F472622
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 651 | 313 | 625 | 349 |
Family's Representative Sequence
| Representative Sequence | 3300046506|Ga0495583_0012173|Ga0495583_0012173_858_2021 |
| Length | 387 |
| Sequence | VPRQRSIPPHHIDADASSESGINPEEKEMSLQAGQAPSAQEGAKDSAKEQRTEFYRRISGHHLTPLWEVLGALVPRTPASPVAPALWRYAEVREHVMEAGRLISAEEAERRVLVLENPALRGNSSITQSLYAGLQLILPGEVARAHRHTQSALRLVLDGEGAYTAVDGERTTMRRGDFIITPSWTWHDHGNLGDEPVVWLDGLDIPTVRFFDAGFAEHANQASQPMARPEGDALARYGRNMLPVELGQQAASDPAKLFVYPYAETRQALESIALTAPDPHFGHKLRYVNPATGASPMPTIGAFAQLLPAGFASKPYRSTDGTVYVCLEGEGSAEIGGETFAFGPNDIFVVPSWHVLRLRASATTVLFSFSDRPMQQALGLWREEKMQ |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2511231002 | Polaromonas sp. CF318 | Isolate | Rhizosphere |
| 2 | 2547132374 | Acidovorax radicis N35 | Isolate | Unclassified |
| 3 | 2551306416 | Herbaspirillum seropedicae Os34 | Isolate | Unclassified |
| 4 | 2585428062 | Methylibium sp. CF059 | Isolate | Rhizosphere |
| 5 | 2643221609 | Acidovorax sp. Root217 | Isolate | Unclassified |
| 6 | 2643221611 | Acidovorax sp. Root219 | Isolate | Unclassified |
| 7 | 2643221717 | Acidovorax sp. Root267 | Isolate | Unclassified |
| 8 | 2738541280 | Massilia sp. GV090 | Isolate | Unclassified |
| 9 | 2738541297 | Duganella sp. GV083 | Isolate | Unclassified |
| 10 | 2738541300 | Massilia sp. GV016 | Isolate | Unclassified |
| 11 | 2738541357 | Duganella sp. GV053 | Isolate | Unclassified |
| 12 | 2738543003 | Duganella sp. GV066 | Isolate | Unclassified |
| 13 | 2738543012 | Acidovorax sp. CF301 | Isolate | Unclassified |
| 14 | 2738543018 | Massilia sp. GV045 | Isolate | Unclassified |
| 15 | 2738543026 | Duganella sp. GV089 | Isolate | Unclassified |
| 16 | 2738543029 | Duganella sp. GV039 | Isolate | Unclassified |
| 17 | 2738543030 | Massilia sp. GV097 | Isolate | Unclassified |
| 18 | 2816332133 | Acidovorax radicis 2721A | Isolate | Unclassified |
| 19 | 2818991445 | Herbaspirillum hiltneri 3195 | Isolate | Unclassified |
| 20 | 2842711865 | Duganella sp. R-73148 | Isolate | Unclassified |
| 21 | 2904530477 | Herbaspirillum huttiense 611 | Isolate | Unclassified |
| 22 | 2919046199 | Herbaspirillum frisingense 596 | Isolate | Unclassified |
| 23 | 2919704043 | Hydrogenophaga palleronii 4249 | Isolate | Unclassified |
| 24 | 2923510766 | Herbaspirillum rubrisubalbicans SLBN-127 | Isolate | Rhizosphere |
| 25 | 2929160207 | Variovorax sp. R-72349 Hybrid assembly | Isolate | Unclassified |
| 26 | 2939631187 | Ottowia thiooxydans 2709 | Isolate | Rhizosphere |
| 27 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 28 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 29 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 30 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 31 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 32 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 33 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 34 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 35 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 36 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 37 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 38 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 39 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 40 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 41 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 42 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 43 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 44 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 45 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 46 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 47 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 48 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 49 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 52 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 53 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 55 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 56 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 57 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 58 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 61 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 62 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 66 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 67 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 68 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 69 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 70 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 71 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 72 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 74 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 75 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 77 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 78 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 79 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 80 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 81 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 82 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 83 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 84 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 85 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 86 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 87 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 88 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 89 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 90 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 91 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 92 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 93 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 94 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 95 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 96 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 98 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 99 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 100 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 112 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 115 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 116 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 117 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 118 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 119 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 120 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 121 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 122 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 123 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 124 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 125 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 126 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 127 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 128 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 129 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 130 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 131 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 132 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 133 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 134 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 135 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 136 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 137 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 138 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 169 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 170 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 171 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 172 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 173 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 174 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 175 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 176 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 177 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 178 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 179 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 180 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 181 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 182 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 183 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 184 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 185 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 186 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 187 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 188 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 189 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 190 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 191 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 192 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 193 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 194 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 195 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 196 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 197 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 198 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 199 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 200 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 201 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 202 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 203 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 204 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 205 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 206 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 207 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 208 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 209 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 210 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 270 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 271 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 272 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 273 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 274 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 275 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 276 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 277 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 278 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 279 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 282 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 283 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 284 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 285 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 286 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 287 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 288 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 289 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 290 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 291 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 292 | 3300049759 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought | Metagenome | Rhizosphere |
| 293 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 294 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 295 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 296 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 297 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 298 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 299 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 300 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 301 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 302 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 303 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 304 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 305 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 306 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 307 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 308 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 309 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 310 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 311 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 312 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
| 313 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.01 |
| Metatranscriptomes | 0 |
| Isolates | 3.99 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 15.51 |
| Nodule | 0 |
| Rhizoplane | 1.08 |
| Rhizosphere | 68.66 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 14.75 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25155J39150_1000062 | 3300002704 | Bacteria | 70719 |
| 2 | JGI25155J39150_1000302 | 3300002704 | Bacteria | 16773 |
| 3 | JGI25155J39150_1000941 | 3300002704 | Bacteria | 3669 |
| 4 | JGI25156J39149_1000012 | 3300002705 | Bacteria | 194393 |
| 5 | JGI25156J39149_1000039 | 3300002705 | Bacteria | 107108 |
| 6 | JGI25156J39149_1002181 | 3300002705 | Bacteria | 7333 |
| 7 | JGI25162J39368_1004881 | 3300002737 | Bacteria | 2879 |
| 8 | JGI25154J39366_1000029 | 3300002738 | Bacteria | 194393 |
| 9 | JGI25154J39366_1000059 | 3300002738 | Bacteria | 107114 |
| 10 | JGI25154J39366_1000278 | 3300002738 | Bacteria | 31200 |
| 11 | JGI25154J39366_1000497 | 3300002738 | Bacteria | 20176 |
| 12 | JGI25157J39369_1000014 | 3300002741 | Bacteria | 194393 |
| 13 | JGI25157J39369_1000057 | 3300002741 | Bacteria | 107108 |
| 14 | JGI25150J39212_1006746 | 3300002774 | Bacteria | 2346 |
| 15 | JGI25159J45721_1000054 | 3300002987 | Bacteria | 56576 |
| 16 | JGI25159J45721_1001495 | 3300002987 | Bacteria | 9583 |
| 17 | JGI25151J46595_10004424 | 3300003187 | Bacteria | 7439 |
| 18 | JGI25151J46595_10006031 | 3300003187 | Bacteria | 6171 |
| 19 | JGI25151J46595_10006574 | 3300003187 | Bacteria | 5823 |
| 20 | rootH2_10099521 | 3300003320 | Bacteria | 1632 |
| 21 | rootL2_10005895 | 3300003322 | Bacteria | 4335 |
| 22 | rootL2_10055248 | 3300003322 | Bacteria | 2866 |
| 23 | rootL2_10293613 | 3300003322 | Bacteria | 1701 |
| 24 | JGI25160J50197_1000088 | 3300003354 | Bacteria | 93050 |
| 25 | JGI25160J50197_1000119 | 3300003354 | Bacteria | 71366 |
| 26 | JGI25161J50226_1000056 | 3300003374 | Bacteria | 103097 |
| 27 | Ga0055532_1000018 | 3300003758 | Bacteria | 305466 |
| 28 | Ga0055535_1007095 | 3300003761 | Bacteria | 2180 |
| 29 | Ga0055537_1000047 | 3300003773 | Bacteria | 88000 |
| 30 | Ga0055524_1000039 | 3300003775 | Bacteria | 159897 |
| 31 | Ga0055534_1000141 | 3300003784 | Bacteria | 53818 |
| 32 | Ga0055530_10000532 | 3300003791 | Bacteria | 33030 |
| 33 | Ga0055540_1000047 | 3300003792 | Bacteria | 146914 |
| 34 | Ga0055531_10011051 | 3300003794 | Bacteria | 4407 |
| 35 | Ga0055543_1001077 | 3300004625 | Bacteria | 11969 |
| 36 | Ga0065165_1005321 | 3300005262 | Bacteria | 7314 |
| 37 | Ga0070658_10132634 | 3300005327 | Bacteria | 2076 |
| 38 | Ga0070676_10008441 | 3300005328 | Bacteria | 5555 |
| 39 | Ga0070676_10010954 | 3300005328 | Bacteria | 4927 |
| 40 | Ga0070683_100112346 | 3300005329 | Bacteria | 2571 |
| 41 | Ga0070690_100010785 | 3300005330 | Bacteria | 5329 |
| 42 | Ga0070670_100043688 | 3300005331 | Bacteria | 3852 |
| 43 | Ga0068869_100007924 | 3300005334 | Bacteria | 6823 |
| 44 | Ga0070680_100188942 | 3300005336 | Bacteria | 1735 |
| 45 | Ga0068868_100076352 | 3300005338 | Bacteria | 2679 |
| 46 | Ga0070689_100006491 | 3300005340 | Bacteria | 8102 |
| 47 | Ga0070689_100082346 | 3300005340 | Bacteria | 2528 |
| 48 | Ga0070674_100380950 | 3300005356 | Bacteria | 1148 |
| 49 | Ga0070673_100159833 | 3300005364 | Bacteria | 1915 |
| 50 | Ga0070673_100186736 | 3300005364 | Bacteria | 1778 |
| 51 | Ga0070701_10000403 | 3300005438 | Bacteria | 14602 |
| 52 | Ga0070700_100002730 | 3300005441 | Bacteria | 9025 |
| 53 | Ga0070708_100000270 | 3300005445 | Bacteria | 38550 |
| 54 | Ga0070678_100004661 | 3300005456 | Bacteria | 7800 |
| 55 | Ga0070678_100042691 | 3300005456 | Bacteria | 3225 |
| 56 | Ga0070678_100152471 | 3300005456 | Bacteria | 1863 |
| 57 | Ga0070662_100160726 | 3300005457 | Bacteria | 1757 |
| 58 | Ga0068867_100000186 | 3300005459 | Bacteria | 41001 |
| 59 | Ga0068867_100007948 | 3300005459 | Bacteria | 7492 |
| 60 | Ga0068867_100054382 | 3300005459 | Bacteria | 2958 |
| 61 | Ga0068867_100103519 | 3300005459 | Bacteria | 2177 |
| 62 | Ga0070706_100017115 | 3300005467 | Bacteria | 6699 |
| 63 | Ga0070707_100079498 | 3300005468 | Bacteria | 3165 |
| 64 | Ga0070684_100074345 | 3300005535 | Bacteria | 2995 |
| 65 | Ga0068853_100027653 | 3300005539 | Bacteria | 4766 |
| 66 | Ga0070686_100001963 | 3300005544 | Bacteria | 11420 |
| 67 | Ga0070695_100099432 | 3300005545 | Bacteria | 1957 |
| 68 | Ga0070695_100153193 | 3300005545 | Bacteria | 1611 |
| 69 | Ga0070693_100007222 | 3300005547 | Bacteria | 5422 |
| 70 | Ga0070704_100269721 | 3300005549 | Bacteria | 1406 |
| 71 | Ga0068855_100000028 | 3300005563 | Bacteria | 171801 |
| 72 | Ga0068855_100001569 | 3300005563 | Bacteria | 28685 |
| 73 | Ga0070664_100000426 | 3300005564 | Bacteria | 31532 |
| 74 | Ga0068857_100159869 | 3300005577 | Bacteria | 2044 |
| 75 | Ga0068854_100007377 | 3300005578 | Bacteria | 7028 |
| 76 | Ga0068856_100000978 | 3300005614 | Bacteria | 30484 |
| 77 | Ga0068852_100006894 | 3300005616 | Bacteria | 8258 |
| 78 | Ga0068859_100011217 | 3300005617 | Bacteria | 9012 |
| 79 | Ga0068859_100399254 | 3300005617 | Bacteria | 1471 |
| 80 | Ga0068866_10002351 | 3300005718 | Bacteria | 7841 |
| 81 | Ga0068861_100007675 | 3300005719 | Bacteria | 7404 |
| 82 | Ga0068870_10021148 | 3300005840 | Bacteria | 3179 |
| 83 | Ga0068858_100004891 | 3300005842 | Bacteria | 13137 |
| 84 | Ga0068858_100088756 | 3300005842 | Bacteria | 2877 |
| 85 | Ga0068860_100078082 | 3300005843 | Bacteria | 3149 |
| 86 | Ga0068860_100144946 | 3300005843 | Bacteria | 2285 |
| 87 | Ga0068860_100161734 | 3300005843 | Bacteria | 2159 |
| 88 | Ga0068860_100219142 | 3300005843 | Bacteria | 1848 |
| 89 | Ga0075365_10051177 | 3300006038 | Bacteria | 2727 |
| 90 | Ga0075368_10004920 | 3300006042 | Bacteria | 4556 |
| 91 | Ga0075363_100053398 | 3300006048 | Bacteria | 2159 |
| 92 | Ga0075364_10077336 | 3300006051 | Bacteria | 2197 |
| 93 | Ga0075432_10037312 | 3300006058 | Bacteria | 1691 |
| 94 | Ga0070712_100085822 | 3300006175 | Bacteria | 2293 |
| 95 | Ga0075362_10009785 | 3300006177 | Bacteria | 3720 |
| 96 | Ga0075362_10043390 | 3300006177 | Bacteria | 1991 |
| 97 | Ga0075367_10055782 | 3300006178 | Bacteria | 2346 |
| 98 | Ga0075369_10013266 | 3300006186 | Bacteria | 3268 |
| 99 | Ga0075366_10007761 | 3300006195 | Bacteria | 5940 |
| 100 | Ga0075366_10014644 | 3300006195 | Bacteria | 4482 |
| 101 | Ga0075366_10020137 | 3300006195 | Bacteria | 3867 |
| 102 | Ga0075366_10040502 | 3300006195 | Bacteria | 2756 |
| 103 | Ga0075366_10138912 | 3300006195 | Bacteria | 1468 |
| 104 | Ga0075366_10242062 | 3300006195 | Bacteria | 1100 |
| 105 | Ga0097621_100038338 | 3300006237 | Bacteria | 3845 |
| 106 | Ga0075370_10020573 | 3300006353 | Bacteria | 3609 |
| 107 | Ga0075370_10031064 | 3300006353 | Bacteria | 2981 |
| 108 | Ga0068871_100006001 | 3300006358 | Bacteria | 8552 |
| 109 | Ga0068871_100168570 | 3300006358 | Bacteria | 1876 |
| 110 | Ga0068865_100002680 | 3300006881 | Bacteria | 10558 |
| 111 | Ga0097620_100011217 | 3300006931 | Bacteria | 9012 |
| 112 | Ga0097620_100399228 | 3300006931 | Bacteria | 1471 |
| 113 | Ga0105245_10021546 | 3300009098 | Bacteria | 5655 |
| 114 | Ga0105243_10002791 | 3300009148 | Bacteria | 14509 |
| 115 | Ga0105243_10015622 | 3300009148 | Bacteria | 5739 |
| 116 | Ga0105243_10022655 | 3300009148 | Bacteria | 4776 |
| 117 | Ga0105243_10264203 | 3300009148 | Bacteria | 1542 |
| 118 | Ga0105242_10002015 | 3300009176 | Bacteria | 15991 |
| 119 | Ga0105248_10204078 | 3300009177 | Bacteria | 2227 |
| 120 | Ga0105248_10283602 | 3300009177 | Bacteria | 1865 |
| 121 | Ga0105237_10126559 | 3300009545 | Bacteria | 2549 |
| 122 | Ga0157371_10000422 | 3300013102 | Bacteria | 52177 |
| 123 | Ga0157378_10026828 | 3300013297 | Bacteria | 5079 |
| 124 | Ga0157372_10201843 | 3300013307 | Bacteria | 2303 |
| 125 | Ga0157375_10182308 | 3300013308 | Bacteria | 2252 |
| 126 | Ga0157380_10036152 | 3300014326 | Bacteria | 3820 |
| 127 | Ga0157380_10111063 | 3300014326 | Bacteria | 2304 |
| 128 | Ga0157380_10226271 | 3300014326 | Bacteria | 1677 |
| 129 | Ga0182008_10005147 | 3300014497 | Bacteria | 7502 |
| 130 | Ga0157377_10000464 | 3300014745 | Bacteria | 17471 |
| 131 | Ga0157379_10047386 | 3300014968 | Bacteria | 3835 |
| 132 | Ga0157379_10160163 | 3300014968 | Bacteria | 2031 |
| 133 | Ga0209435_100002 | 3300025206 | Bacteria | 794178 |
| 134 | Ga0209435_100007 | 3300025206 | Bacteria | 516857 |
| 135 | Ga0209436_104201 | 3300025208 | Bacteria | 3609 |
| 136 | Ga0209147_100017 | 3300025229 | Bacteria | 516857 |
| 137 | Ga0209437_100272 | 3300025233 | Bacteria | 77336 |
| 138 | Ga0209258_100297 | 3300025242 | Bacteria | 81353 |
| 139 | Ga0207425_1001011 | 3300025245 | Bacteria | 13170 |
| 140 | Ga0207425_1008751 | 3300025245 | Bacteria | 2564 |
| 141 | Ga0207425_1009598 | 3300025245 | Bacteria | 2398 |
| 142 | Ga0209646_1000001 | 3300025246 | Bacteria | 3092932 |
| 143 | Ga0209646_1000023 | 3300025246 | Bacteria | 441100 |
| 144 | Ga0209646_1000061 | 3300025246 | Bacteria | 255495 |
| 145 | Ga0209646_1000096 | 3300025246 | Bacteria | 182388 |
| 146 | Ga0209026_1000040 | 3300025250 | Bacteria | 277470 |
| 147 | Ga0209026_1000052 | 3300025250 | Bacteria | 248897 |
| 148 | Ga0209759_1000001 | 3300025256 | Bacteria | 2799452 |
| 149 | Ga0209759_1000174 | 3300025256 | Bacteria | 107149 |
| 150 | Ga0209759_1000209 | 3300025256 | Bacteria | 90642 |
| 151 | Ga0209129_1014229 | 3300025258 | Bacteria | 1705 |
| 152 | Ga0209565_1000080 | 3300025263 | Bacteria | 156999 |
| 153 | Ga0209565_1000876 | 3300025263 | Bacteria | 16569 |
| 154 | Ga0209455_1019008 | 3300025272 | Bacteria | 1397 |
| 155 | Ga0209673_1000088 | 3300025273 | Bacteria | 204629 |
| 156 | Ga0209130_1000040 | 3300025284 | Bacteria | 262926 |
| 157 | Ga0209130_1000346 | 3300025284 | Bacteria | 53329 |
| 158 | Ga0209675_1000133 | 3300025291 | Bacteria | 101207 |
| 159 | Ga0209675_1000471 | 3300025291 | Bacteria | 30899 |
| 160 | Ga0209675_1024886 | 3300025291 | Bacteria | 1520 |
| 161 | Ga0209676_1000073 | 3300025292 | Bacteria | 305947 |
| 162 | Ga0209676_1002444 | 3300025292 | Bacteria | 13185 |
| 163 | Ga0209025_1003514 | 3300025294 | Bacteria | 14717 |
| 164 | Ga0209025_1004730 | 3300025294 | Bacteria | 11596 |
| 165 | Ga0209025_1006776 | 3300025294 | Bacteria | 8785 |
| 166 | Ga0209025_1009312 | 3300025294 | Bacteria | 6873 |
| 167 | Ga0209025_1009596 | 3300025294 | Bacteria | 6715 |
| 168 | Ga0209564_1000313 | 3300025295 | Bacteria | 95224 |
| 169 | Ga0209564_1000823 | 3300025295 | Bacteria | 42196 |
| 170 | Ga0209564_1005212 | 3300025295 | Bacteria | 7521 |
| 171 | Ga0209758_1000679 | 3300025297 | Bacteria | 50729 |
| 172 | Ga0209758_1005216 | 3300025297 | Bacteria | 10191 |
| 173 | Ga0209050_1000008 | 3300025298 | Bacteria | 1144179 |
| 174 | Ga0209050_1001577 | 3300025298 | Bacteria | 23647 |
| 175 | Ga0209256_1000096 | 3300025299 | Bacteria | 204629 |
| 176 | Ga0207426_1000188 | 3300025302 | Bacteria | 153510 |
| 177 | Ga0207426_1001354 | 3300025302 | Bacteria | 20775 |
| 178 | Ga0209051_1000005 | 3300025303 | Bacteria | 1142353 |
| 179 | Ga0209257_1000031 | 3300025304 | Bacteria | 688770 |
| 180 | Ga0209257_1002902 | 3300025304 | Bacteria | 15869 |
| 181 | Ga0207642_10022558 | 3300025899 | Bacteria | 2499 |
| 182 | Ga0207699_10073140 | 3300025906 | Bacteria | 2102 |
| 183 | Ga0207645_10008027 | 3300025907 | Bacteria | 7404 |
| 184 | Ga0207645_10010581 | 3300025907 | Bacteria | 6330 |
| 185 | Ga0207645_10162183 | 3300025907 | Bacteria | 1463 |
| 186 | Ga0207705_10057039 | 3300025909 | Bacteria | 2817 |
| 187 | Ga0207684_10024199 | 3300025910 | Bacteria | 5178 |
| 188 | Ga0207671_10082937 | 3300025914 | Bacteria | 2406 |
| 189 | Ga0207646_10015873 | 3300025922 | Bacteria | 7087 |
| 190 | Ga0207706_10286884 | 3300025933 | Bacteria | 1435 |
| 191 | Ga0207686_10003923 | 3300025934 | Bacteria | 7978 |
| 192 | Ga0207709_10143820 | 3300025935 | Bacteria | 1643 |
| 193 | Ga0207670_10011083 | 3300025936 | Bacteria | 5219 |
| 194 | Ga0207704_10011058 | 3300025938 | Bacteria | 4429 |
| 195 | Ga0207704_10067551 | 3300025938 | Bacteria | 2250 |
| 196 | Ga0207691_10019676 | 3300025940 | Bacteria | 6386 |
| 197 | Ga0207691_10059002 | 3300025940 | Bacteria | 3490 |
| 198 | Ga0207689_10002140 | 3300025942 | Bacteria | 18578 |
| 199 | Ga0207689_10022127 | 3300025942 | Bacteria | 5346 |
| 200 | Ga0207661_10051048 | 3300025944 | Bacteria | 3299 |
| 201 | Ga0207679_10002864 | 3300025945 | Bacteria | 10697 |
| 202 | Ga0207679_10013747 | 3300025945 | Bacteria | 5308 |
| 203 | Ga0207667_10009133 | 3300025949 | Bacteria | 11710 |
| 204 | Ga0207667_10252379 | 3300025949 | Bacteria | 1805 |
| 205 | Ga0207651_10129602 | 3300025960 | Bacteria | 1928 |
| 206 | Ga0207658_10032153 | 3300025986 | Bacteria | 3731 |
| 207 | Ga0207677_10014829 | 3300026023 | Bacteria | 4564 |
| 208 | Ga0207677_10030771 | 3300026023 | Bacteria | 3431 |
| 209 | Ga0207703_10099688 | 3300026035 | Bacteria | 2459 |
| 210 | Ga0207639_10104539 | 3300026041 | Bacteria | 2296 |
| 211 | Ga0207708_10000219 | 3300026075 | Bacteria | 45553 |
| 212 | Ga0207648_10000534 | 3300026089 | Bacteria | 42312 |
| 213 | Ga0207648_10000686 | 3300026089 | Bacteria | 37954 |
| 214 | Ga0207648_10028615 | 3300026089 | Bacteria | 4940 |
| 215 | Ga0207648_10036621 | 3300026089 | Bacteria | 4322 |
| 216 | Ga0207674_10252232 | 3300026116 | Bacteria | 1712 |
| 217 | Ga0207675_100000531 | 3300026118 | Bacteria | 37047 |
| 218 | Ga0207683_10009791 | 3300026121 | Bacteria | 8172 |
| 219 | Ga0207683_10165802 | 3300026121 | Bacteria | 1999 |
| 220 | Ga0207698_10152124 | 3300026142 | Bacteria | 2010 |
| 221 | Ga0209588_1016549 | 3300027671 | Bacteria | 2277 |
| 222 | Ga0268264_10089095 | 3300028381 | Bacteria | 2656 |
| 223 | Ga0268264_10119155 | 3300028381 | Bacteria | 2324 |
| 224 | Ga0268264_10151399 | 3300028381 | Bacteria | 2080 |
| 225 | Ga0307517_10000160 | 3300028786 | Bacteria | 108370 |
| 226 | Ga0307517_10000395 | 3300028786 | Bacteria | 74663 |
| 227 | Ga0307515_10000006 | 3300028794 | Bacteria | 725810 |
| 228 | Ga0307515_10000332 | 3300028794 | Bacteria | 116126 |
| 229 | Ga0307515_10000893 | 3300028794 | Bacteria | 68669 |
| 230 | Ga0307515_10007639 | 3300028794 | Bacteria | 21327 |
| 231 | Ga0307515_10012223 | 3300028794 | Bacteria | 16171 |
| 232 | Ga0307515_10014643 | 3300028794 | Bacteria | 14520 |
| 233 | Ga0307515_10033807 | 3300028794 | Bacteria | 8403 |
| 234 | Ga0307515_10097942 | 3300028794 | Bacteria | 3577 |
| 235 | Ga0307511_10013142 | 3300030521 | Bacteria | 8095 |
| 236 | Ga0307512_10034891 | 3300030522 | Bacteria | 4297 |
| 237 | Ga0307512_10095568 | 3300030522 | Bacteria | 2044 |
| 238 | Ga0307513_10003528 | 3300031456 | Bacteria | 21162 |
| 239 | Ga0307513_10020560 | 3300031456 | Bacteria | 7826 |
| 240 | Ga0307513_10288299 | 3300031456 | Bacteria | 1415 |
| 241 | Ga0307509_10000212 | 3300031507 | Bacteria | 92922 |
| 242 | Ga0307509_10000317 | 3300031507 | Bacteria | 79032 |
| 243 | Ga0307509_10001463 | 3300031507 | Bacteria | 39971 |
| 244 | Ga0307509_10001515 | 3300031507 | Bacteria | 39177 |
| 245 | Ga0307509_10005816 | 3300031507 | Bacteria | 16916 |
| 246 | Ga0307509_10014784 | 3300031507 | Bacteria | 9150 |
| 247 | Ga0307509_10133120 | 3300031507 | Bacteria | 2437 |
| 248 | Ga0307509_10221396 | 3300031507 | Bacteria | 1705 |
| 249 | Ga0307408_100000196 | 3300031548 | Bacteria | 65663 |
| 250 | Ga0307408_100001382 | 3300031548 | Bacteria | 18050 |
| 251 | Ga0307508_10000097 | 3300031616 | Bacteria | 103662 |
| 252 | Ga0307508_10000412 | 3300031616 | Bacteria | 50808 |
| 253 | Ga0307508_10001697 | 3300031616 | Bacteria | 24440 |
| 254 | Ga0307508_10001791 | 3300031616 | Bacteria | 23876 |
| 255 | Ga0307508_10006375 | 3300031616 | Bacteria | 11096 |
| 256 | Ga0307508_10058425 | 3300031616 | Bacteria | 3412 |
| 257 | Ga0307514_10001713 | 3300031649 | Bacteria | 25184 |
| 258 | Ga0307514_10033260 | 3300031649 | Bacteria | 4116 |
| 259 | Ga0307514_10113059 | 3300031649 | Bacteria | 1917 |
| 260 | Ga0307514_10134731 | 3300031649 | Bacteria | 1693 |
| 261 | Ga0307514_10205485 | 3300031649 | Bacteria | 1231 |
| 262 | Ga0307516_10004792 | 3300031730 | Bacteria | 16488 |
| 263 | Ga0307516_10058559 | 3300031730 | Bacteria | 3750 |
| 264 | Ga0307516_10115718 | 3300031730 | Bacteria | 2477 |
| 265 | Ga0307406_10000931 | 3300031901 | Bacteria | 16339 |
| 266 | Ga0307507_10006339 | 3300033179 | Bacteria | 18255 |
| 267 | Ga0307507_10026906 | 3300033179 | Bacteria | 6185 |
| 268 | Ga0307507_10096560 | 3300033179 | Bacteria | 2499 |
| 269 | Ga0307510_10197873 | 3300033180 | Bacteria | 1548 |
| 270 | Ga0373936_0000014 | 3300035113 | Bacteria | 202828 |
| 271 | Ga0373936_0007356 | 3300035113 | Bacteria | 4143 |
| 272 | Ga0373936_0025043 | 3300035113 | Bacteria | 2332 |
| 273 | Ga0373946_0025912 | 3300035171 | Bacteria | 2309 |
| 274 | Ga0373924_0001472 | 3300035410 | Bacteria | 7658 |
| 275 | Ga0373924_0055919 | 3300035410 | Bacteria | 1643 |
| 276 | Ga0373931_0124710 | 3300035691 | Bacteria | 1475 |
| 277 | Ga0373927_0074895 | 3300035695 | Bacteria | 2192 |
| 278 | Ga0373947_0064981 | 3300035725 | Bacteria | 2225 |
| 279 | Ga0373937_0077753 | 3300036401 | Bacteria | 3066 |
| 280 | Ga0373925_0017662 | 3300037068 | Bacteria | 5177 |
| 281 | Ga0373925_0062980 | 3300037068 | Bacteria | 2790 |
| 282 | Ga0395899_0000439 | 3300037312 | Bacteria | 47640 |
| 283 | Ga0395899_0002901 | 3300037312 | Bacteria | 13781 |
| 284 | Ga0395899_0003277 | 3300037312 | Bacteria | 12837 |
| 285 | Ga0395899_0005643 | 3300037312 | Bacteria | 9711 |
| 286 | Ga0395900_0003982 | 3300037418 | Bacteria | 15770 |
| 287 | Ga0395900_0006947 | 3300037418 | Bacteria | 11742 |
| 288 | Ga0395900_0031706 | 3300037418 | Bacteria | 5432 |
| 289 | Ga0395900_0047376 | 3300037418 | Bacteria | 4425 |
| 290 | Ga0395898_0008585 | 3300037466 | Bacteria | 10782 |
| 291 | Ga0395898_0011655 | 3300037466 | Bacteria | 9119 |
| 292 | Ga0395905_0004813 | 3300037471 | Bacteria | 13929 |
| 293 | Ga0395905_0148831 | 3300037471 | Bacteria | 2203 |
| 294 | Ga0395901_0019451 | 3300038443 | Bacteria | 6943 |
| 295 | Ga0395901_0022179 | 3300038443 | Bacteria | 6506 |
| 296 | Ga0395901_0050898 | 3300038443 | Bacteria | 4304 |
| 297 | Ga0395901_0123389 | 3300038443 | Bacteria | 2722 |
| 298 | Ga0395901_0125258 | 3300038443 | Bacteria | 2700 |
| 299 | Ga0439461_0020413 | 3300041410 | Bacteria | 1311 |
| 300 | Ga0451802_1256569 | 3300041460 | Bacteria | 2565 |
| 301 | Ga0451853_0840822 | 3300041512 | Bacteria | 1800 |
| 302 | Ga0439431_0003980 | 3300041997 | Bacteria | 3253 |
| 303 | Ga0450898_002675 | 3300042134 | Bacteria | 2497 |
| 304 | Ga0439460_0024484 | 3300042461 | Bacteria | 1672 |
| 305 | Ga0450893_0011593 | 3300042532 | Bacteria | 1458 |
| 306 | Ga0466969_0012519 | 3300044656 | Bacteria | 4472 |
| 307 | Ga0466972_0001573 | 3300044658 | Bacteria | 11130 |
| 308 | Ga0466972_0074011 | 3300044658 | Bacteria | 1623 |
| 309 | Ga0466965_0008321 | 3300044683 | Bacteria | 4797 |
| 310 | Ga0466965_0222073 | 3300044683 | Bacteria | 1007 |
| 311 | Ga0466966_0013155 | 3300044684 | Bacteria | 5480 |
| 312 | Ga0466961_0000421 | 3300044693 | Bacteria | 27063 |
| 313 | Ga0466964_0004540 | 3300044706 | Bacteria | 5128 |
| 314 | Ga0466968_0000892 | 3300044735 | Bacteria | 10496 |
| 315 | Ga0466957_0008010 | 3300044842 | Bacteria | 5994 |
| 316 | Ga0466958_0017064 | 3300045836 | Bacteria | 4191 |
| 317 | Ga0495617_001179 | 3300046452 | Bacteria | 11806 |
| 318 | Ga0495617_013587 | 3300046452 | Bacteria | 2770 |
| 319 | Ga0495627_000015 | 3300046453 | Bacteria | 320787 |
| 320 | Ga0495592_0000175 | 3300046454 | Bacteria | 56416 |
| 321 | Ga0495603_0073101 | 3300046455 | Bacteria | 2015 |
| 322 | Ga0495590_0000001 | 3300046457 | Bacteria | 762984 |
| 323 | Ga0495590_0001681 | 3300046457 | Bacteria | 9407 |
| 324 | Ga0495590_0008483 | 3300046457 | Bacteria | 3924 |
| 325 | Ga0495590_0009678 | 3300046457 | Bacteria | 3655 |
| 326 | Ga0495629_0203914 | 3300046459 | Bacteria | 1367 |
| 327 | Ga0495638_0002754 | 3300046460 | Bacteria | 14123 |
| 328 | Ga0495638_0005064 | 3300046460 | Bacteria | 9880 |
| 329 | Ga0495638_0084731 | 3300046460 | Bacteria | 1918 |
| 330 | Ga0495638_0144893 | 3300046460 | Bacteria | 1383 |
| 331 | Ga0495638_0166990 | 3300046460 | Bacteria | 1265 |
| 332 | Ga0495653_0000009 | 3300046463 | Bacteria | 304207 |
| 333 | Ga0495650_0000001 | 3300046471 | Bacteria | 1085492 |
| 334 | Ga0495650_0000051 | 3300046471 | Bacteria | 318297 |
| 335 | Ga0495650_0000164 | 3300046471 | Bacteria | 147142 |
| 336 | Ga0495650_0000213 | 3300046471 | Bacteria | 123910 |
| 337 | Ga0495650_0000289 | 3300046471 | Bacteria | 93255 |
| 338 | Ga0495650_0002251 | 3300046471 | Bacteria | 16132 |
| 339 | Ga0495650_0009697 | 3300046471 | Bacteria | 5456 |
| 340 | Ga0495605_0001676 | 3300046474 | Bacteria | 14240 |
| 341 | Ga0495605_0011586 | 3300046474 | Bacteria | 4911 |
| 342 | Ga0495605_0116741 | 3300046474 | Bacteria | 1213 |
| 343 | Ga0495639_0102142 | 3300046475 | Bacteria | 1355 |
| 344 | Ga0495584_0000179 | 3300046491 | Bacteria | 44738 |
| 345 | Ga0495584_0001609 | 3300046491 | Bacteria | 13289 |
| 346 | Ga0495584_0011146 | 3300046491 | Bacteria | 4608 |
| 347 | Ga0495584_0012011 | 3300046491 | Bacteria | 4428 |
| 348 | Ga0495585_0000587 | 3300046492 | Bacteria | 34126 |
| 349 | Ga0495585_0019845 | 3300046492 | Bacteria | 3870 |
| 350 | Ga0495585_0033368 | 3300046492 | Bacteria | 2914 |
| 351 | Ga0495585_0060255 | 3300046492 | Bacteria | 2089 |
| 352 | Ga0495596_0000029 | 3300046500 | Bacteria | 103615 |
| 353 | Ga0495596_0000309 | 3300046500 | Bacteria | 32084 |
| 354 | Ga0495596_0003951 | 3300046500 | Bacteria | 7334 |
| 355 | Ga0495596_0006179 | 3300046500 | Bacteria | 5548 |
| 356 | Ga0495596_0006338 | 3300046500 | Bacteria | 5459 |
| 357 | Ga0495596_0010016 | 3300046500 | Bacteria | 4147 |
| 358 | Ga0495596_0010603 | 3300046500 | Bacteria | 4005 |
| 359 | Ga0495607_0000867 | 3300046501 | Bacteria | 28348 |
| 360 | Ga0495607_0135877 | 3300046501 | Bacteria | 1273 |
| 361 | Ga0495583_0000014 | 3300046506 | Bacteria | 320136 |
| 362 | Ga0495583_0000127 | 3300046506 | Bacteria | 127780 |
| 363 | Ga0495583_0002530 | 3300046506 | Bacteria | 15470 |
| 364 | Ga0495583_0002687 | 3300046506 | Bacteria | 14789 |
| 365 | Ga0495583_0003009 | 3300046506 | Bacteria | 13477 |
| 366 | Ga0495583_0012173 | 3300046506 | Bacteria | 4889 |
| 367 | Ga0495583_0022588 | 3300046506 | Bacteria | 3204 |
| 368 | Ga0495583_0023323 | 3300046506 | Bacteria | 3133 |
| 369 | Ga0495583_0023527 | 3300046506 | Bacteria | 3114 |
| 370 | Ga0495583_0028223 | 3300046506 | Bacteria | 2762 |
| 371 | Ga0495583_0029866 | 3300046506 | Bacteria | 2662 |
| 372 | Ga0495606_0026449 | 3300046507 | Bacteria | 4136 |
| 373 | Ga0495610_0000008 | 3300046512 | Bacteria | 622732 |
| 374 | Ga0495610_0001018 | 3300046512 | Bacteria | 25838 |
| 375 | Ga0495616_0000034 | 3300046513 | Bacteria | 129394 |
| 376 | Ga0495616_0000982 | 3300046513 | Bacteria | 20446 |
| 377 | Ga0495616_0001531 | 3300046513 | Bacteria | 15932 |
| 378 | Ga0495616_0002129 | 3300046513 | Bacteria | 13266 |
| 379 | Ga0495616_0005494 | 3300046513 | Bacteria | 7791 |
| 380 | Ga0495616_0008342 | 3300046513 | Bacteria | 6143 |
| 381 | Ga0495616_0021724 | 3300046513 | Bacteria | 3470 |
| 382 | Ga0495616_0033553 | 3300046513 | Bacteria | 2673 |
| 383 | Ga0495631_0001648 | 3300046518 | Bacteria | 13280 |
| 384 | Ga0495631_0004819 | 3300046518 | Bacteria | 7110 |
| 385 | Ga0495632_0000033 | 3300046519 | Bacteria | 164240 |
| 386 | Ga0495632_0000086 | 3300046519 | Bacteria | 95327 |
| 387 | Ga0495632_0000321 | 3300046519 | Bacteria | 46253 |
| 388 | Ga0495632_0001237 | 3300046519 | Bacteria | 21665 |
| 389 | Ga0495632_0023864 | 3300046519 | Bacteria | 3260 |
| 390 | Ga0495632_0041909 | 3300046519 | Bacteria | 2298 |
| 391 | Ga0495637_0004655 | 3300046520 | Bacteria | 7087 |
| 392 | Ga0495643_0000044 | 3300046522 | Bacteria | 226211 |
| 393 | Ga0495643_0000330 | 3300046522 | Bacteria | 65068 |
| 394 | Ga0495643_0000398 | 3300046522 | Bacteria | 57089 |
| 395 | Ga0495643_0000760 | 3300046522 | Bacteria | 36247 |
| 396 | Ga0495643_0006770 | 3300046522 | Bacteria | 7495 |
| 397 | Ga0495643_0014616 | 3300046522 | Bacteria | 4666 |
| 398 | Ga0495643_0016715 | 3300046522 | Bacteria | 4307 |
| 399 | Ga0495643_0018460 | 3300046522 | Bacteria | 4052 |
| 400 | Ga0495643_0028483 | 3300046522 | Bacteria | 3131 |
| 401 | Ga0495643_0042087 | 3300046522 | Bacteria | 2489 |
| 402 | Ga0495643_0086518 | 3300046522 | Bacteria | 1623 |
| 403 | Ga0495643_0086583 | 3300046522 | Bacteria | 1623 |
| 404 | Ga0495643_0093376 | 3300046522 | Bacteria | 1550 |
| 405 | Ga0495644_0000030 | 3300046523 | Bacteria | 66319 |
| 406 | Ga0495644_0000087 | 3300046523 | Bacteria | 46212 |
| 407 | Ga0495644_0014120 | 3300046523 | Bacteria | 3060 |
| 408 | Ga0495644_0025142 | 3300046523 | Bacteria | 2262 |
| 409 | Ga0495644_0048228 | 3300046523 | Bacteria | 1600 |
| 410 | Ga0495648_0000001 | 3300046524 | Bacteria | 696872 |
| 411 | Ga0495648_0000476 | 3300046524 | Bacteria | 43122 |
| 412 | Ga0495648_0000505 | 3300046524 | Bacteria | 41982 |
| 413 | Ga0495648_0001508 | 3300046524 | Bacteria | 22794 |
| 414 | Ga0495648_0011019 | 3300046524 | Bacteria | 6850 |
| 415 | Ga0495648_0013032 | 3300046524 | Bacteria | 6169 |
| 416 | Ga0495648_0027406 | 3300046524 | Bacteria | 3814 |
| 417 | Ga0495648_0035745 | 3300046524 | Bacteria | 3216 |
| 418 | Ga0495648_0051698 | 3300046524 | Bacteria | 2501 |
| 419 | Ga0495648_0124921 | 3300046524 | Bacteria | 1377 |
| 420 | Ga0495642_0000246 | 3300046528 | Bacteria | 30547 |
| 421 | Ga0495642_0000273 | 3300046528 | Bacteria | 29188 |
| 422 | Ga0495642_0000401 | 3300046528 | Bacteria | 23277 |
| 423 | Ga0495642_0064906 | 3300046528 | Bacteria | 1519 |
| 424 | Ga0495654_0000058 | 3300046530 | Bacteria | 139884 |
| 425 | Ga0495654_0001164 | 3300046530 | Bacteria | 18772 |
| 426 | Ga0495654_0002363 | 3300046530 | Bacteria | 12189 |
| 427 | Ga0495654_0019831 | 3300046530 | Bacteria | 3511 |
| 428 | Ga0495609_0000628 | 3300046538 | Bacteria | 27456 |
| 429 | Ga0495609_0000919 | 3300046538 | Bacteria | 21337 |
| 430 | Ga0495609_0002275 | 3300046538 | Bacteria | 11973 |
| 431 | Ga0495609_0002371 | 3300046538 | Bacteria | 11615 |
| 432 | Ga0495609_0005276 | 3300046538 | Bacteria | 6857 |
| 433 | Ga0495609_0024172 | 3300046538 | Bacteria | 2789 |
| 434 | Ga0495609_0037656 | 3300046538 | Bacteria | 2181 |
| 435 | Ga0495609_0065665 | 3300046538 | Bacteria | 1599 |
| 436 | Ga0495597_0000115 | 3300046542 | Bacteria | 72325 |
| 437 | Ga0495597_0000416 | 3300046542 | Bacteria | 36694 |
| 438 | Ga0495597_0000996 | 3300046542 | Bacteria | 21725 |
| 439 | Ga0495597_0001025 | 3300046542 | Bacteria | 21374 |
| 440 | Ga0495597_0015801 | 3300046542 | Bacteria | 3572 |
| 441 | Ga0495597_0029847 | 3300046542 | Bacteria | 2487 |
| 442 | Ga0495622_0000088 | 3300046557 | Bacteria | 82716 |
| 443 | Ga0495622_0014560 | 3300046557 | Bacteria | 3652 |
| 444 | Ga0495633_0000521 | 3300046558 | Bacteria | 38447 |
| 445 | Ga0495633_0001541 | 3300046558 | Bacteria | 17706 |
| 446 | Ga0495633_0003990 | 3300046558 | Bacteria | 9560 |
| 447 | Ga0495633_0005688 | 3300046558 | Bacteria | 7544 |
| 448 | Ga0495633_0007567 | 3300046558 | Bacteria | 6232 |
| 449 | Ga0495633_0020492 | 3300046558 | Bacteria | 3325 |
| 450 | Ga0495633_0028096 | 3300046558 | Bacteria | 2744 |
| 451 | Ga0495656_0002437 | 3300046615 | Bacteria | 6180 |
| 452 | Ga0495656_0034074 | 3300046615 | Bacteria | 2082 |
| 453 | Ga0495656_0074294 | 3300046615 | Bacteria | 1518 |
| 454 | Ga0495668_0000045 | 3300046616 | Bacteria | 225145 |
| 455 | Ga0495668_0000193 | 3300046616 | Bacteria | 89740 |
| 456 | Ga0495668_0000669 | 3300046616 | Bacteria | 41269 |
| 457 | Ga0495668_0019657 | 3300046616 | Bacteria | 3891 |
| 458 | Ga0495668_0031449 | 3300046616 | Bacteria | 2991 |
| 459 | Ga0495611_0000439 | 3300046648 | Bacteria | 25620 |
| 460 | Ga0495625_0000065 | 3300046660 | Bacteria | 173230 |
| 461 | Ga0495625_0001600 | 3300046660 | Bacteria | 26768 |
| 462 | Ga0495625_0002865 | 3300046660 | Bacteria | 18093 |
| 463 | Ga0495625_0003174 | 3300046660 | Bacteria | 16723 |
| 464 | Ga0495625_0010801 | 3300046660 | Bacteria | 7516 |
| 465 | Ga0495625_0020433 | 3300046660 | Bacteria | 5112 |
| 466 | Ga0495625_0027912 | 3300046660 | Bacteria | 4239 |
| 467 | Ga0495625_0067179 | 3300046660 | Bacteria | 2524 |
| 468 | Ga0495625_0084932 | 3300046660 | Bacteria | 2198 |
| 469 | Ga0495625_0105403 | 3300046660 | Bacteria | 1931 |
| 470 | Ga0495625_0138899 | 3300046660 | Bacteria | 1640 |
| 471 | Ga0495659_0000041 | 3300046664 | Bacteria | 59124 |
| 472 | Ga0495659_0000243 | 3300046664 | Bacteria | 22725 |
| 473 | Ga0495659_0005877 | 3300046664 | Bacteria | 3875 |
| 474 | Ga0495659_0015612 | 3300046664 | Bacteria | 2498 |
| 475 | Ga0495661_0000049 | 3300046665 | Bacteria | 144060 |
| 476 | Ga0495661_0000170 | 3300046665 | Bacteria | 77754 |
| 477 | Ga0495661_0000843 | 3300046665 | Bacteria | 28565 |
| 478 | Ga0495661_0001206 | 3300046665 | Bacteria | 22434 |
| 479 | Ga0495661_0002108 | 3300046665 | Bacteria | 15613 |
| 480 | Ga0495661_0014647 | 3300046665 | Bacteria | 5252 |
| 481 | Ga0495661_0015806 | 3300046665 | Bacteria | 5026 |
| 482 | Ga0495661_0024792 | 3300046665 | Bacteria | 3881 |
| 483 | Ga0495661_0029049 | 3300046665 | Bacteria | 3533 |
| 484 | Ga0495661_0074974 | 3300046665 | Bacteria | 1967 |
| 485 | Ga0495647_0000332 | 3300046681 | Bacteria | 13240 |
| 486 | Ga0495658_0000659 | 3300046683 | Bacteria | 18706 |
| 487 | Ga0495669_0008396 | 3300046684 | Bacteria | 4342 |
| 488 | Ga0495624_0038828 | 3300046690 | Bacteria | 3056 |
| 489 | Ga0495624_0039178 | 3300046690 | Bacteria | 3039 |
| 490 | Ga0495670_0000064 | 3300046691 | Bacteria | 47436 |
| 491 | Ga0495670_0020850 | 3300046691 | Bacteria | 3232 |
| 492 | Ga0495671_0000002 | 3300046692 | Bacteria | 1136189 |
| 493 | Ga0495671_0000131 | 3300046692 | Bacteria | 67432 |
| 494 | Ga0495671_0000198 | 3300046692 | Bacteria | 52877 |
| 495 | Ga0495671_0001101 | 3300046692 | Bacteria | 18664 |
| 496 | Ga0495671_0014286 | 3300046692 | Bacteria | 4277 |
| 497 | Ga0495671_0032750 | 3300046692 | Bacteria | 2652 |
| 498 | Ga0495671_0047840 | 3300046692 | Bacteria | 2135 |
| 499 | Ga0495649_0000166 | 3300046694 | Bacteria | 57538 |
| 500 | Ga0495649_0000303 | 3300046694 | Bacteria | 43094 |
| 501 | Ga0495649_0111140 | 3300046694 | Bacteria | 1453 |
| 502 | Ga0495589_0024973 | 3300046794 | Bacteria | 3034 |
| 503 | Ga0495589_0030641 | 3300046794 | Bacteria | 2709 |
| 504 | Ga0495660_0002620 | 3300046810 | Bacteria | 11425 |
| 505 | Ga0495660_0004863 | 3300046810 | Bacteria | 8088 |
| 506 | Ga0495660_0024680 | 3300046810 | Bacteria | 3424 |
| 507 | Ga0495660_0053376 | 3300046810 | Bacteria | 2194 |
| 508 | Ga0495660_0087452 | 3300046810 | Bacteria | 1625 |
| 509 | Ga0495636_0000067 | 3300047318 | Bacteria | 44261 |
| 510 | Ga0495636_0000361 | 3300047318 | Bacteria | 17364 |
| 511 | Ga0495636_0000537 | 3300047318 | Bacteria | 13950 |
| 512 | Ga0495636_0014179 | 3300047318 | Bacteria | 3169 |
| 513 | Ga0495636_0097928 | 3300047318 | Bacteria | 1279 |
| 514 | Ga0495672_0000031 | 3300047320 | Bacteria | 298258 |
| 515 | Ga0495672_0000685 | 3300047320 | Bacteria | 37744 |
| 516 | Ga0495672_0000918 | 3300047320 | Bacteria | 30795 |
| 517 | Ga0495672_0001603 | 3300047320 | Bacteria | 22074 |
| 518 | Ga0495672_0005983 | 3300047320 | Bacteria | 9528 |
| 519 | Ga0495672_0026249 | 3300047320 | Bacteria | 3719 |
| 520 | Ga0495680_0054184 | 3300047322 | Bacteria | 3116 |
| 521 | Ga0495680_0213911 | 3300047322 | Bacteria | 1379 |
| 522 | Ga0495683_0014460 | 3300047323 | Bacteria | 4111 |
| 523 | Ga0495683_0022503 | 3300047323 | Bacteria | 3240 |
| 524 | Ga0495687_000002 | 3300047443 | Bacteria | 1085770 |
| 525 | Ga0495687_000566 | 3300047443 | Bacteria | 43606 |
| 526 | Ga0495687_000603 | 3300047443 | Bacteria | 42021 |
| 527 | Ga0495687_001099 | 3300047443 | Bacteria | 26415 |
| 528 | Ga0495687_001273 | 3300047443 | Bacteria | 23729 |
| 529 | Ga0495687_002986 | 3300047443 | Bacteria | 12800 |
| 530 | Ga0495687_039408 | 3300047443 | Bacteria | 2090 |
| 531 | Ga0495677_0000448 | 3300047445 | Bacteria | 17572 |
| 532 | Ga0495677_0000512 | 3300047445 | Bacteria | 16307 |
| 533 | Ga0495677_0001444 | 3300047445 | Bacteria | 9529 |
| 534 | Ga0495677_0002369 | 3300047445 | Bacteria | 7408 |
| 535 | Ga0495677_0003267 | 3300047445 | Bacteria | 6320 |
| 536 | Ga0495679_000296 | 3300047446 | Bacteria | 40360 |
| 537 | Ga0495679_002037 | 3300047446 | Bacteria | 10678 |
| 538 | Ga0495679_005527 | 3300047446 | Bacteria | 5591 |
| 539 | Ga0495679_009576 | 3300047446 | Bacteria | 3867 |
| 540 | Ga0495679_026550 | 3300047446 | Bacteria | 1922 |
| 541 | Ga0495685_000307 | 3300047447 | Bacteria | 16005 |
| 542 | Ga0495685_000415 | 3300047447 | Bacteria | 13478 |
| 543 | Ga0495685_000442 | 3300047447 | Bacteria | 13039 |
| 544 | Ga0495685_002949 | 3300047447 | Bacteria | 5382 |
| 545 | Ga0495673_0000061 | 3300047469 | Bacteria | 230647 |
| 546 | Ga0495673_0000926 | 3300047469 | Bacteria | 26610 |
| 547 | Ga0495673_0003599 | 3300047469 | Bacteria | 10155 |
| 548 | Ga0495681_0000016 | 3300047470 | Bacteria | 181322 |
| 549 | Ga0495681_0006711 | 3300047470 | Bacteria | 7511 |
| 550 | Ga0495681_0020116 | 3300047470 | Bacteria | 3628 |
| 551 | Ga0495681_0045609 | 3300047470 | Bacteria | 2096 |
| 552 | Ga0495686_0000464 | 3300047472 | Bacteria | 60897 |
| 553 | Ga0495686_0078668 | 3300047472 | Bacteria | 2018 |
| 554 | Ga0495615_0005473 | 3300048090 | Bacteria | 2286 |
| 555 | Ga0495615_0045631 | 3300048090 | Bacteria | 1111 |
| 556 | Ga0495626_0003695 | 3300048091 | Bacteria | 9685 |
| 557 | Ga0495626_0004000 | 3300048091 | Bacteria | 9214 |
| 558 | Ga0495626_0007408 | 3300048091 | Bacteria | 6113 |
| 559 | Ga0495626_0008372 | 3300048091 | Bacteria | 5678 |
| 560 | Ga0495626_0022599 | 3300048091 | Bacteria | 3104 |
| 561 | Ga0495626_0039282 | 3300048091 | Bacteria | 2240 |
| 562 | Ga0495626_0048228 | 3300048091 | Bacteria | 1977 |
| 563 | Ga0496100_0007896 | 3300048903 | Bacteria | 5909 |
| 564 | Ga0496101_0156114 | 3300048904 | Bacteria | 1748 |
| 565 | Ga0496102_0178992 | 3300048905 | Bacteria | 1997 |
| 566 | Ga0496108_0165981 | 3300048911 | Bacteria | 1909 |
| 567 | Ga0496109_0043051 | 3300048912 | Bacteria | 4092 |
| 568 | Ga0496110_0073722 | 3300048913 | Bacteria | 3029 |
| 569 | Ga0496121_0317167 | 3300048924 | Bacteria | 1051 |
| 570 | Ga0496122_0000552 | 3300048925 | Bacteria | 77275 |
| 571 | Ga0496123_0001585 | 3300048926 | Bacteria | 30921 |
| 572 | Ga0496125_0001368 | 3300048928 | Bacteria | 35878 |
| 573 | Ga0495678_000009 | 3300049459 | Bacteria | 373806 |
| 574 | Ga0495678_000035 | 3300049459 | Bacteria | 200957 |
| 575 | Ga0495678_000215 | 3300049459 | Bacteria | 66940 |
| 576 | Ga0495678_000870 | 3300049459 | Bacteria | 26857 |
| 577 | Ga0495678_013147 | 3300049459 | Bacteria | 3896 |
| 578 | Ga0495682_0000825 | 3300049460 | Bacteria | 19451 |
| 579 | Ga0495682_0001155 | 3300049460 | Bacteria | 15187 |
| 580 | Ga0495682_0002609 | 3300049460 | Bacteria | 8457 |
| 581 | Ga0495682_0005605 | 3300049460 | Bacteria | 5195 |
| 582 | Ga0501292_005421 | 3300049515 | Bacteria | 1778 |
| 583 | Ga0501034_0001279 | 3300049571 | Bacteria | 34010 |
| 584 | Ga0501034_0177688 | 3300049571 | Bacteria | 2094 |
| 585 | Ga0501043_0010569 | 3300049579 | Bacteria | 7226 |
| 586 | Ga0501046_0012537 | 3300049580 | Bacteria | 7209 |
| 587 | Ga0501047_0015658 | 3300049581 | Bacteria | 7226 |
| 588 | Ga0501068_0006293 | 3300049584 | Bacteria | 6538 |
| 589 | Ga0501070_0060688 | 3300049586 | Bacteria | 3134 |
| 590 | Ga0501072_0013881 | 3300049588 | Bacteria | 6173 |
| 591 | Ga0501073_0054792 | 3300049589 | Bacteria | 2791 |
| 592 | Ga0501080_0194464 | 3300049742 | Bacteria | 1863 |
| 593 | Ga0501083_0120754 | 3300049744 | Bacteria | 1719 |
| 594 | Ga0501262_001032 | 3300049759 | Bacteria | 3150 |
| 595 | Ga0501045_0049558 | 3300049824 | Bacteria | 3062 |
| 596 | nmdc:mga03n38_5431_c1 | 3300050490 | Bacteria | 4341 |
| 597 | nmdc:mga00v17_67048_c1 | 3300050491 | Bacteria | 2217 |
| 598 | nmdc:mga0yw44_142853_c1 | 3300050492 | Bacteria | 1556 |
| 599 | nmdc:mga0yw44_31056_c1 | 3300050492 | Bacteria | 3103 |
| 600 | nmdc:mga0k408_13676_c1 | 3300050493 | Bacteria | 4456 |
| 601 | nmdc:mga0k408_1832_c1 | 3300050493 | Bacteria | 11407 |
| 602 | nmdc:mga0k408_18764_c1 | 3300050493 | Bacteria | 3863 |
| 603 | nmdc:mga0k408_3006_c2 | 3300050493 | Bacteria | 7321 |
| 604 | nmdc:mga0k408_3937_c1 | 3300050493 | Bacteria | 7878 |
| 605 | nmdc:mga0k408_57762_c1 | 3300050493 | Bacteria | 2253 |
| 606 | nmdc:mga07m45_127_c1 | 3300050496 | Bacteria | 30414 |
| 607 | nmdc:mga07m45_85267_c1 | 3300050496 | Bacteria | 1806 |
| 608 | nmdc:mga0qj67_109220_c1 | 3300050509 | Bacteria | 2232 |
| 609 | nmdc:mga0sz30_43269_c1 | 3300050516 | Bacteria | 1896 |
| 610 | nmdc:mga0sz30_71771_c1 | 3300050516 | Bacteria | 1491 |
| 611 | Ga0500644_0010789 | 3300053088 | Bacteria | 2480 |
| 612 | Ga0500644_0093379 | 3300053088 | Bacteria | 1130 |
| 613 | Ga0500647_0128669 | 3300053091 | Bacteria | 1195 |
| 614 | Ga0500583_0032769 | 3300053092 | Bacteria | 2294 |
| 615 | Ga0500593_000057 | 3300053117 | Bacteria | 41215 |
| 616 | Ga0500594_0015641 | 3300053118 | Bacteria | 1832 |
| 617 | Ga0500618_000173 | 3300053125 | Bacteria | 53346 |
| 618 | Ga0500559_0005150 | 3300053136 | Bacteria | 6038 |
| 619 | Ga0500586_000649 | 3300053145 | Bacteria | 7086 |
| 620 | Ga0500586_040450 | 3300053145 | Bacteria | 1579 |
| 621 | Ga0500619_009851 | 3300053154 | Bacteria | 2390 |
| 622 | Ga0500622_0008524 | 3300053156 | Bacteria | 5727 |
| 623 | Ga0500639_008998 | 3300053163 | Bacteria | 5208 |
| 624 | Ga0500587_005663 | 3300053739 | Bacteria | 1672 |
| 625 | Ga0501084_0366658 | 3300054114 | Bacteria | 1217 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300044683 | Ga0466965_0222073 | Ga0466965_0222073_113_982 | 289 |
| 2 | 3300048924 | Ga0496121_0317167 | Ga0496121_0317167_17_901 | 292 |
| 3 | 3300046522 | Ga0495643_0016715 | Ga0495643_0016715_1463_2512 | 308 |
| 4 | 3300046542 | Ga0495597_0029847 | Ga0495597_0029847_61_1110 | 308 |
| 5 | 3300046665 | Ga0495661_0002108 | Ga0495661_0002108_7032_8081 | 308 |
| 6 | 3300046522 | Ga0495643_0086583 | Ga0495643_0086583_553_1491 | 311 |
| 7 | 3300046474 | Ga0495605_0116741 | Ga0495605_0116741_38_997 | 317 |
| 8 | 3300046506 | Ga0495583_0023323 | Ga0495583_0023323_1514_2470 | 317 |
| 9 | 3300046522 | Ga0495643_0093376 | Ga0495643_0093376_556_1515 | 317 |
| 10 | 3300005535 | Ga0070684_100074345 | Ga0070684_1000743452 | 322 |
| 11 | 3300005578 | Ga0068854_100007377 | Ga0068854_1000073775 | 322 |
| 12 | 3300005616 | Ga0068852_100006894 | Ga0068852_1000068944 | 322 |
| 13 | 3300025945 | Ga0207679_10013747 | Ga0207679_100137474 | 322 |
| 14 | 3300041512 | Ga0451853_0840822 | Ga0451853_0840822_770_1741 | 323 |
| 15 | 3300046460 | Ga0495638_0002754 | Ga0495638_0002754_1013_1984 | 323 |
| 16 | 3300046460 | Ga0495638_0144893 | Ga0495638_0144893_20_997 | 323 |
| 17 | 3300046660 | Ga0495625_0001600 | Ga0495625_0001600_8783_9754 | 323 |
| 18 | 3300035695 | Ga0373927_0074895 | Ga0373927_0074895_1076_2158 | 333 |
| 19 | 3300035691 | Ga0373931_0124710 | Ga0373931_0124710_110_1156 | 334 |
| 20 | iso_pu_bacteria | 2842711865 | 2842713446 | 336 |
| 21 | 3300009177 | Ga0105248_10283602 | Ga0105248_102836022 | 338 |
| 22 | 3300025914 | Ga0207671_10082937 | Ga0207671_100829372 | 338 |
| 23 | 3300046457 | Ga0495590_0001681 | Ga0495590_0001681_3062_4123 | 338 |
| 24 | 3300002738 | JGI25154J39366_1000278 | JGI25154J39366_10002788 | 339 |
| 25 | 3300025246 | Ga0209646_1000023 | Ga0209646_1000023353 | 339 |
| 26 | 3300031548 | Ga0307408_100000196 | Ga0307408_10000019623 | 339 |
| 27 | 3300046457 | Ga0495590_0000001 | Ga0495590_0000001_345858_346886 | 339 |
| 28 | 3300046471 | Ga0495650_0000001 | Ga0495650_0000001_688490_689515 | 339 |
| 29 | 3300046501 | Ga0495607_0000867 | Ga0495607_0000867_13516_14544 | 339 |
| 30 | 3300046506 | Ga0495583_0000127 | Ga0495583_0000127_18538_19563 | 339 |
| 31 | 3300046506 | Ga0495583_0002687 | Ga0495583_0002687_3131_4159 | 339 |
| 32 | 3300046506 | Ga0495583_0022588 | Ga0495583_0022588_1376_2401 | 339 |
| 33 | 3300046513 | Ga0495616_0033553 | Ga0495616_0033553_1005_2063 | 339 |
| 34 | 3300046522 | Ga0495643_0000044 | Ga0495643_0000044_45525_46553 | 339 |
| 35 | 3300046522 | Ga0495643_0000760 | Ga0495643_0000760_23934_24998 | 339 |
| 36 | 3300046522 | Ga0495643_0014616 | Ga0495643_0014616_1930_2955 | 339 |
| 37 | 3300046523 | Ga0495644_0025142 | Ga0495644_0025142_344_1369 | 339 |
| 38 | 3300046524 | Ga0495648_0000001 | Ga0495648_0000001_502341_503369 | 339 |
| 39 | 3300046528 | Ga0495642_0000401 | Ga0495642_0000401_7632_8660 | 339 |
| 40 | 3300046538 | Ga0495609_0000628 | Ga0495609_0000628_14354_15382 | 339 |
| 41 | 3300046542 | Ga0495597_0000115 | Ga0495597_0000115_57515_58543 | 339 |
| 42 | 3300046615 | Ga0495656_0002437 | Ga0495656_0002437_4023_5048 | 339 |
| 43 | 3300046615 | Ga0495656_0074294 | Ga0495656_0074294_301_1326 | 339 |
| 44 | 3300046616 | Ga0495668_0000045 | Ga0495668_0000045_38799_39827 | 339 |
| 45 | 3300046660 | Ga0495625_0000065 | Ga0495625_0000065_134671_135699 | 339 |
| 46 | 3300046660 | Ga0495625_0003174 | Ga0495625_0003174_2021_3049 | 339 |
| 47 | 3300046664 | Ga0495659_0015612 | Ga0495659_0015612_900_1970 | 339 |
| 48 | 3300046691 | Ga0495670_0020850 | Ga0495670_0020850_162_1187 | 339 |
| 49 | 3300046692 | Ga0495671_0047840 | Ga0495671_0047840_820_1848 | 339 |
| 50 | 3300046810 | Ga0495660_0002620 | Ga0495660_0002620_9184_10212 | 339 |
| 51 | 3300047318 | Ga0495636_0000537 | Ga0495636_0000537_2249_3277 | 339 |
| 52 | 3300047318 | Ga0495636_0097928 | Ga0495636_0097928_195_1220 | 339 |
| 53 | 3300047443 | Ga0495687_001099 | Ga0495687_001099_10150_11178 | 339 |
| 54 | 3300047443 | Ga0495687_001273 | Ga0495687_001273_10145_11173 | 339 |
| 55 | 3300047443 | Ga0495687_002986 | Ga0495687_002986_2262_3290 | 339 |
| 56 | 3300047443 | Ga0495687_039408 | Ga0495687_039408_154_1218 | 339 |
| 57 | 3300047445 | Ga0495677_0002369 | Ga0495677_0002369_4222_5250 | 339 |
| 58 | 3300047447 | Ga0495685_000307 | Ga0495685_000307_5467_6495 | 339 |
| 59 | 3300048090 | Ga0495615_0005473 | Ga0495615_0005473_999_2024 | 339 |
| 60 | 3300048090 | Ga0495615_0045631 | Ga0495615_0045631_25_1050 | 339 |
| 61 | 3300048091 | Ga0495626_0003695 | Ga0495626_0003695_3235_4260 | 339 |
| 62 | 3300048091 | Ga0495626_0008372 | Ga0495626_0008372_1033_2109 | 339 |
| 63 | 3300048091 | Ga0495626_0039282 | Ga0495626_0039282_109_1173 | 339 |
| 64 | iso_pu_bacteria | 2738541280 | 2738739730 | 339 |
| 65 | iso_pu_bacteria | 2738541297 | 2738830464 | 339 |
| 66 | iso_pu_bacteria | 2738541357 | 2739154260 | 339 |
| 67 | iso_pu_bacteria | 2738543003 | 2739196207 | 339 |
| 68 | iso_pu_bacteria | 2738543026 | 2739322656 | 339 |
| 69 | iso_pu_bacteria | 2738543029 | 2739340897 | 339 |
| 70 | iso_pu_bacteria | 2919704043 | 2919708067 | 339 |
| 71 | iso_pu_bacteria | 2904530477 | 2904532425 | 340 |
| 72 | iso_pu_bacteria | 2923510766 | 2923515414 | 340 |
| 73 | 3300005356 | Ga0070674_100380950 | Ga0070674_1003809501 | 341 |
| 74 | 3300005456 | Ga0070678_100042691 | Ga0070678_1000426912 | 341 |
| 75 | 3300005459 | Ga0068867_100103519 | Ga0068867_1001035192 | 341 |
| 76 | 3300005843 | Ga0068860_100219142 | Ga0068860_1002191422 | 341 |
| 77 | 3300006177 | Ga0075362_10009785 | Ga0075362_100097852 | 341 |
| 78 | 3300006358 | Ga0068871_100168570 | Ga0068871_1001685702 | 341 |
| 79 | 3300014326 | Ga0157380_10111063 | Ga0157380_101110632 | 341 |
| 80 | 3300025938 | Ga0207704_10067551 | Ga0207704_100675512 | 341 |
| 81 | 3300026089 | Ga0207648_10036621 | Ga0207648_100366212 | 341 |
| 82 | 3300028381 | Ga0268264_10151399 | Ga0268264_101513992 | 341 |
| 83 | 3300035113 | Ga0373936_0000014 | Ga0373936_0000014_102329_103357 | 341 |
| 84 | 3300037312 | Ga0395899_0002901 | Ga0395899_0002901_4595_5635 | 341 |
| 85 | 3300037312 | Ga0395899_0003277 | Ga0395899_0003277_8517_9557 | 341 |
| 86 | 3300037418 | Ga0395900_0003982 | Ga0395900_0003982_6584_7624 | 341 |
| 87 | 3300037418 | Ga0395900_0006947 | Ga0395900_0006947_3178_4218 | 341 |
| 88 | 3300037466 | Ga0395898_0008585 | Ga0395898_0008585_7072_8112 | 341 |
| 89 | 3300037466 | Ga0395898_0011655 | Ga0395898_0011655_7443_8483 | 341 |
| 90 | 3300037471 | Ga0395905_0004813 | Ga0395905_0004813_8118_9158 | 341 |
| 91 | 3300038443 | Ga0395901_0022179 | Ga0395901_0022179_4356_5396 | 341 |
| 92 | 3300038443 | Ga0395901_0050898 | Ga0395901_0050898_538_1578 | 341 |
| 93 | 3300045836 | Ga0466958_0017064 | Ga0466958_0017064_2903_3943 | 341 |
| 94 | 3300046452 | Ga0495617_001179 | Ga0495617_001179_1500_2609 | 341 |
| 95 | 3300046471 | Ga0495650_0000051 | Ga0495650_0000051_248770_249798 | 341 |
| 96 | 3300046491 | Ga0495584_0011146 | Ga0495584_0011146_1769_2878 | 341 |
| 97 | 3300046506 | Ga0495583_0029866 | Ga0495583_0029866_1404_2480 | 341 |
| 98 | 3300046522 | Ga0495643_0000398 | Ga0495643_0000398_53135_54199 | 341 |
| 99 | 3300046538 | Ga0495609_0024172 | Ga0495609_0024172_945_2054 | 341 |
| 100 | 3300046558 | Ga0495633_0001541 | Ga0495633_0001541_11006_12115 | 341 |
| 101 | 3300046660 | Ga0495625_0027912 | Ga0495625_0027912_2767_3795 | 341 |
| 102 | 3300046692 | Ga0495671_0032750 | Ga0495671_0032750_1026_2135 | 341 |
| 103 | 3300048905 | Ga0496102_0178992 | Ga0496102_0178992_720_1766 | 341 |
| 104 | 3300049460 | Ga0495682_0000825 | Ga0495682_0000825_5355_6464 | 341 |
| 105 | 3300049744 | Ga0501083_0120754 | Ga0501083_0120754_131_1171 | 341 |
| 106 | iso_pu_bacteria | 2818991445 | 2819594126 | 341 |
| 107 | 3300005328 | Ga0070676_10010954 | Ga0070676_100109542 | 342 |
| 108 | 3300005330 | Ga0070690_100010785 | Ga0070690_1000107854 | 342 |
| 109 | 3300005334 | Ga0068869_100007924 | Ga0068869_1000079243 | 342 |
| 110 | 3300005336 | Ga0070680_100188942 | Ga0070680_1001889422 | 342 |
| 111 | 3300005338 | Ga0068868_100076352 | Ga0068868_1000763522 | 342 |
| 112 | 3300005340 | Ga0070689_100006491 | Ga0070689_1000064916 | 342 |
| 113 | 3300005340 | Ga0070689_100082346 | Ga0070689_1000823463 | 342 |
| 114 | 3300005438 | Ga0070701_10000403 | Ga0070701_100004035 | 342 |
| 115 | 3300005441 | Ga0070700_100002730 | Ga0070700_1000027308 | 342 |
| 116 | 3300005456 | Ga0070678_100004661 | Ga0070678_1000046615 | 342 |
| 117 | 3300005459 | Ga0068867_100007948 | Ga0068867_1000079487 | 342 |
| 118 | 3300005544 | Ga0070686_100001963 | Ga0070686_1000019637 | 342 |
| 119 | 3300005545 | Ga0070695_100099432 | Ga0070695_1000994322 | 342 |
| 120 | 3300005545 | Ga0070695_100153193 | Ga0070695_1001531932 | 342 |
| 121 | 3300005547 | Ga0070693_100007222 | Ga0070693_1000072225 | 342 |
| 122 | 3300005549 | Ga0070704_100269721 | Ga0070704_1002697211 | 342 |
| 123 | 3300005563 | Ga0068855_100001569 | Ga0068855_10000156919 | 342 |
| 124 | 3300005564 | Ga0070664_100000426 | Ga0070664_1000004269 | 342 |
| 125 | 3300005614 | Ga0068856_100000978 | Ga0068856_10000097817 | 342 |
| 126 | 3300005617 | Ga0068859_100011217 | Ga0068859_1000112175 | 342 |
| 127 | 3300005718 | Ga0068866_10002351 | Ga0068866_100023517 | 342 |
| 128 | 3300005719 | Ga0068861_100007675 | Ga0068861_1000076754 | 342 |
| 129 | 3300005840 | Ga0068870_10021148 | Ga0068870_100211482 | 342 |
| 130 | 3300005842 | Ga0068858_100004891 | Ga0068858_10000489116 | 342 |
| 131 | 3300005843 | Ga0068860_100078082 | Ga0068860_1000780821 | 342 |
| 132 | 3300006237 | Ga0097621_100038338 | Ga0097621_1000383383 | 342 |
| 133 | 3300006358 | Ga0068871_100006001 | Ga0068871_1000060015 | 342 |
| 134 | 3300006881 | Ga0068865_100002680 | Ga0068865_1000026808 | 342 |
| 135 | 3300006931 | Ga0097620_100011217 | Ga0097620_1000112176 | 342 |
| 136 | 3300009098 | Ga0105245_10021546 | Ga0105245_100215465 | 342 |
| 137 | 3300009148 | Ga0105243_10022655 | Ga0105243_100226554 | 342 |
| 138 | 3300009148 | Ga0105243_10264203 | Ga0105243_102642032 | 342 |
| 139 | 3300009176 | Ga0105242_10002015 | Ga0105242_100020155 | 342 |
| 140 | 3300009177 | Ga0105248_10204078 | Ga0105248_102040782 | 342 |
| 141 | 3300013102 | Ga0157371_10000422 | Ga0157371_100004225 | 342 |
| 142 | 3300013297 | Ga0157378_10026828 | Ga0157378_100268285 | 342 |
| 143 | 3300013308 | Ga0157375_10182308 | Ga0157375_101823082 | 342 |
| 144 | 3300014326 | Ga0157380_10036152 | Ga0157380_100361522 | 342 |
| 145 | 3300014968 | Ga0157379_10160163 | Ga0157379_101601632 | 342 |
| 146 | 3300025899 | Ga0207642_10022558 | Ga0207642_100225581 | 342 |
| 147 | 3300025907 | Ga0207645_10010581 | Ga0207645_100105813 | 342 |
| 148 | 3300025907 | Ga0207645_10162183 | Ga0207645_101621832 | 342 |
| 149 | 3300025934 | Ga0207686_10003923 | Ga0207686_100039231 | 342 |
| 150 | 3300025935 | Ga0207709_10143820 | Ga0207709_101438202 | 342 |
| 151 | 3300025936 | Ga0207670_10011083 | Ga0207670_100110835 | 342 |
| 152 | 3300025942 | Ga0207689_10002140 | Ga0207689_100021404 | 342 |
| 153 | 3300025945 | Ga0207679_10002864 | Ga0207679_100028645 | 342 |
| 154 | 3300025949 | Ga0207667_10009133 | Ga0207667_100091333 | 342 |
| 155 | 3300026023 | Ga0207677_10030771 | Ga0207677_100307714 | 342 |
| 156 | 3300026075 | Ga0207708_10000219 | Ga0207708_1000021917 | 342 |
| 157 | 3300026089 | Ga0207648_10000534 | Ga0207648_1000053427 | 342 |
| 158 | 3300026118 | Ga0207675_100000531 | Ga0207675_10000053124 | 342 |
| 159 | 3300026121 | Ga0207683_10009791 | Ga0207683_100097914 | 342 |
| 160 | 3300027671 | Ga0209588_1016549 | Ga0209588_10165493 | 342 |
| 161 | 3300031548 | Ga0307408_100001382 | Ga0307408_10000138214 | 342 |
| 162 | 3300031901 | Ga0307406_10000931 | Ga0307406_100009319 | 342 |
| 163 | 3300049571 | Ga0501034_0001279 | Ga0501034_0001279_28577_29617 | 342 |
| 164 | 3300049571 | Ga0501034_0177688 | Ga0501034_0177688_594_1634 | 342 |
| 165 | 3300049584 | Ga0501068_0006293 | Ga0501068_0006293_2986_4029 | 342 |
| 166 | 3300049586 | Ga0501070_0060688 | Ga0501070_0060688_1592_2635 | 342 |
| 167 | 3300049588 | Ga0501072_0013881 | Ga0501072_0013881_1674_2714 | 342 |
| 168 | 3300049742 | Ga0501080_0194464 | Ga0501080_0194464_750_1793 | 342 |
| 169 | 3300054114 | Ga0501084_0366658 | Ga0501084_0366658_17_1060 | 342 |
| 170 | iso_pu_bacteria | 2551306416 | 2553004586 | 342 |
| 171 | iso_pu_bacteria | 2919046199 | 2919047936 | 342 |
| 172 | 3300003320 | rootH2_10099521 | rootH2_100995211 | 343 |
| 173 | 3300003322 | rootL2_10293613 | rootL2_102936132 | 343 |
| 174 | 3300005563 | Ga0068855_100000028 | Ga0068855_10000002857 | 343 |
| 175 | 3300025245 | Ga0207425_1001011 | Ga0207425_10010113 | 343 |
| 176 | 3300025294 | Ga0209025_1006776 | Ga0209025_10067768 | 343 |
| 177 | 3300025297 | Ga0209758_1000679 | Ga0209758_100067927 | 343 |
| 178 | 3300046665 | Ga0495661_0000049 | Ga0495661_0000049_90546_91592 | 343 |
| 179 | 3300048903 | Ga0496100_0007896 | Ga0496100_0007896_4266_5312 | 343 |
| 180 | 3300048911 | Ga0496108_0165981 | Ga0496108_0165981_76_1122 | 343 |
| 181 | 3300048912 | Ga0496109_0043051 | Ga0496109_0043051_1170_2216 | 343 |
| 182 | 3300048925 | Ga0496122_0000552 | Ga0496122_0000552_52182_53228 | 343 |
| 183 | 3300048926 | Ga0496123_0001585 | Ga0496123_0001585_19937_20983 | 343 |
| 184 | 3300048928 | Ga0496125_0001368 | Ga0496125_0001368_9942_10988 | 343 |
| 185 | 3300005327 | Ga0070658_10132634 | Ga0070658_101326342 | 344 |
| 186 | 3300005329 | Ga0070683_100112346 | Ga0070683_1001123462 | 344 |
| 187 | 3300005364 | Ga0070673_100159833 | Ga0070673_1001598332 | 344 |
| 188 | 3300005577 | Ga0068857_100159869 | Ga0068857_1001598692 | 344 |
| 189 | 3300006175 | Ga0070712_100085822 | Ga0070712_1000858222 | 344 |
| 190 | 3300013307 | Ga0157372_10201843 | Ga0157372_102018432 | 344 |
| 191 | 3300025909 | Ga0207705_10057039 | Ga0207705_100570392 | 344 |
| 192 | 3300025944 | Ga0207661_10051048 | Ga0207661_100510483 | 344 |
| 193 | 3300025949 | Ga0207667_10252379 | Ga0207667_102523791 | 344 |
| 194 | 3300025960 | Ga0207651_10129602 | Ga0207651_101296022 | 344 |
| 195 | 3300028794 | Ga0307515_10097942 | Ga0307515_100979423 | 344 |
| 196 | 3300037471 | Ga0395905_0148831 | Ga0395905_0148831_124_1164 | 344 |
| 197 | 3300041460 | Ga0451802_1256569 | Ga0451802_1256569_155_1189 | 344 |
| 198 | 3300042461 | Ga0439460_0024484 | Ga0439460_0024484_149_1186 | 344 |
| 199 | iso_pu_bacteria | 2585428062 | 2587758683 | 344 |
| 200 | iso_pu_bacteria | 2643221611 | 2644075761 | 344 |
| 201 | iso_pu_bacteria | 2738541300 | 2738843852 | 344 |
| 202 | iso_pu_bacteria | 2738543018 | 2739274586 | 344 |
| 203 | iso_pu_bacteria | 2738543030 | 2739343630 | 344 |
| 204 | 3300002704 | JGI25155J39150_1000302 | JGI25155J39150_10003023 | 345 |
| 205 | 3300002704 | JGI25155J39150_1000941 | JGI25155J39150_10009411 | 345 |
| 206 | 3300002705 | JGI25156J39149_1000039 | JGI25156J39149_100003983 | 345 |
| 207 | 3300002705 | JGI25156J39149_1002181 | JGI25156J39149_10021815 | 345 |
| 208 | 3300002738 | JGI25154J39366_1000059 | JGI25154J39366_100005983 | 345 |
| 209 | 3300002738 | JGI25154J39366_1000497 | JGI25154J39366_100049715 | 345 |
| 210 | 3300002741 | JGI25157J39369_1000057 | JGI25157J39369_100005717 | 345 |
| 211 | 3300003758 | Ga0055532_1000018 | Ga0055532_1000018266 | 345 |
| 212 | 3300003761 | Ga0055535_1007095 | Ga0055535_10070952 | 345 |
| 213 | 3300025206 | Ga0209435_100007 | Ga0209435_100007455 | 345 |
| 214 | 3300025229 | Ga0209147_100017 | Ga0209147_10001718 | 345 |
| 215 | 3300025242 | Ga0209258_100297 | Ga0209258_10029761 | 345 |
| 216 | 3300025246 | Ga0209646_1000061 | Ga0209646_100006134 | 345 |
| 217 | 3300025246 | Ga0209646_1000096 | Ga0209646_1000096143 | 345 |
| 218 | 3300025250 | Ga0209026_1000052 | Ga0209026_1000052208 | 345 |
| 219 | 3300025256 | Ga0209759_1000174 | Ga0209759_100017418 | 345 |
| 220 | 3300025256 | Ga0209759_1000209 | Ga0209759_100020933 | 345 |
| 221 | 3300025272 | Ga0209455_1019008 | Ga0209455_10190082 | 345 |
| 222 | 3300037312 | Ga0395899_0005643 | Ga0395899_0005643_183_1226 | 345 |
| 223 | 3300037418 | Ga0395900_0047376 | Ga0395900_0047376_1343_2386 | 345 |
| 224 | 3300038443 | Ga0395901_0019451 | Ga0395901_0019451_5139_6182 | 345 |
| 225 | 3300044656 | Ga0466969_0012519 | Ga0466969_0012519_242_1282 | 345 |
| 226 | 3300044693 | Ga0466961_0000421 | Ga0466961_0000421_16374_17414 | 345 |
| 227 | 3300049589 | Ga0501073_0054792 | Ga0501073_0054792_1328_2371 | 345 |
| 228 | iso_pu_bacteria | 2511231002 | 2511242543 | 345 |
| 229 | iso_pu_bacteria | 2547132374 | 2548498602 | 345 |
| 230 | iso_pu_bacteria | 2643221609 | 2644059197 | 345 |
| 231 | iso_pu_bacteria | 2643221717 | 2644649337 | 345 |
| 232 | iso_pu_bacteria | 2738543012 | 2739240690 | 345 |
| 233 | iso_pu_bacteria | 2816332133 | 2816472233 | 345 |
| 234 | iso_pu_bacteria | 2929160207 | 2929165646 | 345 |
| 235 | 3300002737 | JGI25162J39368_1004881 | JGI25162J39368_10048812 | 346 |
| 236 | 3300006195 | Ga0075366_10014644 | Ga0075366_100146443 | 346 |
| 237 | 3300014497 | Ga0182008_10005147 | Ga0182008_100051472 | 346 |
| 238 | 3300025233 | Ga0209437_100272 | Ga0209437_10027242 | 346 |
| 239 | 3300025906 | Ga0207699_10073140 | Ga0207699_100731402 | 346 |
| 240 | 3300035410 | Ga0373924_0055919 | Ga0373924_0055919_106_1176 | 346 |
| 241 | 3300036401 | Ga0373937_0077753 | Ga0373937_0077753_32_1102 | 346 |
| 242 | 3300037312 | Ga0395899_0000439 | Ga0395899_0000439_33862_34908 | 346 |
| 243 | 3300037418 | Ga0395900_0031706 | Ga0395900_0031706_806_1852 | 346 |
| 244 | 3300038443 | Ga0395901_0123389 | Ga0395901_0123389_1619_2665 | 346 |
| 245 | 3300038443 | Ga0395901_0125258 | Ga0395901_0125258_342_1388 | 346 |
| 246 | 3300044658 | Ga0466972_0074011 | Ga0466972_0074011_155_1201 | 346 |
| 247 | 3300044684 | Ga0466966_0013155 | Ga0466966_0013155_3416_4462 | 346 |
| 248 | 3300046492 | Ga0495585_0033368 | Ga0495585_0033368_1215_2276 | 346 |
| 249 | 3300046519 | Ga0495632_0041909 | Ga0495632_0041909_516_1580 | 346 |
| 250 | 3300048904 | Ga0496101_0156114 | Ga0496101_0156114_492_1538 | 346 |
| 251 | 3300048913 | Ga0496110_0073722 | Ga0496110_0073722_886_1932 | 346 |
| 252 | 3300002987 | JGI25159J45721_1001495 | JGI25159J45721_100149513 | 347 |
| 253 | 3300003187 | JGI25151J46595_10006031 | JGI25151J46595_100060312 | 347 |
| 254 | 3300003187 | JGI25151J46595_10006574 | JGI25151J46595_100065746 | 347 |
| 255 | 3300003773 | Ga0055537_1000047 | Ga0055537_100004734 | 347 |
| 256 | 3300003775 | Ga0055524_1000039 | Ga0055524_100003940 | 347 |
| 257 | 3300003784 | Ga0055534_1000141 | Ga0055534_100014127 | 347 |
| 258 | 3300003791 | Ga0055530_10000532 | Ga0055530_1000053229 | 347 |
| 259 | 3300003792 | Ga0055540_1000047 | Ga0055540_100004730 | 347 |
| 260 | 3300003794 | Ga0055531_10011051 | Ga0055531_100110515 | 347 |
| 261 | 3300005262 | Ga0065165_1005321 | Ga0065165_10053216 | 347 |
| 262 | 3300005539 | Ga0068853_100027653 | Ga0068853_1000276532 | 347 |
| 263 | 3300009545 | Ga0105237_10126559 | Ga0105237_101265592 | 347 |
| 264 | 3300025245 | Ga0207425_1008751 | Ga0207425_10087512 | 347 |
| 265 | 3300025263 | Ga0209565_1000080 | Ga0209565_100008035 | 347 |
| 266 | 3300025273 | Ga0209673_1000088 | Ga0209673_1000088111 | 347 |
| 267 | 3300025284 | Ga0209130_1000346 | Ga0209130_100034630 | 347 |
| 268 | 3300025291 | Ga0209675_1000133 | Ga0209675_100013375 | 347 |
| 269 | 3300025291 | Ga0209675_1024886 | Ga0209675_10248861 | 347 |
| 270 | 3300025292 | Ga0209676_1000073 | Ga0209676_1000073221 | 347 |
| 271 | 3300025292 | Ga0209676_1002444 | Ga0209676_100244414 | 347 |
| 272 | 3300025294 | Ga0209025_1003514 | Ga0209025_100351414 | 347 |
| 273 | 3300025294 | Ga0209025_1004730 | Ga0209025_10047307 | 347 |
| 274 | 3300025294 | Ga0209025_1009596 | Ga0209025_10095963 | 347 |
| 275 | 3300025295 | Ga0209564_1000313 | Ga0209564_100031349 | 347 |
| 276 | 3300025295 | Ga0209564_1000823 | Ga0209564_100082322 | 347 |
| 277 | 3300025295 | Ga0209564_1005212 | Ga0209564_10052126 | 347 |
| 278 | 3300025298 | Ga0209050_1000008 | Ga0209050_1000008842 | 347 |
| 279 | 3300025299 | Ga0209256_1000096 | Ga0209256_100009696 | 347 |
| 280 | 3300025302 | Ga0207426_1001354 | Ga0207426_100135422 | 347 |
| 281 | 3300025303 | Ga0209051_1000005 | Ga0209051_1000005842 | 347 |
| 282 | 3300025304 | Ga0209257_1000031 | Ga0209257_1000031432 | 347 |
| 283 | 3300025304 | Ga0209257_1002902 | Ga0209257_10029026 | 347 |
| 284 | 3300026142 | Ga0207698_10152124 | Ga0207698_101521242 | 347 |
| 285 | 3300035171 | Ga0373946_0025912 | Ga0373946_0025912_597_1679 | 347 |
| 286 | 3300035410 | Ga0373924_0001472 | Ga0373924_0001472_6041_7096 | 347 |
| 287 | 3300035725 | Ga0373947_0064981 | Ga0373947_0064981_726_1808 | 347 |
| 288 | 3300037068 | Ga0373925_0062980 | Ga0373925_0062980_548_1630 | 347 |
| 289 | 3300046452 | Ga0495617_013587 | Ga0495617_013587_805_1866 | 347 |
| 290 | 3300046453 | Ga0495627_000015 | Ga0495627_000015_231847_232908 | 347 |
| 291 | 3300046460 | Ga0495638_0005064 | Ga0495638_0005064_1416_2477 | 347 |
| 292 | 3300046463 | Ga0495653_0000009 | Ga0495653_0000009_214164_215225 | 347 |
| 293 | 3300046471 | Ga0495650_0000164 | Ga0495650_0000164_25139_26200 | 347 |
| 294 | 3300046471 | Ga0495650_0000289 | Ga0495650_0000289_52797_53858 | 347 |
| 295 | 3300046471 | Ga0495650_0002251 | Ga0495650_0002251_13737_14798 | 347 |
| 296 | 3300046471 | Ga0495650_0009697 | Ga0495650_0009697_1092_2153 | 347 |
| 297 | 3300046474 | Ga0495605_0001676 | Ga0495605_0001676_11119_12180 | 347 |
| 298 | 3300046491 | Ga0495584_0000179 | Ga0495584_0000179_35383_36444 | 347 |
| 299 | 3300046491 | Ga0495584_0001609 | Ga0495584_0001609_10168_11229 | 347 |
| 300 | 3300046492 | Ga0495585_0000587 | Ga0495585_0000587_23520_24581 | 347 |
| 301 | 3300046492 | Ga0495585_0060255 | Ga0495585_0060255_124_1185 | 347 |
| 302 | 3300046506 | Ga0495583_0000014 | Ga0495583_0000014_104879_105940 | 347 |
| 303 | 3300046506 | Ga0495583_0002530 | Ga0495583_0002530_13746_14807 | 347 |
| 304 | 3300046506 | Ga0495583_0023527 | Ga0495583_0023527_1076_2137 | 347 |
| 305 | 3300046512 | Ga0495610_0000008 | Ga0495610_0000008_581741_582802 | 347 |
| 306 | 3300046512 | Ga0495610_0001018 | Ga0495610_0001018_13477_14538 | 347 |
| 307 | 3300046513 | Ga0495616_0000982 | Ga0495616_0000982_12114_13175 | 347 |
| 308 | 3300046522 | Ga0495643_0000330 | Ga0495643_0000330_9926_10987 | 347 |
| 309 | 3300046523 | Ga0495644_0000087 | Ga0495644_0000087_28780_29841 | 347 |
| 310 | 3300046524 | Ga0495648_0000476 | Ga0495648_0000476_10756_11817 | 347 |
| 311 | 3300046524 | Ga0495648_0001508 | Ga0495648_0001508_3426_4487 | 347 |
| 312 | 3300046524 | Ga0495648_0035745 | Ga0495648_0035745_1009_2070 | 347 |
| 313 | 3300046528 | Ga0495642_0064906 | Ga0495642_0064906_170_1231 | 347 |
| 314 | 3300046530 | Ga0495654_0000058 | Ga0495654_0000058_107981_109042 | 347 |
| 315 | 3300046530 | Ga0495654_0002363 | Ga0495654_0002363_5801_6862 | 347 |
| 316 | 3300046538 | Ga0495609_0002371 | Ga0495609_0002371_2675_3736 | 347 |
| 317 | 3300046538 | Ga0495609_0005276 | Ga0495609_0005276_5617_6678 | 347 |
| 318 | 3300046538 | Ga0495609_0065665 | Ga0495609_0065665_499_1560 | 347 |
| 319 | 3300046542 | Ga0495597_0000996 | Ga0495597_0000996_8630_9691 | 347 |
| 320 | 3300046557 | Ga0495622_0000088 | Ga0495622_0000088_77061_78122 | 347 |
| 321 | 3300046557 | Ga0495622_0014560 | Ga0495622_0014560_2491_3552 | 347 |
| 322 | 3300046558 | Ga0495633_0000521 | Ga0495633_0000521_24939_26000 | 347 |
| 323 | 3300046558 | Ga0495633_0003990 | Ga0495633_0003990_1112_2173 | 347 |
| 324 | 3300046558 | Ga0495633_0005688 | Ga0495633_0005688_3688_4749 | 347 |
| 325 | 3300046558 | Ga0495633_0007567 | Ga0495633_0007567_4388_5449 | 347 |
| 326 | 3300046615 | Ga0495656_0034074 | Ga0495656_0034074_780_1841 | 347 |
| 327 | 3300046616 | Ga0495668_0000193 | Ga0495668_0000193_33330_34391 | 347 |
| 328 | 3300046616 | Ga0495668_0031449 | Ga0495668_0031449_747_1808 | 347 |
| 329 | 3300046664 | Ga0495659_0000041 | Ga0495659_0000041_44337_45398 | 347 |
| 330 | 3300046664 | Ga0495659_0000243 | Ga0495659_0000243_9329_10390 | 347 |
| 331 | 3300046664 | Ga0495659_0005877 | Ga0495659_0005877_1509_2570 | 347 |
| 332 | 3300046665 | Ga0495661_0014647 | Ga0495661_0014647_182_1243 | 347 |
| 333 | 3300046665 | Ga0495661_0015806 | Ga0495661_0015806_2395_3456 | 347 |
| 334 | 3300046684 | Ga0495669_0008396 | Ga0495669_0008396_2381_3442 | 347 |
| 335 | 3300046691 | Ga0495670_0000064 | Ga0495670_0000064_16880_17941 | 347 |
| 336 | 3300046692 | Ga0495671_0000002 | Ga0495671_0000002_1105124_1106185 | 347 |
| 337 | 3300046692 | Ga0495671_0000198 | Ga0495671_0000198_48491_49552 | 347 |
| 338 | 3300046692 | Ga0495671_0001101 | Ga0495671_0001101_5520_6581 | 347 |
| 339 | 3300046694 | Ga0495649_0000166 | Ga0495649_0000166_47354_48415 | 347 |
| 340 | 3300046810 | Ga0495660_0024680 | Ga0495660_0024680_232_1293 | 347 |
| 341 | 3300047318 | Ga0495636_0000067 | Ga0495636_0000067_34129_35190 | 347 |
| 342 | 3300047318 | Ga0495636_0000361 | Ga0495636_0000361_5107_6168 | 347 |
| 343 | 3300047320 | Ga0495672_0000918 | Ga0495672_0000918_19236_20297 | 347 |
| 344 | 3300047320 | Ga0495672_0001603 | Ga0495672_0001603_16980_18041 | 347 |
| 345 | 3300047320 | Ga0495672_0026249 | Ga0495672_0026249_2268_3329 | 347 |
| 346 | 3300047323 | Ga0495683_0014460 | Ga0495683_0014460_196_1257 | 347 |
| 347 | 3300047443 | Ga0495687_000566 | Ga0495687_000566_34251_35312 | 347 |
| 348 | 3300047443 | Ga0495687_000603 | Ga0495687_000603_30344_31405 | 347 |
| 349 | 3300047445 | Ga0495677_0000448 | Ga0495677_0000448_973_2034 | 347 |
| 350 | 3300047445 | Ga0495677_0001444 | Ga0495677_0001444_8361_9422 | 347 |
| 351 | 3300047446 | Ga0495679_000296 | Ga0495679_000296_30043_31104 | 347 |
| 352 | 3300047446 | Ga0495679_002037 | Ga0495679_002037_4156_5217 | 347 |
| 353 | 3300047447 | Ga0495685_000415 | Ga0495685_000415_10862_11923 | 347 |
| 354 | 3300047447 | Ga0495685_000442 | Ga0495685_000442_1547_2608 | 347 |
| 355 | 3300047469 | Ga0495673_0000061 | Ga0495673_0000061_156724_157791 | 347 |
| 356 | 3300047469 | Ga0495673_0000926 | Ga0495673_0000926_5409_6470 | 347 |
| 357 | 3300047469 | Ga0495673_0003599 | Ga0495673_0003599_3826_4887 | 347 |
| 358 | 3300047470 | Ga0495681_0006711 | Ga0495681_0006711_5271_6332 | 347 |
| 359 | 3300049459 | Ga0495678_000009 | Ga0495678_000009_100249_101310 | 347 |
| 360 | 3300049459 | Ga0495678_000215 | Ga0495678_000215_11797_12858 | 347 |
| 361 | 3300049459 | Ga0495678_000870 | Ga0495678_000870_21175_22236 | 347 |
| 362 | 3300049460 | Ga0495682_0005605 | Ga0495682_0005605_1479_2540 | 347 |
| 363 | 3300049515 | Ga0501292_005421 | Ga0501292_005421_247_1290 | 347 |
| 364 | 3300049759 | Ga0501262_001032 | Ga0501262_001032_1420_2463 | 347 |
| 365 | 3300050492 | nmdc:mga0yw44_142853_c1 | nmdc:mga0yw44_142853_c1_166_1209 | 347 |
| 366 | 3300050496 | nmdc:mga07m45_85267_c1 | nmdc:mga07m45_85267_c1_648_1691 | 347 |
| 367 | 3300053125 | Ga0500618_000173 | Ga0500618_000173_39179_40240 | 347 |
| 368 | 3300053145 | Ga0500586_000649 | Ga0500586_000649_1233_2294 | 347 |
| 369 | 3300053145 | Ga0500586_040450 | Ga0500586_040450_497_1558 | 347 |
| 370 | iso_pu_bacteria | 2939631187 | 2939634003 | 347 |
| 371 | 3300003322 | rootL2_10005895 | rootL2_100058954 | 348 |
| 372 | 3300003322 | rootL2_10055248 | rootL2_100552482 | 348 |
| 373 | 3300005328 | Ga0070676_10008441 | Ga0070676_100084414 | 348 |
| 374 | 3300005331 | Ga0070670_100043688 | Ga0070670_1000436883 | 348 |
| 375 | 3300005364 | Ga0070673_100186736 | Ga0070673_1001867362 | 348 |
| 376 | 3300005445 | Ga0070708_100000270 | Ga0070708_10000027011 | 348 |
| 377 | 3300005456 | Ga0070678_100152471 | Ga0070678_1001524712 | 348 |
| 378 | 3300005457 | Ga0070662_100160726 | Ga0070662_1001607262 | 348 |
| 379 | 3300005459 | Ga0068867_100000186 | Ga0068867_10000018630 | 348 |
| 380 | 3300005459 | Ga0068867_100054382 | Ga0068867_1000543823 | 348 |
| 381 | 3300005467 | Ga0070706_100017115 | Ga0070706_1000171155 | 348 |
| 382 | 3300005468 | Ga0070707_100079498 | Ga0070707_1000794982 | 348 |
| 383 | 3300005617 | Ga0068859_100399254 | Ga0068859_1003992541 | 348 |
| 384 | 3300005842 | Ga0068858_100088756 | Ga0068858_1000887563 | 348 |
| 385 | 3300005843 | Ga0068860_100144946 | Ga0068860_1001449462 | 348 |
| 386 | 3300005843 | Ga0068860_100161734 | Ga0068860_1001617342 | 348 |
| 387 | 3300006038 | Ga0075365_10051177 | Ga0075365_100511772 | 348 |
| 388 | 3300006042 | Ga0075368_10004920 | Ga0075368_100049204 | 348 |
| 389 | 3300006048 | Ga0075363_100053398 | Ga0075363_1000533982 | 348 |
| 390 | 3300006058 | Ga0075432_10037312 | Ga0075432_100373121 | 348 |
| 391 | 3300006177 | Ga0075362_10043390 | Ga0075362_100433902 | 348 |
| 392 | 3300006178 | Ga0075367_10055782 | Ga0075367_100557822 | 348 |
| 393 | 3300006186 | Ga0075369_10013266 | Ga0075369_100132663 | 348 |
| 394 | 3300006195 | Ga0075366_10007761 | Ga0075366_100077613 | 348 |
| 395 | 3300006195 | Ga0075366_10020137 | Ga0075366_100201372 | 348 |
| 396 | 3300006195 | Ga0075366_10040502 | Ga0075366_100405022 | 348 |
| 397 | 3300006195 | Ga0075366_10138912 | Ga0075366_101389122 | 348 |
| 398 | 3300006195 | Ga0075366_10242062 | Ga0075366_102420621 | 348 |
| 399 | 3300006353 | Ga0075370_10020573 | Ga0075370_100205733 | 348 |
| 400 | 3300006353 | Ga0075370_10031064 | Ga0075370_100310642 | 348 |
| 401 | 3300006931 | Ga0097620_100399228 | Ga0097620_1003992281 | 348 |
| 402 | 3300009148 | Ga0105243_10002791 | Ga0105243_100027914 | 348 |
| 403 | 3300009148 | Ga0105243_10015622 | Ga0105243_100156222 | 348 |
| 404 | 3300014326 | Ga0157380_10226271 | Ga0157380_102262712 | 348 |
| 405 | 3300014745 | Ga0157377_10000464 | Ga0157377_100004648 | 348 |
| 406 | 3300014968 | Ga0157379_10047386 | Ga0157379_100473864 | 348 |
| 407 | 3300025907 | Ga0207645_10008027 | Ga0207645_100080274 | 348 |
| 408 | 3300025910 | Ga0207684_10024199 | Ga0207684_100241992 | 348 |
| 409 | 3300025922 | Ga0207646_10015873 | Ga0207646_100158732 | 348 |
| 410 | 3300025933 | Ga0207706_10286884 | Ga0207706_102868842 | 348 |
| 411 | 3300025938 | Ga0207704_10011058 | Ga0207704_100110582 | 348 |
| 412 | 3300025940 | Ga0207691_10019676 | Ga0207691_100196763 | 348 |
| 413 | 3300025940 | Ga0207691_10059002 | Ga0207691_100590023 | 348 |
| 414 | 3300025942 | Ga0207689_10022127 | Ga0207689_100221273 | 348 |
| 415 | 3300025986 | Ga0207658_10032153 | Ga0207658_100321532 | 348 |
| 416 | 3300026023 | Ga0207677_10014829 | Ga0207677_100148292 | 348 |
| 417 | 3300026035 | Ga0207703_10099688 | Ga0207703_100996881 | 348 |
| 418 | 3300026041 | Ga0207639_10104539 | Ga0207639_101045392 | 348 |
| 419 | 3300026089 | Ga0207648_10000686 | Ga0207648_100006868 | 348 |
| 420 | 3300026089 | Ga0207648_10028615 | Ga0207648_100286153 | 348 |
| 421 | 3300026116 | Ga0207674_10252232 | Ga0207674_102522322 | 348 |
| 422 | 3300026121 | Ga0207683_10165802 | Ga0207683_101658021 | 348 |
| 423 | 3300028381 | Ga0268264_10089095 | Ga0268264_100890951 | 348 |
| 424 | 3300028381 | Ga0268264_10119155 | Ga0268264_101191552 | 348 |
| 425 | 3300028786 | Ga0307517_10000160 | Ga0307517_1000016049 | 348 |
| 426 | 3300028786 | Ga0307517_10000395 | Ga0307517_1000039564 | 348 |
| 427 | 3300028794 | Ga0307515_10000006 | Ga0307515_10000006466 | 348 |
| 428 | 3300028794 | Ga0307515_10000332 | Ga0307515_1000033228 | 348 |
| 429 | 3300028794 | Ga0307515_10000893 | Ga0307515_1000089319 | 348 |
| 430 | 3300028794 | Ga0307515_10007639 | Ga0307515_1000763914 | 348 |
| 431 | 3300028794 | Ga0307515_10012223 | Ga0307515_1001222314 | 348 |
| 432 | 3300028794 | Ga0307515_10014643 | Ga0307515_100146433 | 348 |
| 433 | 3300028794 | Ga0307515_10033807 | Ga0307515_100338073 | 348 |
| 434 | 3300030521 | Ga0307511_10013142 | Ga0307511_100131426 | 348 |
| 435 | 3300030522 | Ga0307512_10034891 | Ga0307512_100348913 | 348 |
| 436 | 3300030522 | Ga0307512_10095568 | Ga0307512_100955683 | 348 |
| 437 | 3300031456 | Ga0307513_10003528 | Ga0307513_100035287 | 348 |
| 438 | 3300031456 | Ga0307513_10020560 | Ga0307513_100205608 | 348 |
| 439 | 3300031456 | Ga0307513_10288299 | Ga0307513_102882992 | 348 |
| 440 | 3300031507 | Ga0307509_10000212 | Ga0307509_1000021240 | 348 |
| 441 | 3300031507 | Ga0307509_10000317 | Ga0307509_1000031717 | 348 |
| 442 | 3300031507 | Ga0307509_10001463 | Ga0307509_100014637 | 348 |
| 443 | 3300031507 | Ga0307509_10001515 | Ga0307509_1000151517 | 348 |
| 444 | 3300031507 | Ga0307509_10005816 | Ga0307509_1000581615 | 348 |
| 445 | 3300031507 | Ga0307509_10014784 | Ga0307509_100147842 | 348 |
| 446 | 3300031507 | Ga0307509_10133120 | Ga0307509_101331203 | 348 |
| 447 | 3300031507 | Ga0307509_10221396 | Ga0307509_102213962 | 348 |
| 448 | 3300031616 | Ga0307508_10000097 | Ga0307508_1000009742 | 348 |
| 449 | 3300031616 | Ga0307508_10000412 | Ga0307508_100004122 | 348 |
| 450 | 3300031616 | Ga0307508_10001697 | Ga0307508_1000169715 | 348 |
| 451 | 3300031616 | Ga0307508_10001791 | Ga0307508_100017913 | 348 |
| 452 | 3300031616 | Ga0307508_10006375 | Ga0307508_100063753 | 348 |
| 453 | 3300031616 | Ga0307508_10058425 | Ga0307508_100584253 | 348 |
| 454 | 3300031649 | Ga0307514_10001713 | Ga0307514_1000171313 | 348 |
| 455 | 3300031649 | Ga0307514_10033260 | Ga0307514_100332602 | 348 |
| 456 | 3300031649 | Ga0307514_10113059 | Ga0307514_101130592 | 348 |
| 457 | 3300031649 | Ga0307514_10134731 | Ga0307514_101347312 | 348 |
| 458 | 3300031649 | Ga0307514_10205485 | Ga0307514_102054851 | 348 |
| 459 | 3300031730 | Ga0307516_10004792 | Ga0307516_100047929 | 348 |
| 460 | 3300031730 | Ga0307516_10058559 | Ga0307516_100585592 | 348 |
| 461 | 3300031730 | Ga0307516_10115718 | Ga0307516_101157182 | 348 |
| 462 | 3300033179 | Ga0307507_10006339 | Ga0307507_1000633917 | 348 |
| 463 | 3300033179 | Ga0307507_10026906 | Ga0307507_100269064 | 348 |
| 464 | 3300033179 | Ga0307507_10096560 | Ga0307507_100965602 | 348 |
| 465 | 3300033180 | Ga0307510_10197873 | Ga0307510_101978732 | 348 |
| 466 | 3300035113 | Ga0373936_0007356 | Ga0373936_0007356_1245_2312 | 348 |
| 467 | 3300035113 | Ga0373936_0025043 | Ga0373936_0025043_503_1570 | 348 |
| 468 | 3300037068 | Ga0373925_0017662 | Ga0373925_0017662_933_1991 | 348 |
| 469 | 3300041410 | Ga0439461_0020413 | Ga0439461_0020413_151_1224 | 348 |
| 470 | 3300041997 | Ga0439431_0003980 | Ga0439431_0003980_906_1979 | 348 |
| 471 | 3300042134 | Ga0450898_002675 | Ga0450898_002675_799_1872 | 348 |
| 472 | 3300042532 | Ga0450893_0011593 | Ga0450893_0011593_108_1181 | 348 |
| 473 | 3300044658 | Ga0466972_0001573 | Ga0466972_0001573_4404_5480 | 348 |
| 474 | 3300044683 | Ga0466965_0008321 | Ga0466965_0008321_2111_3187 | 348 |
| 475 | 3300044706 | Ga0466964_0004540 | Ga0466964_0004540_2110_3186 | 348 |
| 476 | 3300044735 | Ga0466968_0000892 | Ga0466968_0000892_7863_8939 | 348 |
| 477 | 3300044842 | Ga0466957_0008010 | Ga0466957_0008010_1415_2491 | 348 |
| 478 | 3300046454 | Ga0495592_0000175 | Ga0495592_0000175_17604_18662 | 348 |
| 479 | 3300046455 | Ga0495603_0073101 | Ga0495603_0073101_289_1335 | 348 |
| 480 | 3300046457 | Ga0495590_0008483 | Ga0495590_0008483_2432_3493 | 348 |
| 481 | 3300046457 | Ga0495590_0009678 | Ga0495590_0009678_766_1818 | 348 |
| 482 | 3300046459 | Ga0495629_0203914 | Ga0495629_0203914_31_1077 | 348 |
| 483 | 3300046460 | Ga0495638_0084731 | Ga0495638_0084731_493_1551 | 348 |
| 484 | 3300046460 | Ga0495638_0166990 | Ga0495638_0166990_160_1227 | 348 |
| 485 | 3300046471 | Ga0495650_0000213 | Ga0495650_0000213_20505_21560 | 348 |
| 486 | 3300046474 | Ga0495605_0011586 | Ga0495605_0011586_1207_2262 | 348 |
| 487 | 3300046475 | Ga0495639_0102142 | Ga0495639_0102142_112_1158 | 348 |
| 488 | 3300046491 | Ga0495584_0012011 | Ga0495584_0012011_1011_2072 | 348 |
| 489 | 3300046492 | Ga0495585_0019845 | Ga0495585_0019845_616_1677 | 348 |
| 490 | 3300046500 | Ga0495596_0000029 | Ga0495596_0000029_26642_27703 | 348 |
| 491 | 3300046500 | Ga0495596_0000309 | Ga0495596_0000309_8428_9489 | 348 |
| 492 | 3300046500 | Ga0495596_0003951 | Ga0495596_0003951_3444_4499 | 348 |
| 493 | 3300046500 | Ga0495596_0006179 | Ga0495596_0006179_3134_4195 | 348 |
| 494 | 3300046500 | Ga0495596_0006338 | Ga0495596_0006338_3349_4410 | 348 |
| 495 | 3300046500 | Ga0495596_0010016 | Ga0495596_0010016_1050_2111 | 348 |
| 496 | 3300046500 | Ga0495596_0010603 | Ga0495596_0010603_1049_2110 | 348 |
| 497 | 3300046501 | Ga0495607_0135877 | Ga0495607_0135877_176_1237 | 348 |
| 498 | 3300046506 | Ga0495583_0003009 | Ga0495583_0003009_9537_10601 | 348 |
| 499 | 3300046506 | Ga0495583_0012173 | Ga0495583_0012173_858_2021 | 348 |
| 500 | 3300046506 | Ga0495583_0028223 | Ga0495583_0028223_41_1102 | 348 |
| 501 | 3300046507 | Ga0495606_0026449 | Ga0495606_0026449_1796_2845 | 348 |
| 502 | 3300046513 | Ga0495616_0000034 | Ga0495616_0000034_102343_103404 | 348 |
| 503 | 3300046513 | Ga0495616_0001531 | Ga0495616_0001531_13436_14497 | 348 |
| 504 | 3300046513 | Ga0495616_0002129 | Ga0495616_0002129_951_2024 | 348 |
| 505 | 3300046513 | Ga0495616_0005494 | Ga0495616_0005494_3268_4431 | 348 |
| 506 | 3300046513 | Ga0495616_0008342 | Ga0495616_0008342_3544_4605 | 348 |
| 507 | 3300046513 | Ga0495616_0021724 | Ga0495616_0021724_2030_3109 | 348 |
| 508 | 3300046518 | Ga0495631_0001648 | Ga0495631_0001648_11423_12496 | 348 |
| 509 | 3300046518 | Ga0495631_0004819 | Ga0495631_0004819_1238_2299 | 348 |
| 510 | 3300046519 | Ga0495632_0000033 | Ga0495632_0000033_92607_93668 | 348 |
| 511 | 3300046519 | Ga0495632_0000086 | Ga0495632_0000086_58800_59861 | 348 |
| 512 | 3300046519 | Ga0495632_0000321 | Ga0495632_0000321_30750_31829 | 348 |
| 513 | 3300046519 | Ga0495632_0001237 | Ga0495632_0001237_10753_11814 | 348 |
| 514 | 3300046519 | Ga0495632_0023864 | Ga0495632_0023864_270_1319 | 348 |
| 515 | 3300046520 | Ga0495637_0004655 | Ga0495637_0004655_1094_2155 | 348 |
| 516 | 3300046522 | Ga0495643_0006770 | Ga0495643_0006770_194_1261 | 348 |
| 517 | 3300046522 | Ga0495643_0018460 | Ga0495643_0018460_1511_2572 | 348 |
| 518 | 3300046522 | Ga0495643_0028483 | Ga0495643_0028483_610_1671 | 348 |
| 519 | 3300046522 | Ga0495643_0042087 | Ga0495643_0042087_1254_2312 | 348 |
| 520 | 3300046522 | Ga0495643_0086518 | Ga0495643_0086518_487_1557 | 348 |
| 521 | 3300046523 | Ga0495644_0000030 | Ga0495644_0000030_16196_17275 | 348 |
| 522 | 3300046523 | Ga0495644_0014120 | Ga0495644_0014120_1260_2333 | 348 |
| 523 | 3300046523 | Ga0495644_0048228 | Ga0495644_0048228_133_1179 | 348 |
| 524 | 3300046524 | Ga0495648_0000505 | Ga0495648_0000505_11863_12924 | 348 |
| 525 | 3300046524 | Ga0495648_0011019 | Ga0495648_0011019_3214_4275 | 348 |
| 526 | 3300046524 | Ga0495648_0013032 | Ga0495648_0013032_176_1237 | 348 |
| 527 | 3300046524 | Ga0495648_0027406 | Ga0495648_0027406_2722_3783 | 348 |
| 528 | 3300046524 | Ga0495648_0051698 | Ga0495648_0051698_42_1103 | 348 |
| 529 | 3300046524 | Ga0495648_0124921 | Ga0495648_0124921_144_1205 | 348 |
| 530 | 3300046528 | Ga0495642_0000246 | Ga0495642_0000246_28602_29663 | 348 |
| 531 | 3300046528 | Ga0495642_0000273 | Ga0495642_0000273_2443_3504 | 348 |
| 532 | 3300046530 | Ga0495654_0001164 | Ga0495654_0001164_9969_11030 | 348 |
| 533 | 3300046530 | Ga0495654_0019831 | Ga0495654_0019831_853_1914 | 348 |
| 534 | 3300046538 | Ga0495609_0000919 | Ga0495609_0000919_2213_3274 | 348 |
| 535 | 3300046538 | Ga0495609_0002275 | Ga0495609_0002275_10226_11287 | 348 |
| 536 | 3300046538 | Ga0495609_0037656 | Ga0495609_0037656_300_1463 | 348 |
| 537 | 3300046542 | Ga0495597_0000416 | Ga0495597_0000416_15075_16124 | 348 |
| 538 | 3300046542 | Ga0495597_0001025 | Ga0495597_0001025_11443_12504 | 348 |
| 539 | 3300046542 | Ga0495597_0015801 | Ga0495597_0015801_916_1977 | 348 |
| 540 | 3300046558 | Ga0495633_0020492 | Ga0495633_0020492_127_1173 | 348 |
| 541 | 3300046558 | Ga0495633_0028096 | Ga0495633_0028096_768_1838 | 348 |
| 542 | 3300046616 | Ga0495668_0000669 | Ga0495668_0000669_8726_9787 | 348 |
| 543 | 3300046616 | Ga0495668_0019657 | Ga0495668_0019657_2244_3305 | 348 |
| 544 | 3300046648 | Ga0495611_0000439 | Ga0495611_0000439_11355_12434 | 348 |
| 545 | 3300046660 | Ga0495625_0002865 | Ga0495625_0002865_1667_2716 | 348 |
| 546 | 3300046660 | Ga0495625_0010801 | Ga0495625_0010801_4746_5804 | 348 |
| 547 | 3300046660 | Ga0495625_0020433 | Ga0495625_0020433_3361_4440 | 348 |
| 548 | 3300046660 | Ga0495625_0067179 | Ga0495625_0067179_317_1366 | 348 |
| 549 | 3300046660 | Ga0495625_0084932 | Ga0495625_0084932_802_1863 | 348 |
| 550 | 3300046660 | Ga0495625_0105403 | Ga0495625_0105403_833_1894 | 348 |
| 551 | 3300046660 | Ga0495625_0138899 | Ga0495625_0138899_62_1123 | 348 |
| 552 | 3300046665 | Ga0495661_0000170 | Ga0495661_0000170_40544_41623 | 348 |
| 553 | 3300046665 | Ga0495661_0000843 | Ga0495661_0000843_15162_16223 | 348 |
| 554 | 3300046665 | Ga0495661_0001206 | Ga0495661_0001206_8792_9853 | 348 |
| 555 | 3300046665 | Ga0495661_0024792 | Ga0495661_0024792_2645_3706 | 348 |
| 556 | 3300046665 | Ga0495661_0029049 | Ga0495661_0029049_656_1717 | 348 |
| 557 | 3300046665 | Ga0495661_0074974 | Ga0495661_0074974_848_1927 | 348 |
| 558 | 3300046681 | Ga0495647_0000332 | Ga0495647_0000332_7071_8117 | 348 |
| 559 | 3300046683 | Ga0495658_0000659 | Ga0495658_0000659_17109_18155 | 348 |
| 560 | 3300046690 | Ga0495624_0038828 | Ga0495624_0038828_349_1509 | 348 |
| 561 | 3300046690 | Ga0495624_0039178 | Ga0495624_0039178_994_2040 | 348 |
| 562 | 3300046692 | Ga0495671_0000131 | Ga0495671_0000131_1360_2421 | 348 |
| 563 | 3300046692 | Ga0495671_0014286 | Ga0495671_0014286_988_2049 | 348 |
| 564 | 3300046694 | Ga0495649_0000303 | Ga0495649_0000303_21122_22183 | 348 |
| 565 | 3300046694 | Ga0495649_0111140 | Ga0495649_0111140_139_1212 | 348 |
| 566 | 3300046794 | Ga0495589_0024973 | Ga0495589_0024973_575_1636 | 348 |
| 567 | 3300046794 | Ga0495589_0030641 | Ga0495589_0030641_1643_2689 | 348 |
| 568 | 3300046810 | Ga0495660_0004863 | Ga0495660_0004863_6483_7565 | 348 |
| 569 | 3300046810 | Ga0495660_0053376 | Ga0495660_0053376_278_1327 | 348 |
| 570 | 3300046810 | Ga0495660_0087452 | Ga0495660_0087452_70_1149 | 348 |
| 571 | 3300047318 | Ga0495636_0014179 | Ga0495636_0014179_153_1316 | 348 |
| 572 | 3300047320 | Ga0495672_0000031 | Ga0495672_0000031_86775_87845 | 348 |
| 573 | 3300047320 | Ga0495672_0000685 | Ga0495672_0000685_12442_13503 | 348 |
| 574 | 3300047320 | Ga0495672_0005983 | Ga0495672_0005983_6209_7270 | 348 |
| 575 | 3300047322 | Ga0495680_0054184 | Ga0495680_0054184_674_1720 | 348 |
| 576 | 3300047322 | Ga0495680_0213911 | Ga0495680_0213911_90_1166 | 348 |
| 577 | 3300047323 | Ga0495683_0022503 | Ga0495683_0022503_1021_2082 | 348 |
| 578 | 3300047443 | Ga0495687_000002 | Ga0495687_000002_456750_457811 | 348 |
| 579 | 3300047445 | Ga0495677_0000512 | Ga0495677_0000512_3216_4295 | 348 |
| 580 | 3300047445 | Ga0495677_0003267 | Ga0495677_0003267_3845_4924 | 348 |
| 581 | 3300047446 | Ga0495679_005527 | Ga0495679_005527_3426_4487 | 348 |
| 582 | 3300047446 | Ga0495679_009576 | Ga0495679_009576_2407_3570 | 348 |
| 583 | 3300047446 | Ga0495679_026550 | Ga0495679_026550_544_1605 | 348 |
| 584 | 3300047447 | Ga0495685_002949 | Ga0495685_002949_3876_4937 | 348 |
| 585 | 3300047470 | Ga0495681_0000016 | Ga0495681_0000016_66165_67226 | 348 |
| 586 | 3300047470 | Ga0495681_0020116 | Ga0495681_0020116_2175_3221 | 348 |
| 587 | 3300047470 | Ga0495681_0045609 | Ga0495681_0045609_317_1378 | 348 |
| 588 | 3300047472 | Ga0495686_0000464 | Ga0495686_0000464_41114_42175 | 348 |
| 589 | 3300047472 | Ga0495686_0078668 | Ga0495686_0078668_545_1591 | 348 |
| 590 | 3300048091 | Ga0495626_0004000 | Ga0495626_0004000_6951_8012 | 348 |
| 591 | 3300048091 | Ga0495626_0007408 | Ga0495626_0007408_4953_6014 | 348 |
| 592 | 3300048091 | Ga0495626_0022599 | Ga0495626_0022599_507_1568 | 348 |
| 593 | 3300048091 | Ga0495626_0048228 | Ga0495626_0048228_878_1939 | 348 |
| 594 | 3300049459 | Ga0495678_000035 | Ga0495678_000035_24645_25706 | 348 |
| 595 | 3300049459 | Ga0495678_013147 | Ga0495678_013147_1927_3000 | 348 |
| 596 | 3300049460 | Ga0495682_0001155 | Ga0495682_0001155_12959_14020 | 348 |
| 597 | 3300049460 | Ga0495682_0002609 | Ga0495682_0002609_4593_5666 | 348 |
| 598 | 3300049579 | Ga0501043_0010569 | Ga0501043_0010569_3811_4938 | 348 |
| 599 | 3300049580 | Ga0501046_0012537 | Ga0501046_0012537_3810_4937 | 348 |
| 600 | 3300049581 | Ga0501047_0015658 | Ga0501047_0015658_2289_3416 | 348 |
| 601 | 3300049824 | Ga0501045_0049558 | Ga0501045_0049558_1851_2978 | 348 |
| 602 | 3300050490 | nmdc:mga03n38_5431_c1 | nmdc:mga03n38_5431_c1_274_1320 | 348 |
| 603 | 3300050491 | nmdc:mga00v17_67048_c1 | nmdc:mga00v17_67048_c1_988_2034 | 348 |
| 604 | 3300050492 | nmdc:mga0yw44_31056_c1 | nmdc:mga0yw44_31056_c1_1559_2605 | 348 |
| 605 | 3300050493 | nmdc:mga0k408_13676_c1 | nmdc:mga0k408_13676_c1_671_1717 | 348 |
| 606 | 3300050493 | nmdc:mga0k408_1832_c1 | nmdc:mga0k408_1832_c1_9213_10295 | 348 |
| 607 | 3300050493 | nmdc:mga0k408_18764_c1 | nmdc:mga0k408_18764_c1_726_1772 | 348 |
| 608 | 3300050493 | nmdc:mga0k408_3006_c2 | nmdc:mga0k408_3006_c2_5570_6616 | 348 |
| 609 | 3300050493 | nmdc:mga0k408_3937_c1 | nmdc:mga0k408_3937_c1_1354_2412 | 348 |
| 610 | 3300050493 | nmdc:mga0k408_57762_c1 | nmdc:mga0k408_57762_c1_1182_2231 | 348 |
| 611 | 3300050496 | nmdc:mga07m45_127_c1 | nmdc:mga07m45_127_c1_13741_14787 | 348 |
| 612 | 3300050509 | nmdc:mga0qj67_109220_c1 | nmdc:mga0qj67_109220_c1_872_1945 | 348 |
| 613 | 3300050516 | nmdc:mga0sz30_43269_c1 | nmdc:mga0sz30_43269_c1_189_1235 | 348 |
| 614 | 3300050516 | nmdc:mga0sz30_71771_c1 | nmdc:mga0sz30_71771_c1_330_1376 | 348 |
| 615 | 3300053088 | Ga0500644_0010789 | Ga0500644_0010789_983_2041 | 348 |
| 616 | 3300053088 | Ga0500644_0093379 | Ga0500644_0093379_46_1104 | 348 |
| 617 | 3300053091 | Ga0500647_0128669 | Ga0500647_0128669_47_1105 | 348 |
| 618 | 3300053092 | Ga0500583_0032769 | Ga0500583_0032769_169_1218 | 348 |
| 619 | 3300053118 | Ga0500594_0015641 | Ga0500594_0015641_141_1199 | 348 |
| 620 | 3300053136 | Ga0500559_0005150 | Ga0500559_0005150_1731_2789 | 348 |
| 621 | 3300053154 | Ga0500619_009851 | Ga0500619_009851_730_1788 | 348 |
| 622 | 3300053156 | Ga0500622_0008524 | Ga0500622_0008524_3483_4541 | 348 |
| 623 | 3300053163 | Ga0500639_008998 | Ga0500639_008998_2828_3895 | 348 |
| 624 | 3300053739 | Ga0500587_005663 | Ga0500587_005663_577_1635 | 348 |
| 625 | 3300002704 | JGI25155J39150_1000062 | JGI25155J39150_100006256 | 349 |
| 626 | 3300002705 | JGI25156J39149_1000012 | JGI25156J39149_1000012160 | 349 |
| 627 | 3300002738 | JGI25154J39366_1000029 | JGI25154J39366_100002911 | 349 |
| 628 | 3300002741 | JGI25157J39369_1000014 | JGI25157J39369_1000014160 | 349 |
| 629 | 3300002774 | JGI25150J39212_1006746 | JGI25150J39212_10067463 | 349 |
| 630 | 3300002987 | JGI25159J45721_1000054 | JGI25159J45721_100005437 | 349 |
| 631 | 3300003187 | JGI25151J46595_10004424 | JGI25151J46595_100044247 | 349 |
| 632 | 3300003354 | JGI25160J50197_1000088 | JGI25160J50197_100008860 | 349 |
| 633 | 3300003354 | JGI25160J50197_1000119 | JGI25160J50197_100011937 | 349 |
| 634 | 3300003374 | JGI25161J50226_1000056 | JGI25161J50226_100005637 | 349 |
| 635 | 3300004625 | Ga0055543_1001077 | Ga0055543_10010772 | 349 |
| 636 | 3300006051 | Ga0075364_10077336 | Ga0075364_100773363 | 349 |
| 637 | 3300025206 | Ga0209435_100002 | Ga0209435_100002563 | 349 |
| 638 | 3300025208 | Ga0209436_104201 | Ga0209436_1042012 | 349 |
| 639 | 3300025245 | Ga0207425_1009598 | Ga0207425_10095982 | 349 |
| 640 | 3300025246 | Ga0209646_1000001 | Ga0209646_10000012706 | 349 |
| 641 | 3300025250 | Ga0209026_1000040 | Ga0209026_100004069 | 349 |
| 642 | 3300025256 | Ga0209759_1000001 | Ga0209759_10000012337 | 349 |
| 643 | 3300025258 | Ga0209129_1014229 | Ga0209129_10142292 | 349 |
| 644 | 3300025263 | Ga0209565_1000876 | Ga0209565_100087615 | 349 |
| 645 | 3300025284 | Ga0209130_1000040 | Ga0209130_100004060 | 349 |
| 646 | 3300025291 | Ga0209675_1000471 | Ga0209675_100047118 | 349 |
| 647 | 3300025294 | Ga0209025_1009312 | Ga0209025_10093127 | 349 |
| 648 | 3300025297 | Ga0209758_1005216 | Ga0209758_10052164 | 349 |
| 649 | 3300025298 | Ga0209050_1001577 | Ga0209050_100157712 | 349 |
| 650 | 3300025302 | Ga0207426_1000188 | Ga0207426_100018860 | 349 |
| 651 | 3300053117 | Ga0500593_000057 | Ga0500593_000057_38286_39335 | 349 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2d40-assembly1.cif.gz_D | crystal structure of z3393 from escherichia coli o157:h7 | 0.9754 | 38 | 349 |
| 2d40-assembly1.cif.gz_D | crystal structure of z3393 from escherichia coli o157:h7 | 0.9721 | 38 | 349 |
| 2d40-assembly1.cif.gz_B | crystal structure of z3393 from escherichia coli o157:h7 | 0.9713 | 41 | 348 |
| 2d40-assembly1.cif.gz_A | crystal structure of z3393 from escherichia coli o157:h7 | 0.9706 | 40 | 349 |
| 2d40-assembly1.cif.gz_B | crystal structure of z3393 from escherichia coli o157:h7 | 0.9679 | 41 | 348 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2d40B00 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.9666 | 41 | 348 | 2.60.120.10 |
| 2d40B00 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.9632 | 41 | 348 | 2.60.120.10 |
| af_Q54FG7_190_474_2.60.120.650 | Mainly Beta;Sandwich;Jelly Rolls;Cupin | 0.949 | 263 | 333 | 2.60.120.650 |
| 3fjsA00 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.9481 | 262 | 333 | 2.60.120.10 |
| 3bu7B00 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.9412 | 13 | 347 | 2.60.120.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3S4IJ63-F1-model_v4 | Gentisate 1,2-dioxygenase (EC 1.13.11.4) | 0.9958 | 238 | 349 |
GO:0047922
|
| AF-A0A251WNB4-F1-model_v4 | deleted | 0.9954 | 229 | 349 |
|
| AF-A0A1F2T3U1-F1-model_v4 | Gentisate 1,2-dioxygenase | 0.9932 | 227 | 347 |
GO:0051213
|
| AF-A0A3B9ITW2-F1-model_v4 | Gentisate 1,2-dioxygenase | 0.993 | 258 | 349 |
GO:0051213
|
| AF-A0A0K2RFM2-F1-model_v4 | Cupin type-2 domain-containing protein | 0.993 | 248 | 348 |
GO:0051213
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar