745_4350_4931 183
194 3300046515 Ga0495620_0030834 Ga0495620_0030834_543_1124 183
195 3300046518 Ga0495631_0002196 Ga0495631_0002196_9476_10057 183
196 3300046518 Ga0495631_0040559 Ga0495631_0040559_1058_1639 183
197 3300046519 Ga0495632_0000162 Ga0495632_0000162_23786_24370 183
198 3300046519 Ga0495632_0009083 Ga0495632_0009083_5343_5924 183
199 3300046519 Ga0495632_0073457 Ga0495632_0073457_550_1131 183
200 3300046520 Ga0495637_0000284 Ga0495637_0000284_26139_26720 183
201 3300046520 Ga0495637_0031963 Ga0495637_0031963_1435_2016 183
202 3300046520 Ga0495637_0034847 Ga0495637_0034847_1450_2034 183
203 3300046520 Ga0495637_0036173 Ga0495637_0036173_1177_1758 183
204 3300046520 Ga0495637_0047833 Ga0495637_0047833_788_1369 183
205 3300046520 Ga0495637_0163268 Ga0495637_0163268_49_672 183
206 3300046522 Ga0495643_0016669 Ga0495643_0016669_804_1385 183
207 3300046522 Ga0495643_0242661 Ga0495643_0242661_227_808 183
208 3300046523 Ga0495644_0003494 Ga0495644_0003494_397_978 183
209 3300046524 Ga0495648_0001829 Ga0495648_0001829_5101_5682 183
210 3300046524 Ga0495648_0003030 Ga0495648_0003030_13911_14492 183
211 3300046524 Ga0495648_0019565 Ga0495648_0019565_4054_4635 183
212 3300046530 Ga0495654_0002862 Ga0495654_0002862_6152_6733 183
213 3300046530 Ga0495654_0040231 Ga0495654_0040231_432_1013 183
214 3300046530 Ga0495654_0042568 Ga0495654_0042568_1629_2210 183
215 3300046530 Ga0495654_0137147 Ga0495654_0137147_366_947 183
216 3300046538 Ga0495609_0000448 Ga0495609_0000448_6533_7114 183
217 3300046538 Ga0495609_0000631 Ga0495609_0000631_24235_24816 183
218 3300046538 Ga0495609_0019639 Ga0495609_0019639_501_1085 183
219 3300046538 Ga0495609_0043051 Ga0495609_0043051_1331_1912 183
220 3300046542 Ga0495597_0000004 Ga0495597_0000004_25150_25773 183
221 3300046542 Ga0495597_0039126 Ga0495597_0039126_743_1324 183
222 3300046542 Ga0495597_0159990 Ga0495597_0159990_216_797 183
223 3300046558 Ga0495633_0000140 Ga0495633_0000140_24763_25344 183
224 3300046558 Ga0495633_0207675 Ga0495633_0207675_95_676 183
225 3300046616 Ga0495668_0107933 Ga0495668_0107933_579_1160 183
226 3300046616 Ga0495668_0142785 Ga0495668_0142785_552_1133 183
227 3300046648 Ga0495611_0000369 Ga0495611_0000369_27568_28149 183
228 3300046648 Ga0495611_0001100 Ga0495611_0001100_7324_7905 183
229 3300046648 Ga0495611_0011168 Ga0495611_0011168_129_710 183
230 3300046660 Ga0495625_0000089 Ga0495625_0000089_145968_146549 183
231 3300046665 Ga0495661_0000004 Ga0495661_0000004_10298_10879 183
232 3300046665 Ga0495661_0000018 Ga0495661_0000018_24019_24603 183
233 3300046665 Ga0495661_0000210 Ga0495661_0000210_26048_26629 183
234 3300046665 Ga0495661_0014169 Ga0495661_0014169_383_964 183
235 3300046665 Ga0495661_0051854 Ga0495661_0051854_424_1005 183
236 3300046692 Ga0495671_0002068 Ga0495671_0002068_6599_7180 183
237 3300046692 Ga0495671_0081856 Ga0495671_0081856_842_1423 183
238 3300046694 Ga0495649_0005503 Ga0495649_0005503_2011_2592 183
239 3300046794 Ga0495589_0002566 Ga0495589_0002566_4637_5218 183
240 3300046794 Ga0495589_0161773 Ga0495589_0161773_404_985 183
241 3300046810 Ga0495660_0003946 Ga0495660_0003946_3131_3712 183
242 3300046810 Ga0495660_0004322 Ga0495660_0004322_1326_1952 183
243 3300046810 Ga0495660_0005400 Ga0495660_0005400_3459_4082 183
244 3300046810 Ga0495660_0031278 Ga0495660_0031278_809_1390 183
245 3300046810 Ga0495660_0035826 Ga0495660_0035826_1345_1926 183
246 3300046810 Ga0495660_0061629 Ga0495660_0061629_1014_1595 183
247 3300046810 Ga0495660_0135807 Ga0495660_0135807_198_779 183
248 3300046810 Ga0495660_0173311 Ga0495660_0173311_94_678 183
249 3300047320 Ga0495672_0001345 Ga0495672_0001345_22187_22834 183
250 3300047320 Ga0495672_0013732 Ga0495672_0013732_496_1077 183
251 3300047320 Ga0495672_0057085 Ga0495672_0057085_1514_2095 183
252 3300047320 Ga0495672_0075530 Ga0495672_0075530_97_720 183
253 3300047321 Ga0495676_0000020 Ga0495676_0000020_138976_139557 183
254 3300047323 Ga0495683_0000045 Ga0495683_0000045_25092_25673 183
255 3300047323 Ga0495683_0147011 Ga0495683_0147011_467_1048 183
256 3300047446 Ga0495679_000211 Ga0495679_000211_25021_25602 183
257 3300047446 Ga0495679_000397 Ga0495679_000397_20536_21117 183
258 3300047469 Ga0495673_0000183 Ga0495673_0000183_93636_94217 183
259 3300047469 Ga0495673_0002454 Ga0495673_0002454_8048_8629 183
260 3300047469 Ga0495673_0013390 Ga0495673_0013390_419_1000 183
261 3300047469 Ga0495673_0016714 Ga0495673_0016714_969_1550 183
262 3300047469 Ga0495673_0073449 Ga0495673_0073449_48_629 183
263 3300047469 Ga0495673_0076950 Ga0495673_0076950_412_993 183
264 3300047469 Ga0495673_0091415 Ga0495673_0091415_581_1162 183
265 3300047470 Ga0495681_0010664 Ga0495681_0010664_4417_4998 183
266 3300047470 Ga0495681_0077050 Ga0495681_0077050_741_1322 183
267 3300047472 Ga0495686_0145305 Ga0495686_0145305_104_685 183
268 3300047472 Ga0495686_0200605 Ga0495686_0200605_78_659 183
269 3300048091 Ga0495626_0000041 Ga0495626_0000041_26374_26955 183
270 3300048905 Ga0496102_0118909 Ga0496102_0118909_406_987 183
271 3300048915 Ga0496112_0618461 Ga0496112_0618461_18_599 183
272 3300048915 Ga0496112_0665890 Ga0496112_0665890_294_875 183
273 3300048919 Ga0496116_0072323 Ga0496116_0072323_1211_1792 183
274 3300048920 Ga0496117_0083261 Ga0496117_0083261_1125_1706 183
275 3300048920 Ga0496117_0113721 Ga0496117_0113721_309_890 183
276 3300048924 Ga0496121_0002620 Ga0496121_0002620_649_1230 183
277 3300048924 Ga0496121_0031729 Ga0496121_0031729_2802_3383 183
278 3300048925 Ga0496122_0000285 Ga0496122_0000285_23564_24145 183
279 3300048925 Ga0496122_0002556 Ga0496122_0002556_22410_22991 183
280 3300048925 Ga0496122_0084045 Ga0496122_0084045_1411_1992 183
281 3300048926 Ga0496123_0000232 Ga0496123_0000232_88929_89510 183
282 3300048926 Ga0496123_0047498 Ga0496123_0047498_1835_2416 183
283 3300048927 Ga0496124_0000280 Ga0496124_0000280_71970_72551 183
284 3300048927 Ga0496124_0029892 Ga0496124_0029892_1434_2015 183
285 3300048927 Ga0496124_0207705 Ga0496124_0207705_399_980 183
286 3300049459 Ga0495678_000037 Ga0495678_000037_24784_25365 183
287 3300049459 Ga0495678_001777 Ga0495678_001777_515_1096 183
288 3300049459 Ga0495678_014182 Ga0495678_014182_37_618 183
289 3300049459 Ga0495678_069075 Ga0495678_069075_348_929 183
290 3300049460 Ga0495682_0000467 Ga0495682_0000467_1356_1937 183
291 iso_pu_bacteria 2904504865 2904505253 183
292 iso_pu_bacteria 2510065053 2510280867 184
293 iso_pu_bacteria 2510065055 2510295003 184
294 iso_pu_bacteria 2510065058 2510309014 184
295 iso_pu_bacteria 2773857672 2774132183 184
296 iso_pu_bacteria 2917832318 2917835131 184
297 iso_pu_bacteria 2919125081 2919130027 184
298 iso_pu_bacteria 2974298342 2974301215 184
299 iso_pu_bacteria 2984499530 2984503693 184
300 iso_pu_bacteria 2984504281 2984507732 184
301 iso_pu_bacteria 3000376612 3000379727 184
302 iso_pu_bacteria 8016728285 8016730121 184
303 3300046522 Ga0495643_0377084 Ga0495643_0377084_58_618 186
304 iso_pu_bacteria 3007803356 3007805025 186
305 iso_pu_bacteria 3007872151 3007873997 186
306 iso_pu_bacteria 651053060 651174145 186
307 iso_pu_bacteria 8056137416 8056142773 186
308 3300009036 Ga0105244_10010495 Ga0105244_100104952 187
309 3300009092 Ga0105250_10000003 Ga0105250_1000000356 187
310 3300025711 Ga0207696_1000004 Ga0207696_1000004578 187
311 3300047470 Ga0495681_0017672 Ga0495681_0017672_791_1366 187
312 3300048919 Ga0496116_0246466 Ga0496116_0246466_86_673 187
313 3300048925 Ga0496122_0164340 Ga0496122_0164340_373_960 187
314 3300048926 Ga0496123_0027257 Ga0496123_0027257_1962_2549 187
315 iso_pu_bacteria 2554235234 2555261332 187
316 iso_pu_bacteria 2585427591 2585827473 187
317 iso_pu_bacteria 2585427592 2585832458 187
318 iso_pu_bacteria 2599185169 2599410729 187
319 iso_pu_bacteria 2600255254 2601523628 187
320 iso_pu_bacteria 2600255255 2601528787 187
321 iso_pu_bacteria 2600255280 2601615620 187
322 iso_pu_bacteria 2600255281 2601620660 187
323 iso_pu_bacteria 2600255287 2601645507 187
324 iso_pu_bacteria 2600255288 2601649057 187
325 iso_pu_bacteria 2600255289 2601653671 187
326 iso_pu_bacteria 2600255290 2601659091 187
327 iso_pu_bacteria 2600255291 2601665506 187
328 iso_pu_bacteria 2600255298 2601698365 187
329 iso_pu_bacteria 2600255299 2601703653 187
330 iso_pu_bacteria 2600255300 2601707752 187
331 iso_pu_bacteria 2600255301 2601712811 187
332 iso_pu_bacteria 2600255302 2601716930 187
333 iso_pu_bacteria 2600255303 2601723591 187
334 iso_pu_bacteria 2600255304 2601724907 187
335 iso_pu_bacteria 2600255305 2601732190 187
336 iso_pu_bacteria 2600255306 2601737932 187
337 iso_pu_bacteria 2600255307 2601742662 187
338 iso_pu_bacteria 2600255309 2601752114 187
339 iso_pu_bacteria 2600255392 2602020561 187
340 iso_pu_bacteria 2602042047 2603643066 187
341 iso_pu_bacteria 2602042052 2603658803 187
342 iso_pu_bacteria 2602042053 2603668382 187
343 iso_pu_bacteria 2602042103 2603839276 187
344 iso_pu_bacteria 2602042104 2603844668 187
345 iso_pu_bacteria 2602042105 2603849433 187
346 iso_pu_bacteria 2602042106 2603854501 187
347 iso_pu_bacteria 2602042109 2603865815 187
348 iso_pu_bacteria 2602042110 2603870086 187
349 iso_pu_bacteria 2602042111 2603875039 187
350 iso_pu_bacteria 2603880178 2606047277 187
351 iso_pu_bacteria 2603880184 2606072804 187
352 iso_pu_bacteria 2603880202 2606146221 187
353 iso_pu_bacteria 2603880211 2606177147 187
354 iso_pu_bacteria 2609459761 2609910791 187
355 iso_pu_bacteria 2636415599 2637226125 187
356 iso_pu_bacteria 2667528172 2671102783 187
357 iso_pu_bacteria 2667528173 2671106829 187
358 iso_pu_bacteria 2675903046 2676407682 187
359 iso_pu_bacteria 2681812866 2681995433 187
360 iso_pu_bacteria 2681812869 2682007208 187
361 iso_pu_bacteria 2751185917 2753855384 187
362 iso_pu_bacteria 2765235842 2765588341 187
363 iso_pu_bacteria 2775506706 2775542134 187
364 iso_pu_bacteria 2775507074 2777020515 187
365 iso_pu_bacteria 2791355275 2793406003 187
366 iso_pu_bacteria 2821118458 2821119202 187
367 iso_pu_bacteria 2823373977 2823374130 187
368 iso_pu_bacteria 2844425489 2844426937 187
369 iso_pu_bacteria 2884086401 2884089595 187
370 iso_pu_bacteria 2891670763 2891673778 187
371 iso_pu_bacteria 2904474040 2904475789 187
372 iso_pu_bacteria 2904513164 2904517610 187
373 iso_pu_bacteria 2919108558 2919111645 187
374 iso_pu_bacteria 2919150387 2919151958 187
375 iso_pu_bacteria 2923634449 2923638828 187
376 iso_pu_bacteria 2927143783 2927144627 187
377 iso_pu_bacteria 2927833300 2927834689 187
378 iso_pu_bacteria 2937539931 2937543431 187
379 iso_pu_bacteria 2939568625 2939572731 187
380 iso_pu_bacteria 2939573065 2939574389 187
381 iso_pu_bacteria 2939607340 2939608080 187
382 iso_pu_bacteria 2939642701 2939644330 187
383 iso_pu_bacteria 2945874760 2945878692 187
384 iso_pu_bacteria 2969079654 2969083139 187
385 iso_pu_bacteria 2971820967 2971824522 187
386 iso_pu_bacteria 2974310843 2974312733 187
387 iso_pu_bacteria 2984559226 2984560159 187
388 iso_pu_bacteria 2984595703 2984598240 187
389 iso_pu_bacteria 8018221730 8018225475 187
390 iso_pu_bacteria 8018405270 8018407273 187
391 iso_pu_bacteria 8054844752 8054844833 187
392 iso_pu_bacteria 8054849141 8054849540 187
393 iso_pu_bacteria 8055087960 8055088657 187
394 iso_pu_bacteria 8055092621 8055094093 187
395 iso_pu_bacteria 8055097453 8055099518 187
396 iso_pu_bacteria 8057304971 8057305618 187
397 3300009011 Ga0105251_10032550 Ga0105251_100325504 188
398 3300009036 Ga0105244_10013511 Ga0105244_100135114 188
399 3300013102 Ga0157371_10030360 Ga0157371_100303602 188
400 3300013102 Ga0157371_10315461 Ga0157371_103154612 188
401 3300013105 Ga0157369_10006552 Ga0157369_100065524 188
402 3300013307 Ga0157372_10162192 Ga0157372_101621923 188
403 3300025728 Ga0207655_1018917 Ga0207655_10189173 188
404 3300025735 Ga0207713_1038166 Ga0207713_10381662 188
405 3300042138 Ga0450903_016753 Ga0450903_016753_84_671 188
406 3300042438 Ga0439459_0000801 Ga0439459_0000801_385_972 188
407 3300042532 Ga0450893_0038705 Ga0450893_0038705_36_623 188
408 3300048924 Ga0496121_0058960 Ga0496121_0058960_514_1101 188
409 3300048925 Ga0496122_0219675 Ga0496122_0219675_156_743 188
410 3300009011 Ga0105251_10000274 Ga0105251_1000027415 190
411 3300009036 Ga0105244_10069077 Ga0105244_100690772 190
412 3300009092 Ga0105250_10000191 Ga0105250_1000019117 190
413 3300009092 Ga0105250_10169501 Ga0105250_101695011 190
414 3300013102 Ga0157371_10000045 Ga0157371_10000045102 190
415 3300025711 Ga0207696_1000078 Ga0207696_1000078186 190
416 3300025728 Ga0207655_1039982 Ga0207655_10399822 190
417 3300025735 Ga0207713_1000010 Ga0207713_1000010318 190
418 3300042876 Ga0451577_0312915 Ga0451577_0312915_247_834 190
419 3300046455 Ga0495603_0134093 Ga0495603_0134093_333_926 190
420 3300046463 Ga0495653_0005988 Ga0495653_0005988_8896_9489 190
421 3300046492 Ga0495585_0008461 Ga0495585_0008461_4254_4847 190
422 3300046492 Ga0495585_0096834 Ga0495585_0096834_559_1152 190
423 3300046501 Ga0495607_0027621 Ga0495607_0027621_2491_3084 190
424 3300046507 Ga0495606_0009768 Ga0495606_0009768_2927_3520 190
425 3300046520 Ga0495637_0003862 Ga0495637_0003862_1008_1601 190
426 3300046665 Ga0495661_0000061 Ga0495661_0000061_79026_79619 190
427 3300046694 Ga0495649_0001245 Ga0495649_0001245_16152_16745 190
428 3300047321 Ga0495676_0008681 Ga0495676_0008681_2446_3039 190
429 3300049459 Ga0495678_066398 Ga0495678_066398_512_1105 190
430 3300049459 Ga0495678_093781 Ga0495678_093781_63_656 190
431 3300053125 Ga0500618_002135 Ga0500618_002135_4512_5105 190
432 2162886007 SwRhRL2b_contig_2924103 SwRhRL2b_0496.00006300 191
433 2162886007 SwRhRL2b_contig_3649351 SwRhRL2b_0549.00000890 191
434 2162886007 SwRhRL2b_contig_39667 SwRhRL2b_0513.00002960 191
435 3300002737 JGI25162J39368_1000035 JGI25162J39368_100003545 191
436 3300002771 JGI25163J39215_1000010 JGI25163J39215_100001073 191
437 3300002772 JGI25164J39214_1000019 JGI25164J39214_100001945 191
438 3300002773 JGI25152J39213_1000040 JGI25152J39213_100004078 191
439 3300003751 Ga0055538_1000039 Ga0055538_100003945 191
440 3300003752 Ga0055539_1000050 Ga0055539_1000050125 191
441 3300003756 Ga0055533_1000062 Ga0055533_100006245 191
442 3300003759 Ga0055525_1000072 Ga0055525_1000072125 191
443 3300003841 Ga0055541_1000038 Ga0055541_1000038125 191
444 3300003856 Ga0058692_1000189 Ga0058692_10001898 191
445 3300003856 Ga0058692_1002444 Ga0058692_10024441 191
446 3300003856 Ga0058692_1003145 Ga0058692_10031451 191
447 3300005289 Ga0065704_10000483 Ga0065704_1000048346 191
448 3300005289 Ga0065704_10000557 Ga0065704_1000055726 191
449 3300005289 Ga0065704_10000899 Ga0065704_100008996 191
450 3300005289 Ga0065704_10002477 Ga0065704_100024775 191
451 3300005289 Ga0065704_10004239 Ga0065704_100042394 191
452 3300005289 Ga0065704_10078280 Ga0065704_100782805 191
453 3300005548 Ga0070665_100000345 Ga0070665_10000034525 191
454 3300005577 Ga0068857_100003546 Ga0068857_1000035467 191
455 3300006051 Ga0075364_10007020 Ga0075364_100070202 191
456 3300006051 Ga0075364_10022858 Ga0075364_100228583 191
457 3300006946 Ga0079104_1000114 Ga0079104_100011428 191
458 3300006946 Ga0079104_1001186 Ga0079104_10011866 191
459 3300006946 Ga0079104_1001217 Ga0079104_10012176 191
460 3300006946 Ga0079104_1002871 Ga0079104_10028712 191
461 3300006946 Ga0079104_1003033 Ga0079104_10030336 191
462 3300006946 Ga0079104_1006119 Ga0079104_10061195 191
463 3300006946 Ga0079104_1006977 Ga0079104_10069773 191
464 3300009011 Ga0105251_10000351 Ga0105251_1000035127 191
465 3300009011 Ga0105251_10002892 Ga0105251_100028924 191
466 3300009011 Ga0105251_10006083 Ga0105251_100060835 191
467 3300009011 Ga0105251_10006092 Ga0105251_100060926 191
468 3300009011 Ga0105251_10008034 Ga0105251_100080344 191
469 3300009011 Ga0105251_10040111 Ga0105251_100401111 191
470 3300009011 Ga0105251_10041591 Ga0105251_100415912 191
471 3300009036 Ga0105244_10000034 Ga0105244_1000003425 191
472 3300009036 Ga0105244_10000085 Ga0105244_1000008559 191
473 3300009036 Ga0105244_10000094 Ga0105244_1000009458 191
474 3300009036 Ga0105244_10000231 Ga0105244_1000023116 191
475 3300009036 Ga0105244_10002948 Ga0105244_100029485 191
476 3300009036 Ga0105244_10003209 Ga0105244_100032095 191
477 3300009036 Ga0105244_10003792 Ga0105244_100037926 191
478 3300009036 Ga0105244_10162343 Ga0105244_101623432 191
479 3300009036 Ga0105244_10163958 Ga0105244_101639582 191
480 3300009092 Ga0105250_10000168 Ga0105250_1000016812 191
481 3300009092 Ga0105250_10000206 Ga0105250_1000020627 191
482 3300009092 Ga0105250_10000360 Ga0105250_1000036028 191
483 3300009092 Ga0105250_10004217 Ga0105250_100042174 191
484 3300009092 Ga0105250_10040936 Ga0105250_100409362 191
485 3300009093 Ga0105240_10442088 Ga0105240_104420882 191
486 3300009148 Ga0105243_10063927 Ga0105243_100639274 191
487 3300013100 Ga0157373_10089056 Ga0157373_100890562 191
488 3300013100 Ga0157373_10922147 Ga0157373_109221471 191
489 3300013102 Ga0157371_10000177 Ga0157371_1000017753 191
490 3300013102 Ga0157371_10120140 Ga0157371_101201402 191
491 3300013102 Ga0157371_10314839 Ga0157371_103148392 191
492 3300013104 Ga0157370_10001685 Ga0157370_1000168520 191
493 3300013104 Ga0157370_10002205 Ga0157370_1000220517 191
494 3300013104 Ga0157370_10466185 Ga0157370_104661852 191
495 3300013307 Ga0157372_10091487 Ga0157372_100914874 191
496 3300015261 Ga0182006_1000022 Ga0182006_100002245 191
497 3300015679 Ga0183366_1001 Ga0183366_1001715 191
498 3300015680 Ga0183370_1001 Ga0183370_1001715 191
499 3300015685 Ga0183369_1001 Ga0183369_1001715 191
500 3300015687 Ga0183368_1001 Ga0183368_1001715 191
501 3300017792 Ga0163161_10063986 Ga0163161_100639864 191
502 3300021384 Ga0213876_10000016 Ga0213876_10000016296 191
503 3300025207 Ga0209760_100002 Ga0209760_10000245 191
504 3300025224 Ga0209784_100001 Ga0209784_1000012712 191
505 3300025225 Ga0209566_100001 Ga0209566_1000012712 191
506 3300025226 Ga0209674_100002 Ga0209674_1000022712 191
507 3300025230 Ga0209563_100002 Ga0209563_1000021247 191
508 3300025231 Ga0207427_100012 Ga0207427_100012103 191
509 3300025233 Ga0209437_100001 Ga0209437_1000011247 191
510 3300025253 Ga0209677_100002 Ga0209677_1000021247 191
511 3300025261 Ga0209233_1006689 Ga0209233_10066892 191
512 3300025711 Ga0207696_1000003 Ga0207696_1000003826 191
513 3300025711 Ga0207696_1000077 Ga0207696_1000077174 191
514 3300025711 Ga0207696_1000287 Ga0207696_100028737 191
515 3300025711 Ga0207696_1000521 Ga0207696_100052124 191
516 3300025711 Ga0207696_1000535 Ga0207696_100053511 191
517 3300025711 Ga0207696_1004393 Ga0207696_10043933 191
518 3300025728 Ga0207655_1000001 Ga0207655_1000001796 191
519 3300025728 Ga0207655_1000009 Ga0207655_10000095 191
520 3300025728 Ga0207655_1000046 Ga0207655_100004663 191
521 3300025728 Ga0207655_1000102 Ga0207655_100010288 191
522 3300025728 Ga0207655_1000454 Ga0207655_10004543 191
523 3300025728 Ga0207655_1001903 Ga0207655_10019039 191
524 3300025728 Ga0207655_1006840 Ga0207655_10068405 191
525 3300025728 Ga0207655_1083897 Ga0207655_10838972 191
526 3300025735 Ga0207713_1000012 Ga0207713_1000012412 191
527 3300025735 Ga0207713_1000040 Ga0207713_1000040196 191
528 3300025735 Ga0207713_1000346 Ga0207713_100034614 191
529 3300025735 Ga0207713_1011725 Ga0207713_10117255 191
530 3300025735 Ga0207713_1032943 Ga0207713_10329432 191
531 3300025735 Ga0207713_1053169 Ga0207713_10531692 191
532 3300025913 Ga0207695_10456149 Ga0207695_104561492 191
533 3300025935 Ga0207709_10030120 Ga0207709_100301203 191
534 3300026116 Ga0207674_10013066 Ga0207674_100130666 191
535 3300027111 Ga0209281_1000525 Ga0209281_100052527 191
536 3300027111 Ga0209281_1000535 Ga0209281_100053513 191
537 3300027111 Ga0209281_1001624 Ga0209281_10016242 191
538 3300027111 Ga0209281_1001638 Ga0209281_10016382 191
539 3300027111 Ga0209281_1003368 Ga0209281_10033682 191
540 3300027111 Ga0209281_1012801 Ga0209281_10128012 191
541 3300027312 Ga0209371_1000432 Ga0209371_100043214 191
542 3300027312 Ga0209371_1003717 Ga0209371_10037176 191
543 3300028379 Ga0268266_10000100 Ga0268266_10000100148 191
544 3300030500 Ga0268256_1000371 Ga0268256_100037114 191
545 3300030500 Ga0268256_1001825 Ga0268256_10018251 191
546 3300039437 Ga0436365_1910565 Ga0436365_1910565_188139_188720 191
547 3300041405 Ga0439438_002649 Ga0439438_002649_1254_1829 191
548 3300041405 Ga0439438_008704 Ga0439438_008704_150_725 191
549 3300041492 Ga0451835_0220099 Ga0451835_0220099_96_671 191
550 3300041512 Ga0451853_1608294 Ga0451853_1608294_2173_2748 191
551 3300042006 Ga0439432_062706 Ga0439432_062706_280_855 191
552 3300042010 Ga0439452_000003 Ga0439452_000003_192645_193220 191
553 3300042010 Ga0439452_000061 Ga0439452_000061_67146_67721 191
554 3300042010 Ga0439452_000416 Ga0439452_000416_5157_5732 191
555 3300042010 Ga0439452_007542 Ga0439452_007542_2481_3056 191
556 3300042137 Ga0450902_009683 Ga0450902_009683_536_1111 191
557 3300046458 Ga0495591_000022 Ga0495591_000022_142506_143081 191
558 3300046458 Ga0495591_000956 Ga0495591_000956_4763_5338 191
559 3300046460 Ga0495638_0090485 Ga0495638_0090485_563_1138 191
560 3300046471 Ga0495650_0000018 Ga0495650_0000018_398677_399258 191
561 3300046471 Ga0495650_0000021 Ga0495650_0000021_290560_291135 191
562 3300046471 Ga0495650_0018606 Ga0495650_0018606_410_1018 191
563 3300046513 Ga0495616_0073533 Ga0495616_0073533_986_1561 191
564 3300046515 Ga0495620_0007145 Ga0495620_0007145_4952_5527 191
565 3300046530 Ga0495654_0009602 Ga0495654_0009602_3844_4419 191
566 3300046530 Ga0495654_0012320 Ga0495654_0012320_3491_4066 191
567 3300046542 Ga0495597_0001194 Ga0495597_0001194_18163_18738 191
568 3300046660 Ga0495625_0003417 Ga0495625_0003417_8436_9011 191
569 3300046674 Ga0495588_0008577 Ga0495588_0008577_597_1172 191
570 3300046694 Ga0495649_0001822 Ga0495649_0001822_4240_4815 191
571 3300046694 Ga0495649_0005595 Ga0495649_0005595_3111_3686 191
572 3300046694 Ga0495649_0101593 Ga0495649_0101593_560_1135 191
573 3300046810 Ga0495660_0000004 Ga0495660_0000004_646522_647103 191
574 3300047320 Ga0495672_0000199 Ga0495672_0000199_68750_69325 191
575 3300047446 Ga0495679_000020 Ga0495679_000020_137801_138376 191
576 3300047446 Ga0495679_003027 Ga0495679_003027_4479_5054 191
577 3300047446 Ga0495679_008660 Ga0495679_008660_3342_3950 191
578 3300047469 Ga0495673_0000022 Ga0495673_0000022_36134_36709 191
579 3300048903 Ga0496100_0156295 Ga0496100_0156295_251_826 191
580 3300048903 Ga0496100_0428534 Ga0496100_0428534_413_988 191
581 3300048904 Ga0496101_0259544 Ga0496101_0259544_327_902 191
582 3300048907 Ga0496104_0000148 Ga0496104_0000148_26726_27301 191
583 3300048907 Ga0496104_0001540 Ga0496104_0001540_13648_14229 191
584 3300048907 Ga0496104_0173424 Ga0496104_0173424_426_1034 191
585 3300048908 Ga0496105_0007411 Ga0496105_0007411_1680_2255 191
586 3300048908 Ga0496105_0046644 Ga0496105_0046644_186_794 191
587 3300048916 Ga0496113_0206716 Ga0496113_0206716_648_1223 191
588 3300048919 Ga0496116_0000083 Ga0496116_0000083_197910_198491 191
589 3300048919 Ga0496116_0001411 Ga0496116_0001411_14356_14931 191
590 3300048919 Ga0496116_0028002 Ga0496116_0028002_617_1192 191
591 3300048919 Ga0496116_0095299 Ga0496116_0095299_936_1511 191
592 3300048920 Ga0496117_0001185 Ga0496117_0001185_8161_8736 191
593 3300048920 Ga0496117_0002212 Ga0496117_0002212_14959_15534 191
594 3300048920 Ga0496117_0023687 Ga0496117_0023687_575_1156 191
595 3300048920 Ga0496117_0080809 Ga0496117_0080809_774_1355 191
596 3300048920 Ga0496117_0315567 Ga0496117_0315567_207_782 191
597 3300048920 Ga0496117_0332506 Ga0496117_0332506_179_754 191
598 3300048921 Ga0496118_0000456 Ga0496118_0000456_56899_57480 191
599 3300048921 Ga0496118_0001831 Ga0496118_0001831_22465_23046 191
600 3300048921 Ga0496118_0001995 Ga0496118_0001995_20974_21549 191
601 3300048921 Ga0496118_0018703 Ga0496118_0018703_5561_6136 191
602 3300048921 Ga0496118_0037516 Ga0496118_0037516_3030_3638 191
603 3300048921 Ga0496118_0116469 Ga0496118_0116469_157_732 191
604 3300048921 Ga0496118_0195172 Ga0496118_0195172_467_1042 191
605 3300048922 Ga0496119_0015348 Ga0496119_0015348_4792_5400 191
606 3300048922 Ga0496119_0019215 Ga0496119_0019215_3770_4351 191
607 3300048923 Ga0496120_0005730 Ga0496120_0005730_8040_8615 191
608 3300048923 Ga0496120_0005864 Ga0496120_0005864_4200_4808 191
609 3300048923 Ga0496120_0022008 Ga0496120_0022008_2152_2733 191
610 3300048923 Ga0496120_0053907 Ga0496120_0053907_991_1566 191
611 3300048923 Ga0496120_0078809 Ga0496120_0078809_103_678 191
612 3300048923 Ga0496120_0159581 Ga0496120_0159581_437_1012 191
613 3300048924 Ga0496121_0006978 Ga0496121_0006978_9563_10138 191
614 3300048924 Ga0496121_0010125 Ga0496121_0010125_9908_10483 191
615 3300048924 Ga0496121_0011082 Ga0496121_0011082_3132_3707 191
616 3300048924 Ga0496121_0023419 Ga0496121_0023419_4747_5322 191
617 3300048924 Ga0496121_0084228 Ga0496121_0084228_1306_1881 191
618 3300048925 Ga0496122_0000007 Ga0496122_0000007_512485_513066 191
619 3300048925 Ga0496122_0000340 Ga0496122_0000340_66904_67479 191
620 3300048925 Ga0496122_0000623 Ga0496122_0000623_39752_40333 191
621 3300048925 Ga0496122_0000645 Ga0496122_0000645_39913_40488 191
622 3300048925 Ga0496122_0022668 Ga0496122_0022668_3072_3647 191
623 3300048925 Ga0496122_0036052 Ga0496122_0036052_1303_1878 191
624 3300048925 Ga0496122_0152180 Ga0496122_0152180_668_1243 191
625 3300048926 Ga0496123_0000004 Ga0496123_0000004_264164_264745 191
626 3300048926 Ga0496123_0000005 Ga0496123_0000005_66784_67359 191
627 3300048926 Ga0496123_0000425 Ga0496123_0000425_35592_36173 191
628 3300048926 Ga0496123_0000469 Ga0496123_0000469_30268_30843 191
629 3300048926 Ga0496123_0004929 Ga0496123_0004929_9941_10516 191
630 3300048926 Ga0496123_0027994 Ga0496123_0027994_2207_2782 191
631 3300048926 Ga0496123_0152172 Ga0496123_0152172_230_838 191
632 3300048926 Ga0496123_0199333 Ga0496123_0199333_317_892 191
633 3300048926 Ga0496123_0236353 Ga0496123_0236353_70_660 191
634 3300048927 Ga0496124_0000369 Ga0496124_0000369_53797_54378 191
635 3300048927 Ga0496124_0000999 Ga0496124_0000999_29928_30503 191
636 3300048927 Ga0496124_0005182 Ga0496124_0005182_11203_11778 191
637 3300048927 Ga0496124_0008272 Ga0496124_0008272_4814_5389 191
638 3300048927 Ga0496124_0024045 Ga0496124_0024045_1364_1939 191
639 3300048927 Ga0496124_0119403 Ga0496124_0119403_1259_1834 191
640 3300048928 Ga0496125_0000013 Ga0496125_0000013_68257_68838 191
641 3300048928 Ga0496125_0000055 Ga0496125_0000055_43595_44170 191
642 3300048928 Ga0496125_0009303 Ga0496125_0009303_1425_2000 191
643 3300048928 Ga0496125_0012898 Ga0496125_0012898_1711_2286 191
644 3300048928 Ga0496125_0020587 Ga0496125_0020587_4823_5398 191
645 3300048928 Ga0496125_0071432 Ga0496125_0071432_1576_2151 191
646 3300048929 Ga0496126_0000562 Ga0496126_0000562_46496_47077 191
647 3300048929 Ga0496126_0000650 Ga0496126_0000650_51730_52305 191
648 3300048929 Ga0496126_0001503 Ga0496126_0001503_11566_12141 191
649 3300048929 Ga0496126_0022456 Ga0496126_0022456_4533_5108 191
650 3300048929 Ga0496126_0032356 Ga0496126_0032356_261_836 191
651 3300048929 Ga0496126_0372270 Ga0496126_0372270_457_1032 191
652 3300048929 Ga0496126_0392929 Ga0496126_0392929_137_712 191
653 3300048929 Ga0496126_0774435 Ga0496126_0774435_71_646 191
654 3300050491 nmdc:mga00v17_26657_c1 nmdc:mga00v17_26657_c1_2012_2587 191
655 3300050491 nmdc:mga00v17_27575_c1 nmdc:mga00v17_27575_c1_1917_2492 191

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03358

FMN_red

NADPH-dependent FMN reductase

23

166

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
6dqp-assembly1.cif.gz_A crystal structure of ssue fmn reductase delta118 mutant in apo form 0.9389 1 173
4pty-assembly1.cif.gz_D crystal structure of the escherichia coli alkanesulfonate fmn reductase ssue in apo form 0.9388 1 174
6dqo-assembly1.cif.gz_A-2 crystal structure of ssue fmn reductase y118a mutant in fmn bound form. 0.9367 1 173
6dqp-assembly1.cif.gz_A crystal structure of ssue fmn reductase delta118 mutant in apo form 0.9336 1 173
6dqo-assembly1.cif.gz_A-2 crystal structure of ssue fmn reductase y118a mutant in fmn bound form. 0.9315 1 173
ID Description Score Start End Superfamily
6dqpA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.9389 1 173 3.40.50.360
6dqpA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.9336 1 173 3.40.50.360
4ltnA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.8801 2 171 3.40.50.360
af_Q2G135_1_177_3.40.50.360 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.8063 1 176 3.40.50.360
af_Q2G135_1_177_3.40.50.360 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.7981 1 176 3.40.50.360
ID Description Score Start End GO Terms
AF-A0A376SQ25-F1-model_v4 deleted 0.9624 1 108
AF-A0A2X3GWD3-F1-model_v4 FMN reductase (EC 1.5.1.38) 0.9521 1 104 GO:0052873
AF-A0A6I6DU54-F1-model_v4 NADPH-dependent FMN reductase (EC 1.5.1.38) 0.9444 1 176 GO:0008752
GO:0046306
GO:0052873
AF-A0A3M6GHQ3-F1-model_v4 NADPH-dependent FMN reductase-like domain-containing protein 0.9438 1 110 GO:0016655
AF-A0A2T6KFI2-F1-model_v4 SsuE family FMN reductase 0.9388 2 102 GO:0016491

Feature Viewer

pLDDT pTM Quality
88.34 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map