F472800

General Info

Members Datasets Scaffolds Average Seq Length
653 229 1306 251

Family's Representative Sequence

Representative Sequence 3300047444|Ga0495675_0147637|Ga0495675_0147637_454_1377
Length 307
Sequence VEFGLVGEHRQRVPALVRVHHQEVDRVGTDVQNTKSHTLTLLGRAKAYPPARSSEGGAVAAATHGIRIEPGHKRVRAYLDGELVADTLRPVLVWEWPYYPVYYLPAGDIRAELVAAGRAEHSPSRGDAEVFHVKVATATADGAALRYPSSPLEQLRDLVRLDWNSMTEWLEEDEPVYTHPRDPYKRVDILASSRHVRVEVDGVTVADSAQPRILFETGLPPRYYLPLTDLRMDLLRPSATQSHCPYKGTASYWSVDTGKGVHQDLVWMYRSPLAESQKIAGLACLYNEKVDLYLDGEPQERPHTHFS

Samples

Sample ID Description Type Environment
1 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
4 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
5 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
6 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
7 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
8 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
9 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
10 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
11 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
12 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
13 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
14 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
15 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
16 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
17 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
20 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
21 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
22 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
25 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
26 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
27 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
28 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
29 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
30 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
31 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
32 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
33 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
34 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
35 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
36 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
37 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
38 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
39 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
40 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
41 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
42 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
43 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
44 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
45 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
46 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
47 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
48 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
49 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
50 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
52 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
53 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
54 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
55 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
56 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
57 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
58 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
59 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
60 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
61 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
62 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
63 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
64 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
65 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
66 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
67 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
68 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
69 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
102 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
103 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
104 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
105 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
106 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
107 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
108 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
109 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
110 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
111 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
112 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
113 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
114 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
115 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
116 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
117 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
118 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
119 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
120 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
121 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
122 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
123 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
124 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
125 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
126 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
127 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
128 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
129 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
130 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
131 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
132 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
133 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
134 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
135 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
136 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
137 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
138 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
139 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
140 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
141 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
142 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
143 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
144 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
145 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
146 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
147 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
148 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
149 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
150 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
151 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
152 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
153 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
154 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
155 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
156 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
157 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
158 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
159 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
160 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
161 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
162 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
163 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
164 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
165 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
166 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
167 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
168 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
169 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
170 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
171 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
172 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
173 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
174 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
175 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
176 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
177 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
178 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
179 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
180 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
181 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
182 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
183 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
184 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
185 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
186 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
187 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
188 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
189 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
190 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
191 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
192 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
193 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
194 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
195 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
196 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
197 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
198 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
199 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
200 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
201 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
202 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
203 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
204 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
205 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
206 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
207 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
208 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
209 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
210 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
211 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
212 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
213 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
214 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
215 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
216 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
217 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
218 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
219 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
220 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
221 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
222 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
223 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
224 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
225 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
226 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
227 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
228 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
229 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.86
Metatranscriptomes 2.14
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.31
Nodule 0
Rhizoplane 5.67
Rhizosphere 93.42
Stem 0
Stem Tuber 0
Unclassified 0.15

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495675_0147637 3300047444 Bacteria 1454
2 Ga0070683_100017945 3300005329 Bacteria 6257
3 Ga0070683_100259633 3300005329 Bacteria 1652
4 Ga0070680_100087492 3300005336 Bacteria 2577
5 Ga0068868_100052332 3300005338 Bacteria 3215
6 Ga0068868_100617785 3300005338 Bacteria 962
7 Ga0070691_10063067 3300005341 Bacteria 1786
8 Ga0070691_10123208 3300005341 Bacteria 1307
9 Ga0070661_100051675 3300005344 Bacteria 3008
10 Ga0070692_10068447 3300005345 Bacteria 1886
11 Ga0070671_100200999 3300005355 Bacteria 1690
12 Ga0070659_100160632 3300005366 Bacteria 1837
13 Ga0070709_10003483 3300005434 Bacteria 8451
14 Ga0070709_10003723 3300005434 Bacteria 8190
15 Ga0070709_10005214 3300005434 Bacteria 7031
16 Ga0070709_10038672 3300005434 Bacteria 2923
17 Ga0070709_10107181 3300005434 Bacteria 1872
18 Ga0070709_10190135 3300005434 Bacteria 1447
19 Ga0070714_100014486 3300005435 Bacteria 6335
20 Ga0070714_100014931 3300005435 Bacteria 6243
21 Ga0070714_100065133 3300005435 Bacteria 3138
22 Ga0070714_100065289 3300005435 Bacteria 3134
23 Ga0070714_100116333 3300005435 Bacteria 2374
24 Ga0070714_100125314 3300005435 Bacteria 2289
25 Ga0070714_100197049 3300005435 Bacteria 1841
26 Ga0070713_100007896 3300005436 Bacteria 7510
27 Ga0070713_100010221 3300005436 Bacteria 6773
28 Ga0070713_100042209 3300005436 Bacteria 3721
29 Ga0070713_100042319 3300005436 Bacteria 3717
30 Ga0070713_100137132 3300005436 Bacteria 2163
31 Ga0070713_100183559 3300005436 Bacteria 1881
32 Ga0070713_100400127 3300005436 Bacteria 1282
33 Ga0070713_100444744 3300005436 Bacteria 1216
34 Ga0070713_100588983 3300005436 Bacteria 1056
35 Ga0070713_100602536 3300005436 Bacteria 1044
36 Ga0070710_10003477 3300005437 Bacteria 7461
37 Ga0070710_10004193 3300005437 Bacteria 6836
38 Ga0070710_10011981 3300005437 Bacteria 4296
39 Ga0070710_10018570 3300005437 Bacteria 3579
40 Ga0070710_10035602 3300005437 Bacteria 2715
41 Ga0070710_10272291 3300005437 Bacteria 1095
42 Ga0070711_100004563 3300005439 Bacteria 8194
43 Ga0070711_100235736 3300005439 Bacteria 1429
44 Ga0070705_100375847 3300005440 Bacteria 1044
45 Ga0070708_100004167 3300005445 Bacteria 11356
46 Ga0070708_100004830 3300005445 Bacteria 10632
47 Ga0070708_100007322 3300005445 Bacteria 8831
48 Ga0070708_100047343 3300005445 Bacteria 3798
49 Ga0070708_100138325 3300005445 Bacteria 2257
50 Ga0070708_100570796 3300005445 Bacteria 1067
51 Ga0070663_100104219 3300005455 Bacteria 2121
52 Ga0070681_10054370 3300005458 Bacteria 3989
53 Ga0070706_100000527 3300005467 Bacteria 44536
54 Ga0070706_100002698 3300005467 Bacteria 17762
55 Ga0070706_100004318 3300005467 Bacteria 13764
56 Ga0070706_100009670 3300005467 Bacteria 8963
57 Ga0070706_100009714 3300005467 Bacteria 8942
58 Ga0070706_100009811 3300005467 Bacteria 8899
59 Ga0070706_100021674 3300005467 Bacteria 5917
60 Ga0070706_100096582 3300005467 Bacteria 2743
61 Ga0070707_100000225 3300005468 Bacteria 56340
62 Ga0070707_100001531 3300005468 Bacteria 22500
63 Ga0070707_100010166 3300005468 Bacteria 8759
64 Ga0070707_100024597 3300005468 Bacteria 5705
65 Ga0070707_100039391 3300005468 Bacteria 4517
66 Ga0070707_100081204 3300005468 Unclassified 3130
67 Ga0070707_100110938 3300005468 Bacteria 2660
68 Ga0070707_100183265 3300005468 Bacteria 2041
69 Ga0070707_100186024 3300005468 Bacteria 2025
70 Ga0070707_100199800 3300005468 Bacteria 1948
71 Ga0070707_100599913 3300005468 Bacteria 1064
72 Ga0070698_100000703 3300005471 Bacteria 35778
73 Ga0070698_100003991 3300005471 Bacteria 16238
74 Ga0070698_100006518 3300005471 Bacteria 12657
75 Ga0070698_100012614 3300005471 Bacteria 8948
76 Ga0070698_100016486 3300005471 Bacteria 7796
77 Ga0070698_100021375 3300005471 Bacteria 6779
78 Ga0070698_100022513 3300005471 Bacteria 6592
79 Ga0070698_100030769 3300005471 Bacteria 5565
80 Ga0070698_100065226 3300005471 Bacteria 3667
81 Ga0070698_100154160 3300005471 Bacteria 2243
82 Ga0070698_100257866 3300005471 Bacteria 1676
83 Ga0070698_100401637 3300005471 Bacteria 1304
84 Ga0070699_100001686 3300005518 Bacteria 20104
85 Ga0070699_100051117 3300005518 Bacteria 3578
86 Ga0070699_100231397 3300005518 Bacteria 1648
87 Ga0070679_100569311 3300005530 Bacteria 1076
88 Ga0070684_100027178 3300005535 Bacteria 4827
89 Ga0070684_100125952 3300005535 Bacteria 2307
90 Ga0070684_100170672 3300005535 Bacteria 1976
91 Ga0070684_100342525 3300005535 Bacteria 1374
92 Ga0070697_100061088 3300005536 Bacteria 3073
93 Ga0070696_100073815 3300005546 Bacteria 2404
94 Ga0070704_100278917 3300005549 Bacteria 1384
95 Ga0068855_100116655 3300005563 Bacteria 3060
96 Ga0070664_100072058 3300005564 Bacteria 2962
97 Ga0068857_100030951 3300005577 Bacteria 4729
98 Ga0068857_100084998 3300005577 Bacteria 2827
99 Ga0068857_100231829 3300005577 Bacteria 1689
100 Ga0068856_100106735 3300005614 Bacteria 2795
101 Ga0068856_100258275 3300005614 Bacteria 1757
102 Ga0068856_100347488 3300005614 Bacteria 1502
103 Ga0068863_100651369 3300005841 Bacteria 1045
104 Ga0068858_100136468 3300005842 Bacteria 2301
105 Ga0081540_1003436 3300005983 Bacteria 12506
106 Ga0070717_10016373 3300006028 Bacteria 5748
107 Ga0070717_10043095 3300006028 Bacteria 3682
108 Ga0070717_10047209 3300006028 Bacteria 3527
109 Ga0070717_10081973 3300006028 Bacteria 2710
110 Ga0070717_10122362 3300006028 Bacteria 2230
111 Ga0070717_10159627 3300006028 Bacteria 1955
112 Ga0070717_10187473 3300006028 Bacteria 1806
113 Ga0070717_10220285 3300006028 Bacteria 1668
114 Ga0070717_10281798 3300006028 Bacteria 1474
115 Ga0070717_10411051 3300006028 Bacteria 1216
116 Ga0070715_10001300 3300006163 Bacteria 7173
117 Ga0070715_10008182 3300006163 Bacteria 3635
118 Ga0070715_10018201 3300006163 Bacteria 2673
119 Ga0070715_10105589 3300006163 Bacteria 1321
120 Ga0070715_10131144 3300006163 Bacteria 1206
121 Ga0070716_100000285 3300006173 Bacteria 20480
122 Ga0070716_100004711 3300006173 Bacteria 6542
123 Ga0070716_100005449 3300006173 Bacteria 6166
124 Ga0070716_100042326 3300006173 Bacteria 2542
125 Ga0070716_100042989 3300006173 Bacteria 2524
126 Ga0070712_100005797 3300006175 Bacteria 7634
127 Ga0070712_100029180 3300006175 Bacteria 3696
128 Ga0070712_100071097 3300006175 Bacteria 2489
129 Ga0070712_100081753 3300006175 Bacteria 2341
130 Ga0070712_100385568 3300006175 Bacteria 1154
131 Ga0070712_100405117 3300006175 Bacteria 1127
132 Ga0097621_100015827 3300006237 Bacteria 5686
133 Ga0075428_100125462 3300006844 Bacteria 2793
134 Ga0075428_100181810 3300006844 Bacteria 2276
135 Ga0075430_100072745 3300006846 Bacteria 2883
136 Ga0075433_10025303 3300006852 Bacteria 5015
137 Ga0075433_10206897 3300006852 Bacteria 1745
138 Ga0075434_100005786 3300006871 Bacteria 11294
139 Ga0075434_100013526 3300006871 Bacteria 7771
140 Ga0075436_100008465 3300006914 Bacteria 7032
141 Ga0075436_100088651 3300006914 Bacteria 2149
142 Ga0075436_100312688 3300006914 Bacteria 1127
143 Ga0075436_100529616 3300006914 Bacteria 864
144 Ga0075435_100025030 3300007076 Bacteria 4641
145 Ga0075435_100128086 3300007076 Bacteria 2123
146 Ga0075435_100251378 3300007076 Bacteria 1505
147 Ga0099794_10020189 3300007265 Bacteria 3013
148 Ga0105240_10408945 3300009093 Bacteria 1527
149 Ga0111539_10148668 3300009094 Bacteria 2743
150 Ga0105247_10051681 3300009101 Bacteria 2532
151 Ga0114129_10372566 3300009147 Bacteria 1887
152 Ga0105241_10129433 3300009174 Bacteria 2042
153 Ga0105238_10055731 3300009551 Bacteria 3967
154 Ga0105238_10380831 3300009551 Bacteria 1402
155 Ga0105239_10553995 3300010375 Bacteria 1309
156 Ga0157373_10172566 3300013100 Bacteria 1521
157 Ga0157370_10033689 3300013104 Bacteria 4993
158 Ga0157370_10119421 3300013104 Bacteria 2461
159 Ga0157369_10127255 3300013105 Bacteria 2700
160 Ga0157369_10443016 3300013105 Bacteria 1345
161 Ga0157374_10028062 3300013296 Bacteria 5083
162 Ga0157374_10558848 3300013296 Bacteria 1152
163 Ga0157375_10205569 3300013308 Bacteria 2125
164 Ga0163163_10138649 3300014325 Bacteria 2474
165 Ga0163163_10454994 3300014325 Bacteria 1340
166 Ga0157379_10013162 3300014968 Bacteria 7243
167 Ga0157376_10147765 3300014969 Bacteria 2116
168 Ga0206356_10418955 3300020070 Bacteria 1038
169 Ga0206356_10954290 3300020070 Bacteria 4558
170 Ga0206356_11094454 3300020070 Bacteria 1085
171 Ga0206355_1003681 3300020076 Bacteria 1461
172 Ga0206352_10351569 3300020078 Bacteria 788
173 Ga0206354_10169469 3300020081 Bacteria 1773
174 Ga0206354_10346635 3300020081 Bacteria 1326
175 Ga0206353_10028488 3300020082 Bacteria 1867
176 Ga0206353_11115160 3300020082 Bacteria 2771
177 Ga0206353_11936013 3300020082 Bacteria 3212
178 Ga0213875_10000160 3300021388 Bacteria 71044
179 Ga0224712_10007773 3300022467 Bacteria 3139
180 Ga0224712_10066593 3300022467 Bacteria 1451
181 Ga0224712_10087940 3300022467 Bacteria 1296
182 Ga0207692_10000334 3300025898 Bacteria 16309
183 Ga0207692_10000878 3300025898 Bacteria 10861
184 Ga0207692_10000971 3300025898 Bacteria 10431
185 Ga0207692_10001407 3300025898 Bacteria 9007
186 Ga0207692_10027467 3300025898 Bacteria 2682
187 Ga0207692_10031970 3300025898 Bacteria 2524
188 Ga0207692_10056862 3300025898 Bacteria 2008
189 Ga0207685_10080125 3300025905 Bacteria 1349
190 Ga0207685_10089991 3300025905 Bacteria 1290
191 Ga0207685_10182994 3300025905 Bacteria 973
192 Ga0207699_10000455 3300025906 Bacteria 20915
193 Ga0207699_10002023 3300025906 Bacteria 9573
194 Ga0207699_10006827 3300025906 Bacteria 5551
195 Ga0207699_10035014 3300025906 Bacteria 2853
196 Ga0207699_10039413 3300025906 Bacteria 2714
197 Ga0207699_10075580 3300025906 Bacteria 2072
198 Ga0207699_10091832 3300025906 Bacteria 1907
199 Ga0207699_10104352 3300025906 Bacteria 1805
200 Ga0207699_10132701 3300025906 Bacteria 1627
201 Ga0207684_10003740 3300025910 Bacteria 14703
202 Ga0207684_10004855 3300025910 Bacteria 12580
203 Ga0207684_10005039 3300025910 Bacteria 12308
204 Ga0207684_10007774 3300025910 Bacteria 9597
205 Ga0207684_10018593 3300025910 Bacteria 5950
206 Ga0207684_10028383 3300025910 Bacteria 4768
207 Ga0207684_10121619 3300025910 Bacteria 2238
208 Ga0207654_10047373 3300025911 Bacteria 2456
209 Ga0207707_10142732 3300025912 Bacteria 2093
210 Ga0207695_10795171 3300025913 Bacteria 826
211 Ga0207693_10015006 3300025915 Bacteria 6219
212 Ga0207693_10019473 3300025915 Bacteria 5397
213 Ga0207693_10019575 3300025915 Bacteria 5383
214 Ga0207693_10027864 3300025915 Bacteria 4465
215 Ga0207693_10028735 3300025915 Bacteria 4394
216 Ga0207693_10029462 3300025915 Bacteria 4336
217 Ga0207693_10035588 3300025915 Bacteria 3925
218 Ga0207693_10238287 3300025915 Bacteria 1428
219 Ga0207693_10487076 3300025915 Bacteria 963
220 Ga0207663_10000763 3300025916 Bacteria 14377
221 Ga0207663_10004140 3300025916 Bacteria 7181
222 Ga0207663_10045106 3300025916 Bacteria 2709
223 Ga0207663_10053360 3300025916 Bacteria 2525
224 Ga0207663_10096331 3300025916 Bacteria 1976
225 Ga0207663_10183167 3300025916 Bacteria 1497
226 Ga0207663_10293919 3300025916 Bacteria 1211
227 Ga0207663_10467967 3300025916 Bacteria 975
228 Ga0207660_10278097 3300025917 Bacteria 1328
229 Ga0207652_10016511 3300025921 Bacteria 6029
230 Ga0207652_10197825 3300025921 Bacteria 1809
231 Ga0207646_10001144 3300025922 Bacteria 33793
232 Ga0207646_10001398 3300025922 Bacteria 29943
233 Ga0207646_10002276 3300025922 Bacteria 22854
234 Ga0207646_10005991 3300025922 Bacteria 12669
235 Ga0207646_10036078 3300025922 Bacteria 4464
236 Ga0207646_10121980 3300025922 Bacteria 2342
237 Ga0207646_10144784 3300025922 Bacteria 2141
238 Ga0207646_10152940 3300025922 Bacteria 2081
239 Ga0207646_10789274 3300025922 Bacteria 846
240 Ga0207694_10287364 3300025924 Bacteria 1352
241 Ga0207694_10307846 3300025924 Bacteria 1305
242 Ga0207694_10735719 3300025924 Bacteria 832
243 Ga0207650_10315409 3300025925 Bacteria 1280
244 Ga0207687_10150266 3300025927 Bacteria 1776
245 Ga0207700_10001459 3300025928 Bacteria 13422
246 Ga0207700_10002803 3300025928 Bacteria 10037
247 Ga0207700_10003143 3300025928 Bacteria 9530
248 Ga0207700_10006848 3300025928 Bacteria 6928
249 Ga0207700_10009330 3300025928 Bacteria 6123
250 Ga0207700_10016949 3300025928 Bacteria 4852
251 Ga0207700_10031996 3300025928 Bacteria 3745
252 Ga0207700_10049412 3300025928 Bacteria 3128
253 Ga0207700_10118457 3300025928 Bacteria 2143
254 Ga0207700_10122275 3300025928 Bacteria 2112
255 Ga0207700_10140953 3300025928 Bacteria 1981
256 Ga0207664_10000305 3300025929 Bacteria 36504
257 Ga0207664_10007688 3300025929 Bacteria 7482
258 Ga0207664_10008499 3300025929 Bacteria 7167
259 Ga0207664_10010629 3300025929 Bacteria 6505
260 Ga0207664_10015019 3300025929 Bacteria 5607
261 Ga0207664_10032499 3300025929 Bacteria 3999
262 Ga0207664_10090395 3300025929 Bacteria 2509
263 Ga0207664_10122334 3300025929 Bacteria 2179
264 Ga0207664_10142912 3300025929 Bacteria 2026
265 Ga0207664_10194835 3300025929 Bacteria 1746
266 Ga0207664_10367134 3300025929 Bacteria 1276
267 Ga0207664_10518572 3300025929 Bacteria 1068
268 Ga0207690_10296906 3300025932 Bacteria 1263
269 Ga0207690_10321626 3300025932 Bacteria 1216
270 Ga0207665_10000145 3300025939 Bacteria 48042
271 Ga0207665_10003352 3300025939 Bacteria 10727
272 Ga0207665_10009029 3300025939 Bacteria 6544
273 Ga0207665_10018822 3300025939 Bacteria 4539
274 Ga0207665_10025316 3300025939 Bacteria 3915
275 Ga0207665_10147553 3300025939 Bacteria 1682
276 Ga0207689_10497709 3300025942 Bacteria 1021
277 Ga0207661_10015650 3300025944 Bacteria 5588
278 Ga0207679_10013641 3300025945 Bacteria 5328
279 Ga0207679_10134408 3300025945 Bacteria 1989
280 Ga0207667_10204408 3300025949 Bacteria 2026
281 Ga0207667_10266140 3300025949 Bacteria 1753
282 Ga0207703_10091255 3300026035 Bacteria 2562
283 Ga0207678_10033977 3300026067 Bacteria 4442
284 Ga0207702_10008269 3300026078 Bacteria 8791
285 Ga0207702_10091443 3300026078 Bacteria 2664
286 Ga0207702_10480736 3300026078 Bacteria 1209
287 Ga0207702_10613498 3300026078 Bacteria 1068
288 Ga0207641_10130236 3300026088 Bacteria 2258
289 Ga0207676_10353948 3300026095 Bacteria 1359
290 Ga0207674_10013112 3300026116 Bacteria 9224
291 Ga0207674_10031649 3300026116 Bacteria 5554
292 Ga0207674_10048650 3300026116 Bacteria 4339
293 Ga0207683_10731425 3300026121 Bacteria 918
294 Ga0207698_10463789 3300026142 Bacteria 1226
295 Ga0268266_10178761 3300028379 Bacteria 1931
296 Ga0265338_10001950 3300028800 Bacteria 32184
297 Ga0265338_10008299 3300028800 Bacteria 12638
298 Ga0265338_10113391 3300028800 Bacteria 2177
299 Ga0265338_10247182 3300028800 Bacteria 1318
300 Ga0316177_1177551 3300030731 Bacteria 3252
301 Ga0316176_1075292 3300030732 Bacteria 2961
302 Ga0265760_10055224 3300031090 Bacteria 1200
303 Ga0307405_10049822 3300031731 Bacteria 2591
304 Ga0307413_10048084 3300031824 Bacteria 2548
305 Ga0307410_10025816 3300031852 Bacteria 3690
306 Ga0307406_10030820 3300031901 Bacteria 3260
307 Ga0307406_10192820 3300031901 Bacteria 1493
308 Ga0307407_10043934 3300031903 Bacteria 2515
309 Ga0307412_10034625 3300031911 Bacteria 3220
310 Ga0307409_100026437 3300031995 Bacteria 4093
311 Ga0307416_100019516 3300032002 Bacteria 4808
312 Ga0307415_100001178 3300032126 Bacteria 12234
313 Ga0373926_0006444 3300035083 Bacteria 3898
314 Ga0373928_0013052 3300035084 Bacteria 1664
315 Ga0373934_0000017 3300035086 Bacteria 57564
316 Ga0373934_0014658 3300035086 Bacteria 2970
317 Ga0373934_0147090 3300035086 Bacteria 964
318 Ga0373949_0079175 3300035090 Bacteria 873
319 Ga0373923_0001763 3300035111 Bacteria 6377
320 Ga0373923_0020438 3300035111 Bacteria 2572
321 Ga0373923_0136797 3300035111 Bacteria 1105
322 Ga0373936_0003381 3300035113 Bacteria 5979
323 Ga0373936_0140284 3300035113 Bacteria 1043
324 Ga0373945_0018204 3300035116 Bacteria 2388
325 Ga0373953_0000060 3300035117 Bacteria 27522
326 Ga0373953_0002585 3300035117 Bacteria 5477
327 Ga0373953_0004100 3300035117 Bacteria 4617
328 Ga0373953_0035559 3300035117 Bacteria 1958
329 Ga0373954_0006285 3300035118 Bacteria 5178
330 Ga0373954_0012755 3300035118 Bacteria 3741
331 Ga0373954_0025557 3300035118 Bacteria 2701
332 Ga0373956_0000173 3300035119 Bacteria 24477
333 Ga0373956_0006555 3300035119 Bacteria 4665
334 Ga0373956_0078234 3300035119 Bacteria 1514
335 Ga0373956_0207932 3300035119 Bacteria 928
336 Ga0373957_0000055 3300035120 Bacteria 28295
337 Ga0373957_0005235 3300035120 Bacteria 4013
338 Ga0373957_0006190 3300035120 Bacteria 3759
339 Ga0373957_0047344 3300035120 Bacteria 1635
340 Ga0373957_0072081 3300035120 Bacteria 1352
341 Ga0373943_0028236 3300035170 Bacteria 2643
342 Ga0373943_0045774 3300035170 Bacteria 2133
343 Ga0373946_0135903 3300035171 Bacteria 1135
344 Ga0373955_0000052 3300035172 Bacteria 45053
345 Ga0373955_0037754 3300035172 Bacteria 2569
346 Ga0373955_0094028 3300035172 Bacteria 1712
347 Ga0373955_0124570 3300035172 Bacteria 1500
348 Ga0373942_0054110 3300035207 Bacteria 1133
349 Ga0373924_0005750 3300035410 Bacteria 4407
350 Ga0373924_0023671 3300035410 Bacteria 2412
351 Ga0373924_0035154 3300035410 Bacteria 2031
352 Ga0373924_0040393 3300035410 Bacteria 1909
353 Ga0373935_0053539 3300035692 Bacteria 2567
354 Ga0373935_0080937 3300035692 Bacteria 2110
355 Ga0373935_0169365 3300035692 Bacteria 1493
356 Ga0373927_0399534 3300035695 Bacteria 907
357 Ga0373933_0000016 3300035724 Bacteria 102539
358 Ga0373933_0002583 3300035724 Bacteria 10143
359 Ga0373933_0018402 3300035724 Bacteria 3928
360 Ga0373933_0091724 3300035724 Bacteria 1875
361 Ga0373933_0116596 3300035724 Bacteria 1669
362 Ga0373947_0060400 3300035725 Bacteria 2301
363 Ga0373947_0078185 3300035725 Bacteria 2042
364 Ga0373937_0000002 3300036401 Bacteria 304133
365 Ga0373937_0014480 3300036401 Bacteria 6964
366 Ga0373937_0044336 3300036401 Bacteria 4061
367 Ga0373937_0083214 3300036401 Bacteria 2960
368 Ga0373937_0148838 3300036401 Bacteria 2192
369 Ga0373937_0813324 3300036401 Bacteria 882
370 Ga0373925_0000041 3300037068 Bacteria 137281
371 Ga0373925_0044992 3300037068 Bacteria 3278
372 Ga0373925_0047523 3300037068 Bacteria 3194
373 Ga0373925_0105606 3300037068 Bacteria 2170
374 Ga0373925_0133356 3300037068 Bacteria 1938
375 Ga0373925_0308457 3300037068 Bacteria 1279
376 Ga0373925_0424577 3300037068 Bacteria 1086
377 Ga0373925_0457554 3300037068 Bacteria 1045
378 Ga0436364_0017793 3300037853 Bacteria 4397
379 Ga0436364_0330965 3300037853 Bacteria 247749
380 Ga0436364_1358603 3300037853 Bacteria 2973
381 Ga0466966_0205252 3300044684 Bacteria 1192
382 Ga0466963_0029195 3300044694 Bacteria 3548
383 Ga0466963_0193009 3300044694 Bacteria 1423
384 Ga0466971_0027601 3300044719 Bacteria 2543
385 Ga0466960_0007619 3300044901 Bacteria 4407
386 Ga0466959_0042927 3300045049 Bacteria 3335
387 Ga0466959_0066879 3300045049 Bacteria 2606
388 Ga0466959_0496433 3300045049 Bacteria 825
389 Ga0466958_0027722 3300045836 Bacteria 3353
390 Ga0466967_0191311 3300045976 Bacteria 1934
391 Ga0466967_0303629 3300045976 Bacteria 1536
392 Ga0495592_0000056 3300046454 Bacteria 103131
393 Ga0495592_0005783 3300046454 Bacteria 9161
394 Ga0495592_0040233 3300046454 Bacteria 3508
395 Ga0495592_0077335 3300046454 Bacteria 2412
396 Ga0495592_0086064 3300046454 Bacteria 2265
397 Ga0495592_0093320 3300046454 Bacteria 2155
398 Ga0495603_0057633 3300046455 Bacteria 2298
399 Ga0495629_0009406 3300046459 Bacteria 7149
400 Ga0495629_0066577 3300046459 Bacteria 2514
401 Ga0495641_0034310 3300046461 Bacteria 2399
402 Ga0495641_0047970 3300046461 Bacteria 1959
403 Ga0495641_0109910 3300046461 Bacteria 1230
404 Ga0495651_0000030 3300046462 Bacteria 103731
405 Ga0495651_0003992 3300046462 Bacteria 11283
406 Ga0495651_0006032 3300046462 Bacteria 9252
407 Ga0495651_0006439 3300046462 Bacteria 8982
408 Ga0495651_0030683 3300046462 Bacteria 4191
409 Ga0495651_0094589 3300046462 Bacteria 2236
410 Ga0495653_0001905 3300046463 Bacteria 16447
411 Ga0495653_0004495 3300046463 Bacteria 11264
412 Ga0495653_0108524 3300046463 Bacteria 1998
413 Ga0495653_0187895 3300046463 Bacteria 1412
414 Ga0495653_0292215 3300046463 Bacteria 1065
415 Ga0495653_0301641 3300046463 Bacteria 1045
416 Ga0495580_0083705 3300046472 Bacteria 2222
417 Ga0495582_0033431 3300046473 Bacteria 2827
418 Ga0495582_0047200 3300046473 Bacteria 2372
419 Ga0495582_0077184 3300046473 Bacteria 1847
420 Ga0495639_0009306 3300046475 Bacteria 4212
421 Ga0495662_0001476 3300046476 Bacteria 11638
422 Ga0495662_0012769 3300046476 Bacteria 4096
423 Ga0495662_0041741 3300046476 Bacteria 2215
424 Ga0495664_0017063 3300046477 Bacteria 4146
425 Ga0495664_0032242 3300046477 Bacteria 3073
426 Ga0495664_0040465 3300046477 Bacteria 2756
427 Ga0495664_0089045 3300046477 Bacteria 1855
428 Ga0495664_0097298 3300046477 Bacteria 1771
429 Ga0495664_0221778 3300046477 Bacteria 1144
430 Ga0495594_0145278 3300046499 Bacteria 1346
431 Ga0495607_0030911 3300046501 Bacteria 3281
432 Ga0495608_0000077 3300046511 Bacteria 73664
433 Ga0495608_0000416 3300046511 Bacteria 29789
434 Ga0495608_0010018 3300046511 Bacteria 6612
435 Ga0495608_0087835 3300046511 Bacteria 2013
436 Ga0495608_0157616 3300046511 Bacteria 1444
437 Ga0495618_0013888 3300046514 Bacteria 4901
438 Ga0495618_0038071 3300046514 Bacteria 3021
439 Ga0495618_0149079 3300046514 Bacteria 1494
440 Ga0495628_0000873 3300046516 Bacteria 27798
441 Ga0495628_0030753 3300046516 Bacteria 4346
442 Ga0495628_0050963 3300046516 Bacteria 3273
443 Ga0495628_0093444 3300046516 Bacteria 2326
444 Ga0495628_0122101 3300046516 Bacteria 1997
445 Ga0495628_0161022 3300046516 Bacteria 1705
446 Ga0495628_0217077 3300046516 Bacteria 1437
447 Ga0495628_0342867 3300046516 Bacteria 1100
448 Ga0495630_0026922 3300046517 Bacteria 4261
449 Ga0495630_0058705 3300046517 Bacteria 2884
450 Ga0495630_0235359 3300046517 Bacteria 1399
451 Ga0495666_0093599 3300046526 Bacteria 1417
452 Ga0495652_0000297 3300046529 Bacteria 59110
453 Ga0495652_0005751 3300046529 Bacteria 11611
454 Ga0495652_0011719 3300046529 Bacteria 7922
455 Ga0495652_0027826 3300046529 Bacteria 4980
456 Ga0495652_0050988 3300046529 Bacteria 3536
457 Ga0495652_0133680 3300046529 Bacteria 1960
458 Ga0495652_0137784 3300046529 Bacteria 1923
459 Ga0495652_0148324 3300046529 Bacteria 1836
460 Ga0495665_0005218 3300046531 Bacteria 7003
461 Ga0495665_0014063 3300046531 Bacteria 4321
462 Ga0495640_0017659 3300046533 Bacteria 5310
463 Ga0495640_0028267 3300046533 Bacteria 4038
464 Ga0495640_0046602 3300046533 Bacteria 3003
465 Ga0495640_0073515 3300046533 Bacteria 2288
466 Ga0495640_0100758 3300046533 Bacteria 1896
467 Ga0495586_0011469 3300046535 Bacteria 4712
468 Ga0495587_0000581 3300046536 Bacteria 25140
469 Ga0495587_0008909 3300046536 Bacteria 6438
470 Ga0495587_0009874 3300046536 Bacteria 6094
471 Ga0495587_0012714 3300046536 Bacteria 5294
472 Ga0495587_0031810 3300046536 Bacteria 3192
473 Ga0495587_0043479 3300046536 Bacteria 2675
474 Ga0495645_0006698 3300046543 Bacteria 8004
475 Ga0495645_0027812 3300046543 Bacteria 4108
476 Ga0495645_0071973 3300046543 Bacteria 2492
477 Ga0495645_0078277 3300046543 Bacteria 2376
478 Ga0495645_0148085 3300046543 Bacteria 1633
479 Ga0495645_0223151 3300046543 Bacteria 1266
480 Ga0495667_0000056 3300046559 Bacteria 102782
481 Ga0495667_0000904 3300046559 Bacteria 19141
482 Ga0495667_0003781 3300046559 Bacteria 10163
483 Ga0495667_0060905 3300046559 Bacteria 2475
484 Ga0495634_0011563 3300046642 Bacteria 6422
485 Ga0495634_0029459 3300046642 Bacteria 3800
486 Ga0495634_0103906 3300046642 Bacteria 1833
487 Ga0495634_0132342 3300046642 Bacteria 1589
488 Ga0495634_0182119 3300046642 Bacteria 1314
489 Ga0495635_0006894 3300046663 Bacteria 7937
490 Ga0495635_0033942 3300046663 Bacteria 3539
491 Ga0495635_0060668 3300046663 Bacteria 2598
492 Ga0495635_0086967 3300046663 Bacteria 2138
493 Ga0495635_0308958 3300046663 Bacteria 1060
494 Ga0495588_0048177 3300046674 Bacteria 2189
495 Ga0495657_0000045 3300046675 Bacteria 106756
496 Ga0495657_0003971 3300046675 Bacteria 11871
497 Ga0495657_0013852 3300046675 Bacteria 5935
498 Ga0495657_0016713 3300046675 Bacteria 5339
499 Ga0495657_0072570 3300046675 Bacteria 2244
500 Ga0495657_0094705 3300046675 Bacteria 1909
501 Ga0495657_0118881 3300046675 Bacteria 1666
502 Ga0495657_0264217 3300046675 Bacteria 1033
503 Ga0495599_0000106 3300046678 Bacteria 56337
504 Ga0495599_0001993 3300046678 Bacteria 11805
505 Ga0495599_0004613 3300046678 Bacteria 8167
506 Ga0495623_0000319 3300046679 Bacteria 31223
507 Ga0495623_0019969 3300046679 Bacteria 4332
508 Ga0495623_0115577 3300046679 Bacteria 1621
509 Ga0495646_0033302 3300046680 Bacteria 3204
510 Ga0495646_0050301 3300046680 Bacteria 2526
511 Ga0495658_0093582 3300046683 Bacteria 1783
512 Ga0495613_0022475 3300046689 Bacteria 4698
513 Ga0495613_0051954 3300046689 Bacteria 3019
514 Ga0495613_0256496 3300046689 Bacteria 1219
515 Ga0495613_0295304 3300046689 Bacteria 1122
516 Ga0495613_0403436 3300046689 Bacteria 932
517 Ga0495624_0062052 3300046690 Bacteria 2339
518 Ga0495624_0154986 3300046690 Bacteria 1400
519 Ga0495600_0001531 3300046809 Bacteria 12854
520 Ga0495600_0011666 3300046809 Bacteria 5480
521 Ga0495600_0024337 3300046809 Bacteria 3897
522 Ga0495600_0223413 3300046809 Bacteria 1204
523 Ga0495581_0041859 3300047315 Bacteria 2651
524 Ga0495581_0074200 3300047315 Bacteria 1968
525 Ga0495604_0000016 3300047317 Bacteria 193985
526 Ga0495604_0015517 3300047317 Bacteria 6080
527 Ga0495604_0022439 3300047317 Bacteria 5039
528 Ga0495604_0023164 3300047317 Bacteria 4956
529 Ga0495604_0035546 3300047317 Bacteria 3935
530 Ga0495604_0052015 3300047317 Bacteria 3173
531 Ga0495604_0066103 3300047317 Bacteria 2752
532 Ga0495674_0013734 3300047319 Bacteria 7606
533 Ga0495674_0027865 3300047319 Bacteria 5159
534 Ga0495674_0046023 3300047319 Bacteria 3874
535 Ga0495674_0115957 3300047319 Bacteria 2266
536 Ga0495674_0122263 3300047319 Bacteria 2198
537 Ga0495674_0355456 3300047319 Bacteria 1188
538 Ga0495674_0390063 3300047319 Bacteria 1125
539 Ga0495674_0471052 3300047319 Bacteria 1007
540 Ga0495676_0096648 3300047321 Bacteria 2195
541 Ga0495676_0222781 3300047321 Bacteria 1299
542 Ga0495680_0000022 3300047322 Bacteria 117753
543 Ga0495680_0004261 3300047322 Bacteria 13734
544 Ga0495680_0008943 3300047322 Bacteria 9053
545 Ga0495680_0033715 3300047322 Bacteria 4142
546 Ga0495680_0045462 3300047322 Bacteria 3466
547 Ga0495680_0052582 3300047322 Bacteria 3174
548 Ga0495680_0331790 3300047322 Bacteria 1063
549 Ga0495680_0407418 3300047322 Bacteria 938
550 Ga0495683_0004194 3300047323 Bacteria 8238
551 Ga0495675_0008268 3300047444 Bacteria 6439
552 Ga0495675_0058345 3300047444 Bacteria 2447
553 Ga0495675_0083066 3300047444 Bacteria 2016
554 Ga0495684_0004444 3300047471 Bacteria 10960
555 Ga0495684_0019068 3300047471 Bacteria 5282
556 Ga0495684_0069935 3300047471 Bacteria 2669
557 Ga0495684_0087640 3300047471 Bacteria 2359
558 Ga0495684_0120686 3300047471 Bacteria 1974
559 Ga0495684_0167078 3300047471 Bacteria 1638
560 Ga0495684_0211109 3300047471 Bacteria 1427
561 Ga0495684_0242335 3300047471 Bacteria 1314
562 Ga0495593_0042757 3300047673 Bacteria 2431
563 Ga0495593_0061474 3300047673 Bacteria 1964
564 Ga0495602_0000088 3300048088 Bacteria 89770
565 Ga0495602_0014339 3300048088 Bacteria 8049
566 Ga0495602_0015853 3300048088 Bacteria 7591
567 Ga0495602_0049299 3300048088 Bacteria 3773
568 Ga0495602_0123147 3300048088 Bacteria 2082
569 Ga0495602_0202234 3300048088 Bacteria 1514
570 Ga0495602_0273575 3300048088 Bacteria 1247
571 Ga0495614_0037570 3300048089 Bacteria 2077
572 Ga0496101_0124174 3300048904 Bacteria 1955
573 Ga0496102_0117150 3300048905 Bacteria 2486
574 Ga0496102_0142589 3300048905 Bacteria 2247
575 Ga0496102_0211973 3300048905 Bacteria 1826
576 Ga0496103_0073705 3300048906 Bacteria 2139
577 Ga0496104_0004563 3300048907 Bacteria 12071
578 Ga0496104_0004878 3300048907 Bacteria 11693
579 Ga0496104_0229274 3300048907 Bacteria 1769
580 Ga0496104_0392202 3300048907 Bacteria 1300
581 Ga0496105_0030535 3300048908 Bacteria 4415
582 Ga0496105_0039910 3300048908 Bacteria 3870
583 Ga0496105_0045069 3300048908 Bacteria 3639
584 Ga0496105_0082565 3300048908 Bacteria 2654
585 Ga0496105_0187051 3300048908 Bacteria 1695
586 Ga0496105_0345790 3300048908 Bacteria 1188
587 Ga0496106_0081158 3300048909 Bacteria 2491
588 Ga0496107_0078519 3300048910 Bacteria 2405
589 Ga0496108_0020418 3300048911 Bacteria 5446
590 Ga0496108_0040418 3300048911 Bacteria 3888
591 Ga0496108_0107168 3300048911 Bacteria 2386
592 Ga0496108_0231693 3300048911 Bacteria 1606
593 Ga0496109_0368814 3300048912 Bacteria 1356
594 Ga0496110_0128672 3300048913 Bacteria 2285
595 Ga0496110_0517358 3300048913 Bacteria 1086
596 Ga0496111_0131873 3300048914 Bacteria 1849
597 Ga0496111_0140015 3300048914 Bacteria 1793
598 Ga0496112_0007907 3300048915 Bacteria 9473
599 Ga0496112_0031574 3300048915 Bacteria 5139
600 Ga0496112_0253330 3300048915 Bacteria 1711
601 Ga0496112_0543731 3300048915 Bacteria 1096
602 Ga0496113_0070863 3300048916 Bacteria 2651
603 Ga0496113_0080264 3300048916 Bacteria 2498
604 Ga0496113_0104975 3300048916 Bacteria 2193
605 Ga0496114_0008300 3300048917 Bacteria 8230
606 Ga0496115_0001837 3300048918 Bacteria 15201
607 Ga0496115_0085312 3300048918 Bacteria 2575
608 Ga0496115_0302643 3300048918 Bacteria 1310
609 Ga0501031_0081920 3300049568 Bacteria 2104
610 Ga0501038_0117673 3300049574 Bacteria 2195
611 Ga0501042_0028262 3300049578 Bacteria 3949
612 Ga0501042_0096501 3300049578 Bacteria 2124
613 Ga0501047_0036057 3300049581 Bacteria 4779
614 Ga0501071_0503604 3300049587 Bacteria 929
615 Ga0501075_0511858 3300049591 Bacteria 916
616 Ga0501076_0158770 3300049592 Bacteria 1842
617 Ga0501080_0127069 3300049742 Bacteria 2361
618 Ga0501045_0036501 3300049824 Bacteria 3569
619 nmdc:mga05p37_447783_c1 3300050507 Bacteria 1496
620 nmdc:mga09592_399737_c1 3300050508 Bacteria 1187
621 nmdc:mga0qj67_43346_c1 3300050509 Bacteria 3543
622 nmdc:mga06r32_596685_c1 3300050510 Bacteria 1075
623 nmdc:mga0n895_108024_c1 3300050512 Bacteria 2797
624 nmdc:mga0n895_17813_c1 3300050512 Bacteria 3355
625 nmdc:mga0n895_49733_c1 3300050512 Bacteria 4109
626 nmdc:mga0rr50_123423_c1 3300050513 Bacteria 2065
627 nmdc:mga0rr50_213401_c1 3300050513 Bacteria 1591
628 nmdc:mga0rr50_374957_c1 3300050513 Bacteria 1199
629 nmdc:mga0rr50_9354_c1 3300050513 Bacteria 6155
630 nmdc:mga08x19_39270_c1 3300050514 Bacteria 3008
631 nmdc:mga08x19_41642_c1 3300050514 Bacteria 2925
632 nmdc:mga08x19_7504_c1 3300050514 Bacteria 6479
633 nmdc:mga08x19_7836_c1 3300050514 Bacteria 6343
634 nmdc:mga0a205_41505_c1 3300050515 Bacteria 4431
635 Ga0495601_0018921 3300053077 Bacteria 4196
636 Ga0495601_0026284 3300053077 Bacteria 3593
637 Ga0495601_0068542 3300053077 Bacteria 2261
638 Ga0495601_0132299 3300053077 Bacteria 1625
639 Ga0495601_0197739 3300053077 Bacteria 1314
640 Ga0495612_0002117 3300053078 Bacteria 8157
641 Ga0495595_0001198 3300053084 Bacteria 10077
642 Ga0495595_0016571 3300053084 Bacteria 3156
643 Ga0495595_0043990 3300053084 Bacteria 2050
644 Ga0495595_0129552 3300053084 Bacteria 1232
645 Ga0495619_0007071 3300053085 Bacteria 7100
646 Ga0495619_0032553 3300053085 Bacteria 3384
647 Ga0495619_0035386 3300053085 Bacteria 3247
648 Ga0495619_0053768 3300053085 Bacteria 2665
649 Ga0495619_0145334 3300053085 Bacteria 1635
650 Ga0500646_0000626 3300053090 Bacteria 10137
651 Ga0500583_0006242 3300053092 Bacteria 4082
652 Ga0501084_0122859 3300054114 Bacteria 2184
653 Ga0466962_0041176 3300061719 Bacteria 2210
654 Ga0495675_0147637
655 Ga0070683_100017945
656 Ga0070683_100259633
657 Ga0070680_100087492
658 Ga0068868_100052332
659 Ga0068868_100617785
660 Ga0070691_10063067
661 Ga0070691_10123208
662 Ga0070661_100051675
663 Ga0070692_10068447
664 Ga0070671_100200999
665 Ga0070659_100160632
666 Ga0070709_10003483
667 Ga0070709_10003723
668 Ga0070709_10005214
669 Ga0070709_10038672
670 Ga0070709_10107181
671 Ga0070709_10190135
672 Ga0070714_100014486
673 Ga0070714_100014931
674 Ga0070714_100065133
675 Ga0070714_100065289
676 Ga0070714_100116333
677 Ga0070714_100125314
678 Ga0070714_100197049
679 Ga0070713_100007896
680 Ga0070713_100010221
681 Ga0070713_100042209
682 Ga0070713_100042319
683 Ga0070713_100137132
684 Ga0070713_100183559
685 Ga0070713_100400127
686 Ga0070713_100444744
687 Ga0070713_100588983
688 Ga0070713_100602536
689 Ga0070710_10003477
690 Ga0070710_10004193
691 Ga0070710_10011981
692 Ga0070710_10018570
693 Ga0070710_10035602
694 Ga0070710_10272291
695 Ga0070711_100004563
696 Ga0070711_100235736
697 Ga0070705_100375847
698 Ga0070708_100004167
699 Ga0070708_100004830
700 Ga0070708_100007322
701 Ga0070708_100047343
702 Ga0070708_100138325
703 Ga0070708_100570796
704 Ga0070663_100104219
705 Ga0070681_10054370
706 Ga0070706_100000527
707 Ga0070706_100002698
708 Ga0070706_100004318
709 Ga0070706_100009670
710 Ga0070706_100009714
711 Ga0070706_100009811
712 Ga0070706_100021674
713 Ga0070706_100096582
714 Ga0070707_100000225
715 Ga0070707_100001531
716 Ga0070707_100010166
717 Ga0070707_100024597
718 Ga0070707_100039391
719 Ga0070707_100081204
720 Ga0070707_100110938
721 Ga0070707_100183265
722 Ga0070707_100186024
723 Ga0070707_100199800
724 Ga0070707_100599913
725 Ga0070698_100000703
726 Ga0070698_100003991
727 Ga0070698_100006518
728 Ga0070698_100012614
729 Ga0070698_100016486
730 Ga0070698_100021375
731 Ga0070698_100022513
732 Ga0070698_100030769
733 Ga0070698_100065226
734 Ga0070698_100154160
735 Ga0070698_100257866
736 Ga0070698_100401637
737 Ga0070699_100001686
738 Ga0070699_100051117
739 Ga0070699_100231397
740 Ga0070679_100569311
741 Ga0070684_100027178
742 Ga0070684_100125952
743 Ga0070684_100170672
744 Ga0070684_100342525
745 Ga0070697_100061088
746 Ga0070696_100073815
747 Ga0070704_100278917
748 Ga0068855_100116655
749 Ga0070664_100072058
750 Ga0068857_100030951
751 Ga0068857_100084998
752 Ga0068857_100231829
753 Ga0068856_100106735
754 Ga0068856_100258275
755 Ga0068856_100347488
756 Ga0068863_100651369
757 Ga0068858_100136468
758 Ga0081540_1003436
759 Ga0070717_10016373
760 Ga0070717_10043095
761 Ga0070717_10047209
762 Ga0070717_10081973
763 Ga0070717_10122362
764 Ga0070717_10159627
765 Ga0070717_10187473
766 Ga0070717_10220285
767 Ga0070717_10281798
768 Ga0070717_10411051
769 Ga0070715_10001300
770 Ga0070715_10008182
771 Ga0070715_10018201
772 Ga0070715_10105589
773 Ga0070715_10131144
774 Ga0070716_100000285
775 Ga0070716_100004711
776 Ga0070716_100005449
777 Ga0070716_100042326
778 Ga0070716_100042989
779 Ga0070712_100005797
780 Ga0070712_100029180
781 Ga0070712_100071097
782 Ga0070712_100081753
783 Ga0070712_100385568
784 Ga0070712_100405117
785 Ga0097621_100015827
786 Ga0075428_100125462
787 Ga0075428_100181810
788 Ga0075430_100072745
789 Ga0075433_10025303
790 Ga0075433_10206897
791 Ga0075434_100005786
792 Ga0075434_100013526
793 Ga0075436_100008465
794 Ga0075436_100088651
795 Ga0075436_100312688
796 Ga0075436_100529616
797 Ga0075435_100025030
798 Ga0075435_100128086
799 Ga0075435_100251378
800 Ga0099794_10020189
801 Ga0105240_10408945
802 Ga0111539_10148668
803 Ga0105247_10051681
804 Ga0114129_10372566
805 Ga0105241_10129433
806 Ga0105238_10055731
807 Ga0105238_10380831
808 Ga0105239_10553995
809 Ga0157373_10172566
810 Ga0157370_10033689
811 Ga0157370_10119421
812 Ga0157369_10127255
813 Ga0157369_10443016
814 Ga0157374_10028062
815 Ga0157374_10558848
816 Ga0157375_10205569
817 Ga0163163_10138649
818 Ga0163163_10454994
819 Ga0157379_10013162
820 Ga0157376_10147765
821 Ga0206356_10418955
822 Ga0206356_10954290
823 Ga0206356_11094454
824 Ga0206355_1003681
825 Ga0206352_10351569
826 Ga0206354_10169469
827 Ga0206354_10346635
828 Ga0206353_10028488
829 Ga0206353_11115160
830 Ga0206353_11936013
831 Ga0213875_10000160
832 Ga0224712_10007773
833 Ga0224712_10066593
834 Ga0224712_10087940
835 Ga0207692_10000334
836 Ga0207692_10000878
837 Ga0207692_10000971
838 Ga0207692_10001407
839 Ga0207692_10027467
840 Ga0207692_10031970
841 Ga0207692_10056862
842 Ga0207685_10080125
843 Ga0207685_10089991
844 Ga0207685_10182994
845 Ga0207699_10000455
846 Ga0207699_10002023
847 Ga0207699_10006827
848 Ga0207699_10035014
849 Ga0207699_10039413
850 Ga0207699_10075580
851 Ga0207699_10091832
852 Ga0207699_10104352
853 Ga0207699_10132701
854 Ga0207684_10003740
855 Ga0207684_10004855
856 Ga0207684_10005039
857 Ga0207684_10007774
858 Ga0207684_10018593
859 Ga0207684_10028383
860 Ga0207684_10121619
861 Ga0207654_10047373
862 Ga0207707_10142732
863 Ga0207695_10795171
864 Ga0207693_10015006
865 Ga0207693_10019473
866 Ga0207693_10019575
867 Ga0207693_10027864
868 Ga0207693_10028735
869 Ga0207693_10029462
870 Ga0207693_10035588
871 Ga0207693_10238287
872 Ga0207693_10487076
873 Ga0207663_10000763
874 Ga0207663_10004140
875 Ga0207663_10045106
876 Ga0207663_10053360
877 Ga0207663_10096331
878 Ga0207663_10183167
879 Ga0207663_10293919
880 Ga0207663_10467967
881 Ga0207660_10278097
882 Ga0207652_10016511
883 Ga0207652_10197825
884 Ga0207646_10001144
885 Ga0207646_10001398
886 Ga0207646_10002276
887 Ga0207646_10005991
888 Ga0207646_10036078
889 Ga0207646_10121980
890 Ga0207646_10144784
891 Ga0207646_10152940
892 Ga0207646_10789274
893 Ga0207694_10287364
894 Ga0207694_10307846
895 Ga0207694_10735719
896 Ga0207650_10315409
897 Ga0207687_10150266
898 Ga0207700_10001459
899 Ga0207700_10002803
900 Ga0207700_10003143
901 Ga0207700_10006848
902 Ga0207700_10009330
903 Ga0207700_10016949
904 Ga0207700_10031996
905 Ga0207700_10049412
906 Ga0207700_10118457
907 Ga0207700_10122275
908 Ga0207700_10140953
909 Ga0207664_10000305
910 Ga0207664_10007688
911 Ga0207664_10008499
912 Ga0207664_10010629
913 Ga0207664_10015019
914 Ga0207664_10032499
915 Ga0207664_10090395
916 Ga0207664_10122334
917 Ga0207664_10142912
918 Ga0207664_10194835
919 Ga0207664_10367134
920 Ga0207664_10518572
921 Ga0207690_10296906
922 Ga0207690_10321626
923 Ga0207665_10000145
924 Ga0207665_10003352
925 Ga0207665_10009029
926 Ga0207665_10018822
927 Ga0207665_10025316
928 Ga0207665_10147553
929 Ga0207689_10497709
930 Ga0207661_10015650
931 Ga0207679_10013641
932 Ga0207679_10134408
933 Ga0207667_10204408
934 Ga0207667_10266140
935 Ga0207703_10091255
936 Ga0207678_10033977
937 Ga0207702_10008269
938 Ga0207702_10091443
939 Ga0207702_10480736
940 Ga0207702_10613498
941 Ga0207641_10130236
942 Ga0207676_10353948
943 Ga0207674_10013112
944 Ga0207674_10031649
945 Ga0207674_10048650
946 Ga0207683_10731425
947 Ga0207698_10463789
948 Ga0268266_10178761
949 Ga0265338_10001950
950 Ga0265338_10008299
951 Ga0265338_10113391
952 Ga0265338_10247182
953 Ga0316177_1177551
954 Ga0316176_1075292
955 Ga0265760_10055224
956 Ga0307405_10049822
957 Ga0307413_10048084
958 Ga0307410_10025816
959 Ga0307406_10030820
960 Ga0307406_10192820
961 Ga0307407_10043934
962 Ga0307412_10034625
963 Ga0307409_100026437
964 Ga0307416_100019516
965 Ga0307415_100001178
966 Ga0373926_0006444
967 Ga0373928_0013052
968 Ga0373934_0000017
969 Ga0373934_0014658
970 Ga0373934_0147090
971 Ga0373949_0079175
972 Ga0373923_0001763
973 Ga0373923_0020438
974 Ga0373923_0136797
975 Ga0373936_0003381
976 Ga0373936_0140284
977 Ga0373945_0018204
978 Ga0373953_0000060
979 Ga0373953_0002585
980 Ga0373953_0004100
981 Ga0373953_0035559
982 Ga0373954_0006285
983 Ga0373954_0012755
984 Ga0373954_0025557
985 Ga0373956_0000173
986 Ga0373956_0006555
987 Ga0373956_0078234
988 Ga0373956_0207932
989 Ga0373957_0000055
990 Ga0373957_0005235
991 Ga0373957_0006190
992 Ga0373957_0047344
993 Ga0373957_0072081
994 Ga0373943_0028236
995 Ga0373943_0045774
996 Ga0373946_0135903
997 Ga0373955_0000052
998 Ga0373955_0037754
999 Ga0373955_0094028
1000 Ga0373955_0124570
1001 Ga0373942_0054110
1002 Ga0373924_0005750
1003 Ga0373924_0023671
1004 Ga0373924_0035154
1005 Ga0373924_0040393
1006 Ga0373935_0053539
1007 Ga0373935_0080937
1008 Ga0373935_0169365
1009 Ga0373927_0399534
1010 Ga0373933_0000016
1011 Ga0373933_0002583
1012 Ga0373933_0018402
1013 Ga0373933_0091724
1014 Ga0373933_0116596
1015 Ga0373947_0060400
1016 Ga0373947_0078185
1017 Ga0373937_0000002
1018 Ga0373937_0014480
1019 Ga0373937_0044336
1020 Ga0373937_0083214
1021 Ga0373937_0148838
1022 Ga0373937_0813324
1023 Ga0373925_0000041
1024 Ga0373925_0044992
1025 Ga0373925_0047523
1026 Ga0373925_0105606
1027 Ga0373925_0133356
1028 Ga0373925_0308457
1029 Ga0373925_0424577
1030 Ga0373925_0457554
1031 Ga0436364_0017793
1032 Ga0436364_0330965
1033 Ga0436364_1358603
1034 Ga0466966_0205252
1035 Ga0466963_0029195
1036 Ga0466963_0193009
1037 Ga0466971_0027601
1038 Ga0466960_0007619
1039 Ga0466959_0042927
1040 Ga0466959_0066879
1041 Ga0466959_0496433
1042 Ga0466958_0027722
1043 Ga0466967_0191311
1044 Ga0466967_0303629
1045 Ga0495592_0000056
1046 Ga0495592_0005783
1047 Ga0495592_0040233
1048 Ga0495592_0077335
1049 Ga0495592_0086064
1050 Ga0495592_0093320
1051 Ga0495603_0057633
1052 Ga0495629_0009406
1053 Ga0495629_0066577
1054 Ga0495641_0034310
1055 Ga0495641_0047970
1056 Ga0495641_0109910
1057 Ga0495651_0000030
1058 Ga0495651_0003992
1059 Ga0495651_0006032
1060 Ga0495651_0006439
1061 Ga0495651_0030683
1062 Ga0495651_0094589
1063 Ga0495653_0001905
1064 Ga0495653_0004495
1065 Ga0495653_0108524
1066 Ga0495653_0187895
1067 Ga0495653_0292215
1068 Ga0495653_0301641
1069 Ga0495580_0083705
1070 Ga0495582_0033431
1071 Ga0495582_0047200
1072 Ga0495582_0077184
1073 Ga0495639_0009306
1074 Ga0495662_0001476
1075 Ga0495662_0012769
1076 Ga0495662_0041741
1077 Ga0495664_0017063
1078 Ga0495664_0032242
1079 Ga0495664_0040465
1080 Ga0495664_0089045
1081 Ga0495664_0097298
1082 Ga0495664_0221778
1083 Ga0495594_0145278
1084 Ga0495607_0030911
1085 Ga0495608_0000077
1086 Ga0495608_0000416
1087 Ga0495608_0010018
1088 Ga0495608_0087835
1089 Ga0495608_0157616
1090 Ga0495618_0013888
1091 Ga0495618_0038071
1092 Ga0495618_0149079
1093 Ga0495628_0000873
1094 Ga0495628_0030753
1095 Ga0495628_0050963
1096 Ga0495628_0093444
1097 Ga0495628_0122101
1098 Ga0495628_0161022
1099 Ga0495628_0217077
1100 Ga0495628_0342867
1101 Ga0495630_0026922
1102 Ga0495630_0058705
1103 Ga0495630_0235359
1104 Ga0495666_0093599
1105 Ga0495652_0000297
1106 Ga0495652_0005751
1107 Ga0495652_0011719
1108 Ga0495652_0027826
1109 Ga0495652_0050988
1110 Ga0495652_0133680
1111 Ga0495652_0137784
1112 Ga0495652_0148324
1113 Ga0495665_0005218
1114 Ga0495665_0014063
1115 Ga0495640_0017659
1116 Ga0495640_0028267
1117 Ga0495640_0046602
1118 Ga0495640_0073515
1119 Ga0495640_0100758
1120 Ga0495586_0011469
1121 Ga0495587_0000581
1122 Ga0495587_0008909
1123 Ga0495587_0009874
1124 Ga0495587_0012714
1125 Ga0495587_0031810
1126 Ga0495587_0043479
1127 Ga0495645_0006698
1128 Ga0495645_0027812
1129 Ga0495645_0071973
1130 Ga0495645_0078277
1131 Ga0495645_0148085
1132 Ga0495645_0223151
1133 Ga0495667_0000056
1134 Ga0495667_0000904
1135 Ga0495667_0003781
1136 Ga0495667_0060905
1137 Ga0495634_0011563
1138 Ga0495634_0029459
1139 Ga0495634_0103906
1140 Ga0495634_0132342
1141 Ga0495634_0182119
1142 Ga0495635_0006894
1143 Ga0495635_0033942
1144 Ga0495635_0060668
1145 Ga0495635_0086967
1146 Ga0495635_0308958
1147 Ga0495588_0048177
1148 Ga0495657_0000045
1149 Ga0495657_0003971
1150 Ga0495657_0013852
1151 Ga0495657_0016713
1152 Ga0495657_0072570
1153 Ga0495657_0094705
1154 Ga0495657_0118881
1155 Ga0495657_0264217
1156 Ga0495599_0000106
1157 Ga0495599_0001993
1158 Ga0495599_0004613
1159 Ga0495623_0000319
1160 Ga0495623_0019969
1161 Ga0495623_0115577
1162 Ga0495646_0033302
1163 Ga0495646_0050301
1164 Ga0495658_0093582
1165 Ga0495613_0022475
1166 Ga0495613_0051954
1167 Ga0495613_0256496
1168 Ga0495613_0295304
1169 Ga0495613_0403436
1170 Ga0495624_0062052
1171 Ga0495624_0154986
1172 Ga0495600_0001531
1173 Ga0495600_0011666
1174 Ga0495600_0024337
1175 Ga0495600_0223413
1176 Ga0495581_0041859
1177 Ga0495581_0074200
1178 Ga0495604_0000016
1179 Ga0495604_0015517
1180 Ga0495604_0022439
1181 Ga0495604_0023164
1182 Ga0495604_0035546
1183 Ga0495604_0052015
1184 Ga0495604_0066103
1185 Ga0495674_0013734
1186 Ga0495674_0027865
1187 Ga0495674_0046023
1188 Ga0495674_0115957
1189 Ga0495674_0122263
1190 Ga0495674_0355456
1191 Ga0495674_0390063
1192 Ga0495674_0471052
1193 Ga0495676_0096648
1194 Ga0495676_0222781
1195 Ga0495680_0000022
1196 Ga0495680_0004261
1197 Ga0495680_0008943
1198 Ga0495680_0033715
1199 Ga0495680_0045462
1200 Ga0495680_0052582
1201 Ga0495680_0331790
1202 Ga0495680_0407418
1203 Ga0495683_0004194
1204 Ga0495675_0008268
1205 Ga0495675_0058345
1206 Ga0495675_0083066
1207 Ga0495684_0004444
1208 Ga0495684_0019068
1209 Ga0495684_0069935
1210 Ga0495684_0087640
1211 Ga0495684_0120686
1212 Ga0495684_0167078
1213 Ga0495684_0211109
1214 Ga0495684_0242335
1215 Ga0495593_0042757
1216 Ga0495593_0061474
1217 Ga0495602_0000088
1218 Ga0495602_0014339
1219 Ga0495602_0015853
1220 Ga0495602_0049299
1221 Ga0495602_0123147
1222 Ga0495602_0202234
1223 Ga0495602_0273575
1224 Ga0495614_0037570
1225 Ga0496101_0124174
1226 Ga0496102_0117150
1227 Ga0496102_0142589
1228 Ga0496102_0211973
1229 Ga0496103_0073705
1230 Ga0496104_0004563
1231 Ga0496104_0004878
1232 Ga0496104_0229274
1233 Ga0496104_0392202
1234 Ga0496105_0030535
1235 Ga0496105_0039910
1236 Ga0496105_0045069
1237 Ga0496105_0082565
1238 Ga0496105_0187051
1239 Ga0496105_0345790
1240 Ga0496106_0081158
1241 Ga0496107_0078519
1242 Ga0496108_0020418
1243 Ga0496108_0040418
1244 Ga0496108_0107168
1245 Ga0496108_0231693
1246 Ga0496109_0368814
1247 Ga0496110_0128672
1248 Ga0496110_0517358
1249 Ga0496111_0131873
1250 Ga0496111_0140015
1251 Ga0496112_0007907
1252 Ga0496112_0031574
1253 Ga0496112_0253330
1254 Ga0496112_0543731
1255 Ga0496113_0070863
1256 Ga0496113_0080264
1257 Ga0496113_0104975
1258 Ga0496114_0008300
1259 Ga0496115_0001837
1260 Ga0496115_0085312
1261 Ga0496115_0302643
1262 Ga0501031_0081920
1263 Ga0501038_0117673
1264 Ga0501042_0028262
1265 Ga0501042_0096501
1266 Ga0501047_0036057
1267 Ga0501071_0503604
1268 Ga0501075_0511858
1269 Ga0501076_0158770
1270 Ga0501080_0127069
1271 Ga0501045_0036501
1272 nmdc:mga05p37_447783_c1
1273 nmdc:mga09592_399737_c1
1274 nmdc:mga0qj67_43346_c1
1275 nmdc:mga06r32_596685_c1
1276 nmdc:mga0n895_108024_c1
1277 nmdc:mga0n895_17813_c1
1278 nmdc:mga0n895_49733_c1
1279 nmdc:mga0rr50_123423_c1
1280 nmdc:mga0rr50_213401_c1
1281 nmdc:mga0rr50_374957_c1
1282 nmdc:mga0rr50_9354_c1
1283 nmdc:mga08x19_39270_c1
1284 nmdc:mga08x19_41642_c1
1285 nmdc:mga08x19_7504_c1
1286 nmdc:mga08x19_7836_c1
1287 nmdc:mga0a205_41505_c1
1288 Ga0495601_0018921
1289 Ga0495601_0026284
1290 Ga0495601_0068542
1291 Ga0495601_0132299
1292 Ga0495601_0197739
1293 Ga0495612_0002117
1294 Ga0495595_0001198
1295 Ga0495595_0016571
1296 Ga0495595_0043990
1297 Ga0495595_0129552
1298 Ga0495619_0007071
1299 Ga0495619_0032553
1300 Ga0495619_0035386
1301 Ga0495619_0053768
1302 Ga0495619_0145334
1303 Ga0500646_0000626
1304 Ga0500583_0006242
1305 Ga0501084_0122859
1306 Ga0466962_0041176

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04248

NTP_transf_9

Domain of unknown function (DUF427)

196

288

0.98

PF04248

NTP_transf_9

Domain of unknown function (DUF427)

75

164

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
3djm-assembly5.cif.gz_E crystal structure of a protein of unknown function from duf427 family (rsph17029_0682) from rhodobacter sphaeroides 2.4.1 at 2.51 a resolution 0.949 129 236
3djm-assembly5.cif.gz_E crystal structure of a protein of unknown function from duf427 family (rsph17029_0682) from rhodobacter sphaeroides 2.4.1 at 2.51 a resolution 0.9244 129 236
7sfz-assembly2.cif.gz_D crystal structure of mis18a-yippee domain 0.7253 137 237
7sfz-assembly2.cif.gz_D crystal structure of mis18a-yippee domain 0.6991 137 237
4xg9-assembly2.cif.gz_B crystal structure of an inhibitor-bound syk 0.544 175 210
ID Description Score Start End Superfamily
af_P96817_9_123_2.170.150.40 Mainly Beta;Beta Complex;Metal Binding Protein, Guanine Nucleotide Exchange Factor; Chain A;Domain of unknown function (DUF427) 0.9674 129 236 2.170.150.40
af_O53404_128_241_2.170.150.40 Mainly Beta;Beta Complex;Metal Binding Protein, Guanine Nucleotide Exchange Factor; Chain A;Domain of unknown function (DUF427) 0.9423 125 236 2.170.150.40
3djmD00 Mainly Beta;Beta Complex;Metal Binding Protein, Guanine Nucleotide Exchange Factor; Chain A;Domain of unknown function (DUF427) 0.9414 130 236 2.170.150.40
af_O53404_128_241_2.170.150.40 Mainly Beta;Beta Complex;Metal Binding Protein, Guanine Nucleotide Exchange Factor; Chain A;Domain of unknown function (DUF427) 0.9184 125 236 2.170.150.40
af_P96817_9_123_2.170.150.40 Mainly Beta;Beta Complex;Metal Binding Protein, Guanine Nucleotide Exchange Factor; Chain A;Domain of unknown function (DUF427) 0.9022 129 236 2.170.150.40
ID Description Score Start End GO Terms
AF-A0A7J9VET7-F1-model_v4 DUF427 domain-containing protein 0.9945 130 250
AF-A0A7Z9Y1B6-F1-model_v4 DUF427 domain-containing protein 0.987 129 248
AF-A0A4V2Y3R9-F1-model_v4 DUF427 domain-containing protein 0.9869 129 237
AF-A0A2N5Z3Z4-F1-model_v4 DUF427 domain-containing protein 0.985 165 229
AF-A0A543CDA2-F1-model_v4 Uncharacterized protein (DUF427 family) 0.9837 129 242

Map