F472622

General Info

Members Datasets Scaffolds Average Seq Length
651 313 625 349

Family's Representative Sequence

Representative Sequence 3300046506|Ga0495583_0012173|Ga0495583_0012173_858_2021
Length 387
Sequence VPRQRSIPPHHIDADASSESGINPEEKEMSLQAGQAPSAQEGAKDSAKEQRTEFYRRISGHHLTPLWEVLGALVPRTPASPVAPALWRYAEVREHVMEAGRLISAEEAERRVLVLENPALRGNSSITQSLYAGLQLILPGEVARAHRHTQSALRLVLDGEGAYTAVDGERTTMRRGDFIITPSWTWHDHGNLGDEPVVWLDGLDIPTVRFFDAGFAEHANQASQPMARPEGDALARYGRNMLPVELGQQAASDPAKLFVYPYAETRQALESIALTAPDPHFGHKLRYVNPATGASPMPTIGAFAQLLPAGFASKPYRSTDGTVYVCLEGEGSAEIGGETFAFGPNDIFVVPSWHVLRLRASATTVLFSFSDRPMQQALGLWREEKMQ

Samples

Sample ID Description Type Environment
1 2511231002 Polaromonas sp. CF318 Isolate Rhizosphere
2 2547132374 Acidovorax radicis N35 Isolate Unclassified
3 2551306416 Herbaspirillum seropedicae Os34 Isolate Unclassified
4 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
5 2643221609 Acidovorax sp. Root217 Isolate Unclassified
6 2643221611 Acidovorax sp. Root219 Isolate Unclassified
7 2643221717 Acidovorax sp. Root267 Isolate Unclassified
8 2738541280 Massilia sp. GV090 Isolate Unclassified
9 2738541297 Duganella sp. GV083 Isolate Unclassified
10 2738541300 Massilia sp. GV016 Isolate Unclassified
11 2738541357 Duganella sp. GV053 Isolate Unclassified
12 2738543003 Duganella sp. GV066 Isolate Unclassified
13 2738543012 Acidovorax sp. CF301 Isolate Unclassified
14 2738543018 Massilia sp. GV045 Isolate Unclassified
15 2738543026 Duganella sp. GV089 Isolate Unclassified
16 2738543029 Duganella sp. GV039 Isolate Unclassified
17 2738543030 Massilia sp. GV097 Isolate Unclassified
18 2816332133 Acidovorax radicis 2721A Isolate Unclassified
19 2818991445 Herbaspirillum hiltneri 3195 Isolate Unclassified
20 2842711865 Duganella sp. R-73148 Isolate Unclassified
21 2904530477 Herbaspirillum huttiense 611 Isolate Unclassified
22 2919046199 Herbaspirillum frisingense 596 Isolate Unclassified
23 2919704043 Hydrogenophaga palleronii 4249 Isolate Unclassified
24 2923510766 Herbaspirillum rubrisubalbicans SLBN-127 Isolate Rhizosphere
25 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
26 2939631187 Ottowia thiooxydans 2709 Isolate Rhizosphere
27 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
28 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
29 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
30 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
31 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
32 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
33 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
34 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
35 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
36 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
37 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
38 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
39 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
40 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
41 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
42 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
43 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
44 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
45 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
46 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
47 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
48 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
49 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
50 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
51 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
52 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
53 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
54 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
55 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
56 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
57 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
58 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
59 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
60 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
61 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
62 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
63 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
64 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
65 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
66 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
67 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
68 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
69 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
70 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
71 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
72 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
73 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
74 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
75 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
76 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
77 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
78 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
79 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
80 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
81 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
82 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
83 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
84 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
85 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
86 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
87 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
88 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
89 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
90 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
91 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
92 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
93 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
94 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
95 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
96 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
97 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
98 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
99 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
100 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
101 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
102 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
103 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
104 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
105 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
106 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
107 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
108 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
109 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
110 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
111 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
112 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
113 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
114 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
115 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
116 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
117 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
118 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
119 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
120 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
121 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
122 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
123 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
124 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
125 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
126 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
127 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
128 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
129 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
130 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
131 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
132 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
133 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
134 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
135 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
136 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
137 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
138 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
169 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
170 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
171 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
172 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
173 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
174 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
175 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
176 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
177 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
178 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
179 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
180 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
181 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
182 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
183 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
184 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
185 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
186 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
187 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
188 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
189 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
190 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
191 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
192 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
193 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
194 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
195 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
196 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
197 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
198 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
199 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
200 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
201 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
202 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
203 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
204 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
205 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
206 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
207 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
208 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
209 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
210 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
211 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
212 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
213 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
214 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
215 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
216 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
217 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
218 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
219 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
220 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
221 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
222 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
223 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
224 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
225 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
226 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
227 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
228 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
229 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
230 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
231 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
232 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
233 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
234 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
235 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
236 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
237 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
238 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
239 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
240 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
241 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
242 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
243 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
244 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
245 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
246 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
247 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
248 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
249 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
250 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
251 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
252 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
253 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
254 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
255 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
256 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
257 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
258 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
259 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
260 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
261 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
262 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
263 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
264 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
265 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
266 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
267 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
268 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
269 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
270 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
271 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
272 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
273 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
274 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
275 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
276 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
277 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
278 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
279 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
280 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
281 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
282 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
283 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
284 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
285 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
286 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
287 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
288 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
289 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
290 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
291 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
292 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
293 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
294 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
295 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
296 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
297 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
298 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
299 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
300 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
301 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
302 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
303 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
304 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
305 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
306 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
307 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
308 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
309 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
310 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
311 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
312 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
313 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.01
Metatranscriptomes 0
Isolates 3.99

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 15.51
Nodule 0
Rhizoplane 1.08
Rhizosphere 68.66
Stem 0
Stem Tuber 0
Unclassified 14.75

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25155J39150_1000062 3300002704 Bacteria 70719
2 JGI25155J39150_1000302 3300002704 Bacteria 16773
3 JGI25155J39150_1000941 3300002704 Bacteria 3669
4 JGI25156J39149_1000012 3300002705 Bacteria 194393
5 JGI25156J39149_1000039 3300002705 Bacteria 107108
6 JGI25156J39149_1002181 3300002705 Bacteria 7333
7 JGI25162J39368_1004881 3300002737 Bacteria 2879
8 JGI25154J39366_1000029 3300002738 Bacteria 194393
9 JGI25154J39366_1000059 3300002738 Bacteria 107114
10 JGI25154J39366_1000278 3300002738 Bacteria 31200
11 JGI25154J39366_1000497 3300002738 Bacteria 20176
12 JGI25157J39369_1000014 3300002741 Bacteria 194393
13 JGI25157J39369_1000057 3300002741 Bacteria 107108
14 JGI25150J39212_1006746 3300002774 Bacteria 2346
15 JGI25159J45721_1000054 3300002987 Bacteria 56576
16 JGI25159J45721_1001495 3300002987 Bacteria 9583
17 JGI25151J46595_10004424 3300003187 Bacteria 7439
18 JGI25151J46595_10006031 3300003187 Bacteria 6171
19 JGI25151J46595_10006574 3300003187 Bacteria 5823
20 rootH2_10099521 3300003320 Bacteria 1632
21 rootL2_10005895 3300003322 Bacteria 4335
22 rootL2_10055248 3300003322 Bacteria 2866
23 rootL2_10293613 3300003322 Bacteria 1701
24 JGI25160J50197_1000088 3300003354 Bacteria 93050
25 JGI25160J50197_1000119 3300003354 Bacteria 71366
26 JGI25161J50226_1000056 3300003374 Bacteria 103097
27 Ga0055532_1000018 3300003758 Bacteria 305466
28 Ga0055535_1007095 3300003761 Bacteria 2180
29 Ga0055537_1000047 3300003773 Bacteria 88000
30 Ga0055524_1000039 3300003775 Bacteria 159897
31 Ga0055534_1000141 3300003784 Bacteria 53818
32 Ga0055530_10000532 3300003791 Bacteria 33030
33 Ga0055540_1000047 3300003792 Bacteria 146914
34 Ga0055531_10011051 3300003794 Bacteria 4407
35 Ga0055543_1001077 3300004625 Bacteria 11969
36 Ga0065165_1005321 3300005262 Bacteria 7314
37 Ga0070658_10132634 3300005327 Bacteria 2076
38 Ga0070676_10008441 3300005328 Bacteria 5555
39 Ga0070676_10010954 3300005328 Bacteria 4927
40 Ga0070683_100112346 3300005329 Bacteria 2571
41 Ga0070690_100010785 3300005330 Bacteria 5329
42 Ga0070670_100043688 3300005331 Bacteria 3852
43 Ga0068869_100007924 3300005334 Bacteria 6823
44 Ga0070680_100188942 3300005336 Bacteria 1735
45 Ga0068868_100076352 3300005338 Bacteria 2679
46 Ga0070689_100006491 3300005340 Bacteria 8102
47 Ga0070689_100082346 3300005340 Bacteria 2528
48 Ga0070674_100380950 3300005356 Bacteria 1148
49 Ga0070673_100159833 3300005364 Bacteria 1915
50 Ga0070673_100186736 3300005364 Bacteria 1778
51 Ga0070701_10000403 3300005438 Bacteria 14602
52 Ga0070700_100002730 3300005441 Bacteria 9025
53 Ga0070708_100000270 3300005445 Bacteria 38550
54 Ga0070678_100004661 3300005456 Bacteria 7800
55 Ga0070678_100042691 3300005456 Bacteria 3225
56 Ga0070678_100152471 3300005456 Bacteria 1863
57 Ga0070662_100160726 3300005457 Bacteria 1757
58 Ga0068867_100000186 3300005459 Bacteria 41001
59 Ga0068867_100007948 3300005459 Bacteria 7492
60 Ga0068867_100054382 3300005459 Bacteria 2958
61 Ga0068867_100103519 3300005459 Bacteria 2177
62 Ga0070706_100017115 3300005467 Bacteria 6699
63 Ga0070707_100079498 3300005468 Bacteria 3165
64 Ga0070684_100074345 3300005535 Bacteria 2995
65 Ga0068853_100027653 3300005539 Bacteria 4766
66 Ga0070686_100001963 3300005544 Bacteria 11420
67 Ga0070695_100099432 3300005545 Bacteria 1957
68 Ga0070695_100153193 3300005545 Bacteria 1611
69 Ga0070693_100007222 3300005547 Bacteria 5422
70 Ga0070704_100269721 3300005549 Bacteria 1406
71 Ga0068855_100000028 3300005563 Bacteria 171801
72 Ga0068855_100001569 3300005563 Bacteria 28685
73 Ga0070664_100000426 3300005564 Bacteria 31532
74 Ga0068857_100159869 3300005577 Bacteria 2044
75 Ga0068854_100007377 3300005578 Bacteria 7028
76 Ga0068856_100000978 3300005614 Bacteria 30484
77 Ga0068852_100006894 3300005616 Bacteria 8258
78 Ga0068859_100011217 3300005617 Bacteria 9012
79 Ga0068859_100399254 3300005617 Bacteria 1471
80 Ga0068866_10002351 3300005718 Bacteria 7841
81 Ga0068861_100007675 3300005719 Bacteria 7404
82 Ga0068870_10021148 3300005840 Bacteria 3179
83 Ga0068858_100004891 3300005842 Bacteria 13137
84 Ga0068858_100088756 3300005842 Bacteria 2877
85 Ga0068860_100078082 3300005843 Bacteria 3149
86 Ga0068860_100144946 3300005843 Bacteria 2285
87 Ga0068860_100161734 3300005843 Bacteria 2159
88 Ga0068860_100219142 3300005843 Bacteria 1848
89 Ga0075365_10051177 3300006038 Bacteria 2727
90 Ga0075368_10004920 3300006042 Bacteria 4556
91 Ga0075363_100053398 3300006048 Bacteria 2159
92 Ga0075364_10077336 3300006051 Bacteria 2197
93 Ga0075432_10037312 3300006058 Bacteria 1691
94 Ga0070712_100085822 3300006175 Bacteria 2293
95 Ga0075362_10009785 3300006177 Bacteria 3720
96 Ga0075362_10043390 3300006177 Bacteria 1991
97 Ga0075367_10055782 3300006178 Bacteria 2346
98 Ga0075369_10013266 3300006186 Bacteria 3268
99 Ga0075366_10007761 3300006195 Bacteria 5940
100 Ga0075366_10014644 3300006195 Bacteria 4482
101 Ga0075366_10020137 3300006195 Bacteria 3867
102 Ga0075366_10040502 3300006195 Bacteria 2756
103 Ga0075366_10138912 3300006195 Bacteria 1468
104 Ga0075366_10242062 3300006195 Bacteria 1100
105 Ga0097621_100038338 3300006237 Bacteria 3845
106 Ga0075370_10020573 3300006353 Bacteria 3609
107 Ga0075370_10031064 3300006353 Bacteria 2981
108 Ga0068871_100006001 3300006358 Bacteria 8552
109 Ga0068871_100168570 3300006358 Bacteria 1876
110 Ga0068865_100002680 3300006881 Bacteria 10558
111 Ga0097620_100011217 3300006931 Bacteria 9012
112 Ga0097620_100399228 3300006931 Bacteria 1471
113 Ga0105245_10021546 3300009098 Bacteria 5655
114 Ga0105243_10002791 3300009148 Bacteria 14509
115 Ga0105243_10015622 3300009148 Bacteria 5739
116 Ga0105243_10022655 3300009148 Bacteria 4776
117 Ga0105243_10264203 3300009148 Bacteria 1542
118 Ga0105242_10002015 3300009176 Bacteria 15991
119 Ga0105248_10204078 3300009177 Bacteria 2227
120 Ga0105248_10283602 3300009177 Bacteria 1865
121 Ga0105237_10126559 3300009545 Bacteria 2549
122 Ga0157371_10000422 3300013102 Bacteria 52177
123 Ga0157378_10026828 3300013297 Bacteria 5079
124 Ga0157372_10201843 3300013307 Bacteria 2303
125 Ga0157375_10182308 3300013308 Bacteria 2252
126 Ga0157380_10036152 3300014326 Bacteria 3820
127 Ga0157380_10111063 3300014326 Bacteria 2304
128 Ga0157380_10226271 3300014326 Bacteria 1677
129 Ga0182008_10005147 3300014497 Bacteria 7502
130 Ga0157377_10000464 3300014745 Bacteria 17471
131 Ga0157379_10047386 3300014968 Bacteria 3835
132 Ga0157379_10160163 3300014968 Bacteria 2031
133 Ga0209435_100002 3300025206 Bacteria 794178
134 Ga0209435_100007 3300025206 Bacteria 516857
135 Ga0209436_104201 3300025208 Bacteria 3609
136 Ga0209147_100017 3300025229 Bacteria 516857
137 Ga0209437_100272 3300025233 Bacteria 77336
138 Ga0209258_100297 3300025242 Bacteria 81353
139 Ga0207425_1001011 3300025245 Bacteria 13170
140 Ga0207425_1008751 3300025245 Bacteria 2564
141 Ga0207425_1009598 3300025245 Bacteria 2398
142 Ga0209646_1000001 3300025246 Bacteria 3092932
143 Ga0209646_1000023 3300025246 Bacteria 441100
144 Ga0209646_1000061 3300025246 Bacteria 255495
145 Ga0209646_1000096 3300025246 Bacteria 182388
146 Ga0209026_1000040 3300025250 Bacteria 277470
147 Ga0209026_1000052 3300025250 Bacteria 248897
148 Ga0209759_1000001 3300025256 Bacteria 2799452
149 Ga0209759_1000174 3300025256 Bacteria 107149
150 Ga0209759_1000209 3300025256 Bacteria 90642
151 Ga0209129_1014229 3300025258 Bacteria 1705
152 Ga0209565_1000080 3300025263 Bacteria 156999
153 Ga0209565_1000876 3300025263 Bacteria 16569
154 Ga0209455_1019008 3300025272 Bacteria 1397
155 Ga0209673_1000088 3300025273 Bacteria 204629
156 Ga0209130_1000040 3300025284 Bacteria 262926
157 Ga0209130_1000346 3300025284 Bacteria 53329
158 Ga0209675_1000133 3300025291 Bacteria 101207
159 Ga0209675_1000471 3300025291 Bacteria 30899
160 Ga0209675_1024886 3300025291 Bacteria 1520
161 Ga0209676_1000073 3300025292 Bacteria 305947
162 Ga0209676_1002444 3300025292 Bacteria 13185
163 Ga0209025_1003514 3300025294 Bacteria 14717
164 Ga0209025_1004730 3300025294 Bacteria 11596
165 Ga0209025_1006776 3300025294 Bacteria 8785
166 Ga0209025_1009312 3300025294 Bacteria 6873
167 Ga0209025_1009596 3300025294 Bacteria 6715
168 Ga0209564_1000313 3300025295 Bacteria 95224
169 Ga0209564_1000823 3300025295 Bacteria 42196
170 Ga0209564_1005212 3300025295 Bacteria 7521
171 Ga0209758_1000679 3300025297 Bacteria 50729
172 Ga0209758_1005216 3300025297 Bacteria 10191
173 Ga0209050_1000008 3300025298 Bacteria 1144179
174 Ga0209050_1001577 3300025298 Bacteria 23647
175 Ga0209256_1000096 3300025299 Bacteria 204629
176 Ga0207426_1000188 3300025302 Bacteria 153510
177 Ga0207426_1001354 3300025302 Bacteria 20775
178 Ga0209051_1000005 3300025303 Bacteria 1142353
179 Ga0209257_1000031 3300025304 Bacteria 688770
180 Ga0209257_1002902 3300025304 Bacteria 15869
181 Ga0207642_10022558 3300025899 Bacteria 2499
182 Ga0207699_10073140 3300025906 Bacteria 2102
183 Ga0207645_10008027 3300025907 Bacteria 7404
184 Ga0207645_10010581 3300025907 Bacteria 6330
185 Ga0207645_10162183 3300025907 Bacteria 1463
186 Ga0207705_10057039 3300025909 Bacteria 2817
187 Ga0207684_10024199 3300025910 Bacteria 5178
188 Ga0207671_10082937 3300025914 Bacteria 2406
189 Ga0207646_10015873 3300025922 Bacteria 7087
190 Ga0207706_10286884 3300025933 Bacteria 1435
191 Ga0207686_10003923 3300025934 Bacteria 7978
192 Ga0207709_10143820 3300025935 Bacteria 1643
193 Ga0207670_10011083 3300025936 Bacteria 5219
194 Ga0207704_10011058 3300025938 Bacteria 4429
195 Ga0207704_10067551 3300025938 Bacteria 2250
196 Ga0207691_10019676 3300025940 Bacteria 6386
197 Ga0207691_10059002 3300025940 Bacteria 3490
198 Ga0207689_10002140 3300025942 Bacteria 18578
199 Ga0207689_10022127 3300025942 Bacteria 5346
200 Ga0207661_10051048 3300025944 Bacteria 3299
201 Ga0207679_10002864 3300025945 Bacteria 10697
202 Ga0207679_10013747 3300025945 Bacteria 5308
203 Ga0207667_10009133 3300025949 Bacteria 11710
204 Ga0207667_10252379 3300025949 Bacteria 1805
205 Ga0207651_10129602 3300025960 Bacteria 1928
206 Ga0207658_10032153 3300025986 Bacteria 3731
207 Ga0207677_10014829 3300026023 Bacteria 4564
208 Ga0207677_10030771 3300026023 Bacteria 3431
209 Ga0207703_10099688 3300026035 Bacteria 2459
210 Ga0207639_10104539 3300026041 Bacteria 2296
211 Ga0207708_10000219 3300026075 Bacteria 45553
212 Ga0207648_10000534 3300026089 Bacteria 42312
213 Ga0207648_10000686 3300026089 Bacteria 37954
214 Ga0207648_10028615 3300026089 Bacteria 4940
215 Ga0207648_10036621 3300026089 Bacteria 4322
216 Ga0207674_10252232 3300026116 Bacteria 1712
217 Ga0207675_100000531 3300026118 Bacteria 37047
218 Ga0207683_10009791 3300026121 Bacteria 8172
219 Ga0207683_10165802 3300026121 Bacteria 1999
220 Ga0207698_10152124 3300026142 Bacteria 2010
221 Ga0209588_1016549 3300027671 Bacteria 2277
222 Ga0268264_10089095 3300028381 Bacteria 2656
223 Ga0268264_10119155 3300028381 Bacteria 2324
224 Ga0268264_10151399 3300028381 Bacteria 2080
225 Ga0307517_10000160 3300028786 Bacteria 108370
226 Ga0307517_10000395 3300028786 Bacteria 74663
227 Ga0307515_10000006 3300028794 Bacteria 725810
228 Ga0307515_10000332 3300028794 Bacteria 116126
229 Ga0307515_10000893 3300028794 Bacteria 68669
230 Ga0307515_10007639 3300028794 Bacteria 21327
231 Ga0307515_10012223 3300028794 Bacteria 16171
232 Ga0307515_10014643 3300028794 Bacteria 14520
233 Ga0307515_10033807 3300028794 Bacteria 8403
234 Ga0307515_10097942 3300028794 Bacteria 3577
235 Ga0307511_10013142 3300030521 Bacteria 8095
236 Ga0307512_10034891 3300030522 Bacteria 4297
237 Ga0307512_10095568 3300030522 Bacteria 2044
238 Ga0307513_10003528 3300031456 Bacteria 21162
239 Ga0307513_10020560 3300031456 Bacteria 7826
240 Ga0307513_10288299 3300031456 Bacteria 1415
241 Ga0307509_10000212 3300031507 Bacteria 92922
242 Ga0307509_10000317 3300031507 Bacteria 79032
243 Ga0307509_10001463 3300031507 Bacteria 39971
244 Ga0307509_10001515 3300031507 Bacteria 39177
245 Ga0307509_10005816 3300031507 Bacteria 16916
246 Ga0307509_10014784 3300031507 Bacteria 9150
247 Ga0307509_10133120 3300031507 Bacteria 2437
248 Ga0307509_10221396 3300031507 Bacteria 1705
249 Ga0307408_100000196 3300031548 Bacteria 65663
250 Ga0307408_100001382 3300031548 Bacteria 18050
251 Ga0307508_10000097 3300031616 Bacteria 103662
252 Ga0307508_10000412 3300031616 Bacteria 50808
253 Ga0307508_10001697 3300031616 Bacteria 24440
254 Ga0307508_10001791 3300031616 Bacteria 23876
255 Ga0307508_10006375 3300031616 Bacteria 11096
256 Ga0307508_10058425 3300031616 Bacteria 3412
257 Ga0307514_10001713 3300031649 Bacteria 25184
258 Ga0307514_10033260 3300031649 Bacteria 4116
259 Ga0307514_10113059 3300031649 Bacteria 1917
260 Ga0307514_10134731 3300031649 Bacteria 1693
261 Ga0307514_10205485 3300031649 Bacteria 1231
262 Ga0307516_10004792 3300031730 Bacteria 16488
263 Ga0307516_10058559 3300031730 Bacteria 3750
264 Ga0307516_10115718 3300031730 Bacteria 2477
265 Ga0307406_10000931 3300031901 Bacteria 16339
266 Ga0307507_10006339 3300033179 Bacteria 18255
267 Ga0307507_10026906 3300033179 Bacteria 6185
268 Ga0307507_10096560 3300033179 Bacteria 2499
269 Ga0307510_10197873 3300033180 Bacteria 1548
270 Ga0373936_0000014 3300035113 Bacteria 202828
271 Ga0373936_0007356 3300035113 Bacteria 4143
272 Ga0373936_0025043 3300035113 Bacteria 2332
273 Ga0373946_0025912 3300035171 Bacteria 2309
274 Ga0373924_0001472 3300035410 Bacteria 7658
275 Ga0373924_0055919 3300035410 Bacteria 1643
276 Ga0373931_0124710 3300035691 Bacteria 1475
277 Ga0373927_0074895 3300035695 Bacteria 2192
278 Ga0373947_0064981 3300035725 Bacteria 2225
279 Ga0373937_0077753 3300036401 Bacteria 3066
280 Ga0373925_0017662 3300037068 Bacteria 5177
281 Ga0373925_0062980 3300037068 Bacteria 2790
282 Ga0395899_0000439 3300037312 Bacteria 47640
283 Ga0395899_0002901 3300037312 Bacteria 13781
284 Ga0395899_0003277 3300037312 Bacteria 12837
285 Ga0395899_0005643 3300037312 Bacteria 9711
286 Ga0395900_0003982 3300037418 Bacteria 15770
287 Ga0395900_0006947 3300037418 Bacteria 11742
288 Ga0395900_0031706 3300037418 Bacteria 5432
289 Ga0395900_0047376 3300037418 Bacteria 4425
290 Ga0395898_0008585 3300037466 Bacteria 10782
291 Ga0395898_0011655 3300037466 Bacteria 9119
292 Ga0395905_0004813 3300037471 Bacteria 13929
293 Ga0395905_0148831 3300037471 Bacteria 2203
294 Ga0395901_0019451 3300038443 Bacteria 6943
295 Ga0395901_0022179 3300038443 Bacteria 6506
296 Ga0395901_0050898 3300038443 Bacteria 4304
297 Ga0395901_0123389 3300038443 Bacteria 2722
298 Ga0395901_0125258 3300038443 Bacteria 2700
299 Ga0439461_0020413 3300041410 Bacteria 1311
300 Ga0451802_1256569 3300041460 Bacteria 2565
301 Ga0451853_0840822 3300041512 Bacteria 1800
302 Ga0439431_0003980 3300041997 Bacteria 3253
303 Ga0450898_002675 3300042134 Bacteria 2497
304 Ga0439460_0024484 3300042461 Bacteria 1672
305 Ga0450893_0011593 3300042532 Bacteria 1458
306 Ga0466969_0012519 3300044656 Bacteria 4472
307 Ga0466972_0001573 3300044658 Bacteria 11130
308 Ga0466972_0074011 3300044658 Bacteria 1623
309 Ga0466965_0008321 3300044683 Bacteria 4797
310 Ga0466965_0222073 3300044683 Bacteria 1007
311 Ga0466966_0013155 3300044684 Bacteria 5480
312 Ga0466961_0000421 3300044693 Bacteria 27063
313 Ga0466964_0004540 3300044706 Bacteria 5128
314 Ga0466968_0000892 3300044735 Bacteria 10496
315 Ga0466957_0008010 3300044842 Bacteria 5994
316 Ga0466958_0017064 3300045836 Bacteria 4191
317 Ga0495617_001179 3300046452 Bacteria 11806
318 Ga0495617_013587 3300046452 Bacteria 2770
319 Ga0495627_000015 3300046453 Bacteria 320787
320 Ga0495592_0000175 3300046454 Bacteria 56416
321 Ga0495603_0073101 3300046455 Bacteria 2015
322 Ga0495590_0000001 3300046457 Bacteria 762984
323 Ga0495590_0001681 3300046457 Bacteria 9407
324 Ga0495590_0008483 3300046457 Bacteria 3924
325 Ga0495590_0009678 3300046457 Bacteria 3655
326 Ga0495629_0203914 3300046459 Bacteria 1367
327 Ga0495638_0002754 3300046460 Bacteria 14123
328 Ga0495638_0005064 3300046460 Bacteria 9880
329 Ga0495638_0084731 3300046460 Bacteria 1918
330 Ga0495638_0144893 3300046460 Bacteria 1383
331 Ga0495638_0166990 3300046460 Bacteria 1265
332 Ga0495653_0000009 3300046463 Bacteria 304207
333 Ga0495650_0000001 3300046471 Bacteria 1085492
334 Ga0495650_0000051 3300046471 Bacteria 318297
335 Ga0495650_0000164 3300046471 Bacteria 147142
336 Ga0495650_0000213 3300046471 Bacteria 123910
337 Ga0495650_0000289 3300046471 Bacteria 93255
338 Ga0495650_0002251 3300046471 Bacteria 16132
339 Ga0495650_0009697 3300046471 Bacteria 5456
340 Ga0495605_0001676 3300046474 Bacteria 14240
341 Ga0495605_0011586 3300046474 Bacteria 4911
342 Ga0495605_0116741 3300046474 Bacteria 1213
343 Ga0495639_0102142 3300046475 Bacteria 1355
344 Ga0495584_0000179 3300046491 Bacteria 44738
345 Ga0495584_0001609 3300046491 Bacteria 13289
346 Ga0495584_0011146 3300046491 Bacteria 4608
347 Ga0495584_0012011 3300046491 Bacteria 4428
348 Ga0495585_0000587 3300046492 Bacteria 34126
349 Ga0495585_0019845 3300046492 Bacteria 3870
350 Ga0495585_0033368 3300046492 Bacteria 2914
351 Ga0495585_0060255 3300046492 Bacteria 2089
352 Ga0495596_0000029 3300046500 Bacteria 103615
353 Ga0495596_0000309 3300046500 Bacteria 32084
354 Ga0495596_0003951 3300046500 Bacteria 7334
355 Ga0495596_0006179 3300046500 Bacteria 5548
356 Ga0495596_0006338 3300046500 Bacteria 5459
357 Ga0495596_0010016 3300046500 Bacteria 4147
358 Ga0495596_0010603 3300046500 Bacteria 4005
359 Ga0495607_0000867 3300046501 Bacteria 28348
360 Ga0495607_0135877 3300046501 Bacteria 1273
361 Ga0495583_0000014 3300046506 Bacteria 320136
362 Ga0495583_0000127 3300046506 Bacteria 127780
363 Ga0495583_0002530 3300046506 Bacteria 15470
364 Ga0495583_0002687 3300046506 Bacteria 14789
365 Ga0495583_0003009 3300046506 Bacteria 13477
366 Ga0495583_0012173 3300046506 Bacteria 4889
367 Ga0495583_0022588 3300046506 Bacteria 3204
368 Ga0495583_0023323 3300046506 Bacteria 3133
369 Ga0495583_0023527 3300046506 Bacteria 3114
370 Ga0495583_0028223 3300046506 Bacteria 2762
371 Ga0495583_0029866 3300046506 Bacteria 2662
372 Ga0495606_0026449 3300046507 Bacteria 4136
373 Ga0495610_0000008 3300046512 Bacteria 622732
374 Ga0495610_0001018 3300046512 Bacteria 25838
375 Ga0495616_0000034 3300046513 Bacteria 129394
376 Ga0495616_0000982 3300046513 Bacteria 20446
377 Ga0495616_0001531 3300046513 Bacteria 15932
378 Ga0495616_0002129 3300046513 Bacteria 13266
379 Ga0495616_0005494 3300046513 Bacteria 7791
380 Ga0495616_0008342 3300046513 Bacteria 6143
381 Ga0495616_0021724 3300046513 Bacteria 3470
382 Ga0495616_0033553 3300046513 Bacteria 2673
383 Ga0495631_0001648 3300046518 Bacteria 13280
384 Ga0495631_0004819 3300046518 Bacteria 7110
385 Ga0495632_0000033 3300046519 Bacteria 164240
386 Ga0495632_0000086 3300046519 Bacteria 95327
387 Ga0495632_0000321 3300046519 Bacteria 46253
388 Ga0495632_0001237 3300046519 Bacteria 21665
389 Ga0495632_0023864 3300046519 Bacteria 3260
390 Ga0495632_0041909 3300046519 Bacteria 2298
391 Ga0495637_0004655 3300046520 Bacteria 7087
392 Ga0495643_0000044 3300046522 Bacteria 226211
393 Ga0495643_0000330 3300046522 Bacteria 65068
394 Ga0495643_0000398 3300046522 Bacteria 57089
395 Ga0495643_0000760 3300046522 Bacteria 36247
396 Ga0495643_0006770 3300046522 Bacteria 7495
397 Ga0495643_0014616 3300046522 Bacteria 4666
398 Ga0495643_0016715 3300046522 Bacteria 4307
399 Ga0495643_0018460 3300046522 Bacteria 4052
400 Ga0495643_0028483 3300046522 Bacteria 3131
401 Ga0495643_0042087 3300046522 Bacteria 2489
402 Ga0495643_0086518 3300046522 Bacteria 1623
403 Ga0495643_0086583 3300046522 Bacteria 1623
404 Ga0495643_0093376 3300046522 Bacteria 1550
405 Ga0495644_0000030 3300046523 Bacteria 66319
406 Ga0495644_0000087 3300046523 Bacteria 46212
407 Ga0495644_0014120 3300046523 Bacteria 3060
408 Ga0495644_0025142 3300046523 Bacteria 2262
409 Ga0495644_0048228 3300046523 Bacteria 1600
410 Ga0495648_0000001 3300046524 Bacteria 696872
411 Ga0495648_0000476 3300046524 Bacteria 43122
412 Ga0495648_0000505 3300046524 Bacteria 41982
413 Ga0495648_0001508 3300046524 Bacteria 22794
414 Ga0495648_0011019 3300046524 Bacteria 6850
415 Ga0495648_0013032 3300046524 Bacteria 6169
416 Ga0495648_0027406 3300046524 Bacteria 3814
417 Ga0495648_0035745 3300046524 Bacteria 3216
418 Ga0495648_0051698 3300046524 Bacteria 2501
419 Ga0495648_0124921 3300046524 Bacteria 1377
420 Ga0495642_0000246 3300046528 Bacteria 30547
421 Ga0495642_0000273 3300046528 Bacteria 29188
422 Ga0495642_0000401 3300046528 Bacteria 23277
423 Ga0495642_0064906 3300046528 Bacteria 1519
424 Ga0495654_0000058 3300046530 Bacteria 139884
425 Ga0495654_0001164 3300046530 Bacteria 18772
426 Ga0495654_0002363 3300046530 Bacteria 12189
427 Ga0495654_0019831 3300046530 Bacteria 3511
428 Ga0495609_0000628 3300046538 Bacteria 27456
429 Ga0495609_0000919 3300046538 Bacteria 21337
430 Ga0495609_0002275 3300046538 Bacteria 11973
431 Ga0495609_0002371 3300046538 Bacteria 11615
432 Ga0495609_0005276 3300046538 Bacteria 6857
433 Ga0495609_0024172 3300046538 Bacteria 2789
434 Ga0495609_0037656 3300046538 Bacteria 2181
435 Ga0495609_0065665 3300046538 Bacteria 1599
436 Ga0495597_0000115 3300046542 Bacteria 72325
437 Ga0495597_0000416 3300046542 Bacteria 36694
438 Ga0495597_0000996 3300046542 Bacteria 21725
439 Ga0495597_0001025 3300046542 Bacteria 21374
440 Ga0495597_0015801 3300046542 Bacteria 3572
441 Ga0495597_0029847 3300046542 Bacteria 2487
442 Ga0495622_0000088 3300046557 Bacteria 82716
443 Ga0495622_0014560 3300046557 Bacteria 3652
444 Ga0495633_0000521 3300046558 Bacteria 38447
445 Ga0495633_0001541 3300046558 Bacteria 17706
446 Ga0495633_0003990 3300046558 Bacteria 9560
447 Ga0495633_0005688 3300046558 Bacteria 7544
448 Ga0495633_0007567 3300046558 Bacteria 6232
449 Ga0495633_0020492 3300046558 Bacteria 3325
450 Ga0495633_0028096 3300046558 Bacteria 2744
451 Ga0495656_0002437 3300046615 Bacteria 6180
452 Ga0495656_0034074 3300046615 Bacteria 2082
453 Ga0495656_0074294 3300046615 Bacteria 1518
454 Ga0495668_0000045 3300046616 Bacteria 225145
455 Ga0495668_0000193 3300046616 Bacteria 89740
456 Ga0495668_0000669 3300046616 Bacteria 41269
457 Ga0495668_0019657 3300046616 Bacteria 3891
458 Ga0495668_0031449 3300046616 Bacteria 2991
459 Ga0495611_0000439 3300046648 Bacteria 25620
460 Ga0495625_0000065 3300046660 Bacteria 173230
461 Ga0495625_0001600 3300046660 Bacteria 26768
462 Ga0495625_0002865 3300046660 Bacteria 18093
463 Ga0495625_0003174 3300046660 Bacteria 16723
464 Ga0495625_0010801 3300046660 Bacteria 7516
465 Ga0495625_0020433 3300046660 Bacteria 5112
466 Ga0495625_0027912 3300046660 Bacteria 4239
467 Ga0495625_0067179 3300046660 Bacteria 2524
468 Ga0495625_0084932 3300046660 Bacteria 2198
469 Ga0495625_0105403 3300046660 Bacteria 1931
470 Ga0495625_0138899 3300046660 Bacteria 1640
471 Ga0495659_0000041 3300046664 Bacteria 59124
472 Ga0495659_0000243 3300046664 Bacteria 22725
473 Ga0495659_0005877 3300046664 Bacteria 3875
474 Ga0495659_0015612 3300046664 Bacteria 2498
475 Ga0495661_0000049 3300046665 Bacteria 144060
476 Ga0495661_0000170 3300046665 Bacteria 77754
477 Ga0495661_0000843 3300046665 Bacteria 28565
478 Ga0495661_0001206 3300046665 Bacteria 22434
479 Ga0495661_0002108 3300046665 Bacteria 15613
480 Ga0495661_0014647 3300046665 Bacteria 5252
481 Ga0495661_0015806 3300046665 Bacteria 5026
482 Ga0495661_0024792 3300046665 Bacteria 3881
483 Ga0495661_0029049 3300046665 Bacteria 3533
484 Ga0495661_0074974 3300046665 Bacteria 1967
485 Ga0495647_0000332 3300046681 Bacteria 13240
486 Ga0495658_0000659 3300046683 Bacteria 18706
487 Ga0495669_0008396 3300046684 Bacteria 4342
488 Ga0495624_0038828 3300046690 Bacteria 3056
489 Ga0495624_0039178 3300046690 Bacteria 3039
490 Ga0495670_0000064 3300046691 Bacteria 47436
491 Ga0495670_0020850 3300046691 Bacteria 3232
492 Ga0495671_0000002 3300046692 Bacteria 1136189
493 Ga0495671_0000131 3300046692 Bacteria 67432
494 Ga0495671_0000198 3300046692 Bacteria 52877
495 Ga0495671_0001101 3300046692 Bacteria 18664
496 Ga0495671_0014286 3300046692 Bacteria 4277
497 Ga0495671_0032750 3300046692 Bacteria 2652
498 Ga0495671_0047840 3300046692 Bacteria 2135
499 Ga0495649_0000166 3300046694 Bacteria 57538
500 Ga0495649_0000303 3300046694 Bacteria 43094
501 Ga0495649_0111140 3300046694 Bacteria 1453
502 Ga0495589_0024973 3300046794 Bacteria 3034
503 Ga0495589_0030641 3300046794 Bacteria 2709
504 Ga0495660_0002620 3300046810 Bacteria 11425
505 Ga0495660_0004863 3300046810 Bacteria 8088
506 Ga0495660_0024680 3300046810 Bacteria 3424
507 Ga0495660_0053376 3300046810 Bacteria 2194
508 Ga0495660_0087452 3300046810 Bacteria 1625
509 Ga0495636_0000067 3300047318 Bacteria 44261
510 Ga0495636_0000361 3300047318 Bacteria 17364
511 Ga0495636_0000537 3300047318 Bacteria 13950
512 Ga0495636_0014179 3300047318 Bacteria 3169
513 Ga0495636_0097928 3300047318 Bacteria 1279
514 Ga0495672_0000031 3300047320 Bacteria 298258
515 Ga0495672_0000685 3300047320 Bacteria 37744
516 Ga0495672_0000918 3300047320 Bacteria 30795
517 Ga0495672_0001603 3300047320 Bacteria 22074
518 Ga0495672_0005983 3300047320 Bacteria 9528
519 Ga0495672_0026249 3300047320 Bacteria 3719
520 Ga0495680_0054184 3300047322 Bacteria 3116
521 Ga0495680_0213911 3300047322 Bacteria 1379
522 Ga0495683_0014460 3300047323 Bacteria 4111
523 Ga0495683_0022503 3300047323 Bacteria 3240
524 Ga0495687_000002 3300047443 Bacteria 1085770
525 Ga0495687_000566 3300047443 Bacteria 43606
526 Ga0495687_000603 3300047443 Bacteria 42021
527 Ga0495687_001099 3300047443 Bacteria 26415
528 Ga0495687_001273 3300047443 Bacteria 23729
529 Ga0495687_002986 3300047443 Bacteria 12800
530 Ga0495687_039408 3300047443 Bacteria 2090
531 Ga0495677_0000448 3300047445 Bacteria 17572
532 Ga0495677_0000512 3300047445 Bacteria 16307
533 Ga0495677_0001444 3300047445 Bacteria 9529
534 Ga0495677_0002369 3300047445 Bacteria 7408
535 Ga0495677_0003267 3300047445 Bacteria 6320
536 Ga0495679_000296 3300047446 Bacteria 40360
537 Ga0495679_002037 3300047446 Bacteria 10678
538 Ga0495679_005527 3300047446 Bacteria 5591
539 Ga0495679_009576 3300047446 Bacteria 3867
540 Ga0495679_026550 3300047446 Bacteria 1922
541 Ga0495685_000307 3300047447 Bacteria 16005
542 Ga0495685_000415 3300047447 Bacteria 13478
543 Ga0495685_000442 3300047447 Bacteria 13039
544 Ga0495685_002949 3300047447 Bacteria 5382
545 Ga0495673_0000061 3300047469 Bacteria 230647
546 Ga0495673_0000926 3300047469 Bacteria 26610
547 Ga0495673_0003599 3300047469 Bacteria 10155
548 Ga0495681_0000016 3300047470 Bacteria 181322
549 Ga0495681_0006711 3300047470 Bacteria 7511
550 Ga0495681_0020116 3300047470 Bacteria 3628
551 Ga0495681_0045609 3300047470 Bacteria 2096
552 Ga0495686_0000464 3300047472 Bacteria 60897
553 Ga0495686_0078668 3300047472 Bacteria 2018
554 Ga0495615_0005473 3300048090 Bacteria 2286
555 Ga0495615_0045631 3300048090 Bacteria 1111
556 Ga0495626_0003695 3300048091 Bacteria 9685
557 Ga0495626_0004000 3300048091 Bacteria 9214
558 Ga0495626_0007408 3300048091 Bacteria 6113
559 Ga0495626_0008372 3300048091 Bacteria 5678
560 Ga0495626_0022599 3300048091 Bacteria 3104
561 Ga0495626_0039282 3300048091 Bacteria 2240
562 Ga0495626_0048228 3300048091 Bacteria 1977
563 Ga0496100_0007896 3300048903 Bacteria 5909
564 Ga0496101_0156114 3300048904 Bacteria 1748
565 Ga0496102_0178992 3300048905 Bacteria 1997
566 Ga0496108_0165981 3300048911 Bacteria 1909
567 Ga0496109_0043051 3300048912 Bacteria 4092
568 Ga0496110_0073722 3300048913 Bacteria 3029
569 Ga0496121_0317167 3300048924 Bacteria 1051
570 Ga0496122_0000552 3300048925 Bacteria 77275
571 Ga0496123_0001585 3300048926 Bacteria 30921
572 Ga0496125_0001368 3300048928 Bacteria 35878
573 Ga0495678_000009 3300049459 Bacteria 373806
574 Ga0495678_000035 3300049459 Bacteria 200957
575 Ga0495678_000215 3300049459 Bacteria 66940
576 Ga0495678_000870 3300049459 Bacteria 26857
577 Ga0495678_013147 3300049459 Bacteria 3896
578 Ga0495682_0000825 3300049460 Bacteria 19451
579 Ga0495682_0001155 3300049460 Bacteria 15187
580 Ga0495682_0002609 3300049460 Bacteria 8457
581 Ga0495682_0005605 3300049460 Bacteria 5195
582 Ga0501292_005421 3300049515 Bacteria 1778
583 Ga0501034_0001279 3300049571 Bacteria 34010
584 Ga0501034_0177688 3300049571 Bacteria 2094
585 Ga0501043_0010569 3300049579 Bacteria 7226
586 Ga0501046_0012537 3300049580 Bacteria 7209
587 Ga0501047_0015658 3300049581 Bacteria 7226
588 Ga0501068_0006293 3300049584 Bacteria 6538
589 Ga0501070_0060688 3300049586 Bacteria 3134
590 Ga0501072_0013881 3300049588 Bacteria 6173
591 Ga0501073_0054792 3300049589 Bacteria 2791
592 Ga0501080_0194464 3300049742 Bacteria 1863
593 Ga0501083_0120754 3300049744 Bacteria 1719
594 Ga0501262_001032 3300049759 Bacteria 3150
595 Ga0501045_0049558 3300049824 Bacteria 3062
596 nmdc:mga03n38_5431_c1 3300050490 Bacteria 4341
597 nmdc:mga00v17_67048_c1 3300050491 Bacteria 2217
598 nmdc:mga0yw44_142853_c1 3300050492 Bacteria 1556
599 nmdc:mga0yw44_31056_c1 3300050492 Bacteria 3103
600 nmdc:mga0k408_13676_c1 3300050493 Bacteria 4456
601 nmdc:mga0k408_1832_c1 3300050493 Bacteria 11407
602 nmdc:mga0k408_18764_c1 3300050493 Bacteria 3863
603 nmdc:mga0k408_3006_c2 3300050493 Bacteria 7321
604 nmdc:mga0k408_3937_c1 3300050493 Bacteria 7878
605 nmdc:mga0k408_57762_c1 3300050493 Bacteria 2253
606 nmdc:mga07m45_127_c1 3300050496 Bacteria 30414
607 nmdc:mga07m45_85267_c1 3300050496 Bacteria 1806
608 nmdc:mga0qj67_109220_c1 3300050509 Bacteria 2232
609 nmdc:mga0sz30_43269_c1 3300050516 Bacteria 1896
610 nmdc:mga0sz30_71771_c1 3300050516 Bacteria 1491
611 Ga0500644_0010789 3300053088 Bacteria 2480
612 Ga0500644_0093379 3300053088 Bacteria 1130
613 Ga0500647_0128669 3300053091 Bacteria 1195
614 Ga0500583_0032769 3300053092 Bacteria 2294
615 Ga0500593_000057 3300053117 Bacteria 41215
616 Ga0500594_0015641 3300053118 Bacteria 1832
617 Ga0500618_000173 3300053125 Bacteria 53346
618 Ga0500559_0005150 3300053136 Bacteria 6038
619 Ga0500586_000649 3300053145 Bacteria 7086
620 Ga0500586_040450 3300053145 Bacteria 1579
621 Ga0500619_009851 3300053154 Bacteria 2390
622 Ga0500622_0008524 3300053156 Bacteria 5727
623 Ga0500639_008998 3300053163 Bacteria 5208
624 Ga0500587_005663 3300053739 Bacteria 1672
625 Ga0501084_0366658 3300054114 Bacteria 1217

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300044683 Ga0466965_0222073 Ga0466965_0222073_113_982 289
2 3300048924 Ga0496121_0317167 Ga0496121_0317167_17_901 292
3 3300046522 Ga0495643_0016715 Ga0495643_0016715_1463_2512 308
4 3300046542 Ga0495597_0029847 Ga0495597_0029847_61_1110 308
5 3300046665 Ga0495661_0002108 Ga0495661_0002108_7032_8081 308
6 3300046522 Ga0495643_0086583 Ga0495643_0086583_553_1491 311
7 3300046474 Ga0495605_0116741 Ga0495605_0116741_38_997 317
8 3300046506 Ga0495583_0023323 Ga0495583_0023323_1514_2470 317
9 3300046522 Ga0495643_0093376 Ga0495643_0093376_556_1515 317
10 3300005535 Ga0070684_100074345 Ga0070684_1000743452 322
11 3300005578 Ga0068854_100007377 Ga0068854_1000073775 322
12 3300005616 Ga0068852_100006894 Ga0068852_1000068944 322
13 3300025945 Ga0207679_10013747 Ga0207679_100137474 322
14 3300041512 Ga0451853_0840822 Ga0451853_0840822_770_1741 323
15 3300046460 Ga0495638_0002754 Ga0495638_0002754_1013_1984 323
16 3300046460 Ga0495638_0144893 Ga0495638_0144893_20_997 323
17 3300046660 Ga0495625_0001600 Ga0495625_0001600_8783_9754 323
18 3300035695 Ga0373927_0074895 Ga0373927_0074895_1076_2158 333
19 3300035691 Ga0373931_0124710 Ga0373931_0124710_110_1156 334
20 iso_pu_bacteria 2842711865 2842713446 336
21 3300009177 Ga0105248_10283602 Ga0105248_102836022 338
22 3300025914 Ga0207671_10082937 Ga0207671_100829372 338
23 3300046457 Ga0495590_0001681 Ga0495590_0001681_3062_4123 338
24 3300002738 JGI25154J39366_1000278 JGI25154J39366_10002788 339
25 3300025246 Ga0209646_1000023 Ga0209646_1000023353 339
26 3300031548 Ga0307408_100000196 Ga0307408_10000019623 339
27 3300046457 Ga0495590_0000001 Ga0495590_0000001_345858_346886 339
28 3300046471 Ga0495650_0000001 Ga0495650_0000001_688490_689515 339
29 3300046501 Ga0495607_0000867 Ga0495607_0000867_13516_14544 339
30 3300046506 Ga0495583_0000127 Ga0495583_0000127_18538_19563 339
31 3300046506 Ga0495583_0002687 Ga0495583_0002687_3131_4159 339
32 3300046506 Ga0495583_0022588 Ga0495583_0022588_1376_2401 339
33 3300046513 Ga0495616_0033553 Ga0495616_0033553_1005_2063 339
34 3300046522 Ga0495643_0000044 Ga0495643_0000044_45525_46553 339
35 3300046522 Ga0495643_0000760 Ga0495643_0000760_23934_24998 339
36 3300046522 Ga0495643_0014616 Ga0495643_0014616_1930_2955 339
37 3300046523 Ga0495644_0025142 Ga0495644_0025142_344_1369 339
38 3300046524 Ga0495648_0000001 Ga0495648_0000001_502341_503369 339
39 3300046528 Ga0495642_0000401 Ga0495642_0000401_7632_8660 339
40 3300046538 Ga0495609_0000628 Ga0495609_0000628_14354_15382 339
41 3300046542 Ga0495597_0000115 Ga0495597_0000115_57515_58543 339
42 3300046615 Ga0495656_0002437 Ga0495656_0002437_4023_5048 339
43 3300046615 Ga0495656_0074294 Ga0495656_0074294_301_1326 339
44 3300046616 Ga0495668_0000045 Ga0495668_0000045_38799_39827 339
45 3300046660 Ga0495625_0000065 Ga0495625_0000065_134671_135699 339
46 3300046660 Ga0495625_0003174 Ga0495625_0003174_2021_3049 339
47 3300046664 Ga0495659_0015612 Ga0495659_0015612_900_1970 339
48 3300046691 Ga0495670_0020850 Ga0495670_0020850_162_1187 339
49 3300046692 Ga0495671_0047840 Ga0495671_0047840_820_1848 339
50 3300046810 Ga0495660_0002620 Ga0495660_0002620_9184_10212 339
51 3300047318 Ga0495636_0000537 Ga0495636_0000537_2249_3277 339
52 3300047318 Ga0495636_0097928 Ga0495636_0097928_195_1220 339
53 3300047443 Ga0495687_001099 Ga0495687_001099_10150_11178 339
54 3300047443 Ga0495687_001273 Ga0495687_001273_10145_11173 339
55 3300047443 Ga0495687_002986 Ga0495687_002986_2262_3290 339
56 3300047443 Ga0495687_039408 Ga0495687_039408_154_1218 339
57 3300047445 Ga0495677_0002369 Ga0495677_0002369_4222_5250 339
58 3300047447 Ga0495685_000307 Ga0495685_000307_5467_6495 339
59 3300048090 Ga0495615_0005473 Ga0495615_0005473_999_2024 339
60 3300048090 Ga0495615_0045631 Ga0495615_0045631_25_1050 339
61 3300048091 Ga0495626_0003695 Ga0495626_0003695_3235_4260 339
62 3300048091 Ga0495626_0008372 Ga0495626_0008372_1033_2109 339
63 3300048091 Ga0495626_0039282 Ga0495626_0039282_109_1173 339
64 iso_pu_bacteria 2738541280 2738739730 339
65 iso_pu_bacteria 2738541297 2738830464 339
66 iso_pu_bacteria 2738541357 2739154260 339
67 iso_pu_bacteria 2738543003 2739196207 339
68 iso_pu_bacteria 2738543026 2739322656 339
69 iso_pu_bacteria 2738543029 2739340897 339
70 iso_pu_bacteria 2919704043 2919708067 339
71 iso_pu_bacteria 2904530477 2904532425 340
72 iso_pu_bacteria 2923510766 2923515414 340
73 3300005356 Ga0070674_100380950 Ga0070674_1003809501 341
74 3300005456 Ga0070678_100042691 Ga0070678_1000426912 341
75 3300005459 Ga0068867_100103519 Ga0068867_1001035192 341
76 3300005843 Ga0068860_100219142 Ga0068860_1002191422 341
77 3300006177 Ga0075362_10009785 Ga0075362_100097852 341
78 3300006358 Ga0068871_100168570 Ga0068871_1001685702 341
79 3300014326 Ga0157380_10111063 Ga0157380_101110632 341
80 3300025938 Ga0207704_10067551 Ga0207704_100675512 341
81 3300026089 Ga0207648_10036621 Ga0207648_100366212 341
82 3300028381 Ga0268264_10151399 Ga0268264_101513992 341
83 3300035113 Ga0373936_0000014 Ga0373936_0000014_102329_103357 341
84 3300037312 Ga0395899_0002901 Ga0395899_0002901_4595_5635 341
85 3300037312 Ga0395899_0003277 Ga0395899_0003277_8517_9557 341
86 3300037418 Ga0395900_0003982 Ga0395900_0003982_6584_7624 341
87 3300037418 Ga0395900_0006947 Ga0395900_0006947_3178_4218 341
88 3300037466 Ga0395898_0008585 Ga0395898_0008585_7072_8112 341
89 3300037466 Ga0395898_0011655 Ga0395898_0011655_7443_8483 341
90 3300037471 Ga0395905_0004813 Ga0395905_0004813_8118_9158 341
91 3300038443 Ga0395901_0022179 Ga0395901_0022179_4356_5396 341
92 3300038443 Ga0395901_0050898 Ga0395901_0050898_538_1578 341
93 3300045836 Ga0466958_0017064 Ga0466958_0017064_2903_3943 341
94 3300046452 Ga0495617_001179 Ga0495617_001179_1500_2609 341
95 3300046471 Ga0495650_0000051 Ga0495650_0000051_248770_249798 341
96 3300046491 Ga0495584_0011146 Ga0495584_0011146_1769_2878 341
97 3300046506 Ga0495583_0029866 Ga0495583_0029866_1404_2480 341
98 3300046522 Ga0495643_0000398 Ga0495643_0000398_53135_54199 341
99 3300046538 Ga0495609_0024172 Ga0495609_0024172_945_2054 341
100 3300046558 Ga0495633_0001541 Ga0495633_0001541_11006_12115 341
101 3300046660 Ga0495625_0027912 Ga0495625_0027912_2767_3795 341
102 3300046692 Ga0495671_0032750 Ga0495671_0032750_1026_2135 341
103 3300048905 Ga0496102_0178992 Ga0496102_0178992_720_1766 341
104 3300049460 Ga0495682_0000825 Ga0495682_0000825_5355_6464 341
105 3300049744 Ga0501083_0120754 Ga0501083_0120754_131_1171 341
106 iso_pu_bacteria 2818991445 2819594126 341
107 3300005328 Ga0070676_10010954 Ga0070676_100109542 342
108 3300005330 Ga0070690_100010785 Ga0070690_1000107854 342
109 3300005334 Ga0068869_100007924 Ga0068869_1000079243 342
110 3300005336 Ga0070680_100188942 Ga0070680_1001889422 342
111 3300005338 Ga0068868_100076352 Ga0068868_1000763522 342
112 3300005340 Ga0070689_100006491 Ga0070689_1000064916 342
113 3300005340 Ga0070689_100082346 Ga0070689_1000823463 342
114 3300005438 Ga0070701_10000403 Ga0070701_100004035 342
115 3300005441 Ga0070700_100002730 Ga0070700_1000027308 342
116 3300005456 Ga0070678_100004661 Ga0070678_1000046615 342
117 3300005459 Ga0068867_100007948 Ga0068867_1000079487 342
118 3300005544 Ga0070686_100001963 Ga0070686_1000019637 342
119 3300005545 Ga0070695_100099432 Ga0070695_1000994322 342
120 3300005545 Ga0070695_100153193 Ga0070695_1001531932 342
121 3300005547 Ga0070693_100007222 Ga0070693_1000072225 342
122 3300005549 Ga0070704_100269721 Ga0070704_1002697211 342
123 3300005563 Ga0068855_100001569 Ga0068855_10000156919 342
124 3300005564 Ga0070664_100000426 Ga0070664_1000004269 342
125 3300005614 Ga0068856_100000978 Ga0068856_10000097817 342
126 3300005617 Ga0068859_100011217 Ga0068859_1000112175 342
127 3300005718 Ga0068866_10002351 Ga0068866_100023517 342
128 3300005719 Ga0068861_100007675 Ga0068861_1000076754 342
129 3300005840 Ga0068870_10021148 Ga0068870_100211482 342
130 3300005842 Ga0068858_100004891 Ga0068858_10000489116 342
131 3300005843 Ga0068860_100078082 Ga0068860_1000780821 342
132 3300006237 Ga0097621_100038338 Ga0097621_1000383383 342
133 3300006358 Ga0068871_100006001 Ga0068871_1000060015 342
134 3300006881 Ga0068865_100002680 Ga0068865_1000026808 342
135 3300006931 Ga0097620_100011217 Ga0097620_1000112176 342
136 3300009098 Ga0105245_10021546 Ga0105245_100215465 342
137 3300009148 Ga0105243_10022655 Ga0105243_100226554 342
138 3300009148 Ga0105243_10264203 Ga0105243_102642032 342
139 3300009176 Ga0105242_10002015 Ga0105242_100020155 342
140 3300009177 Ga0105248_10204078 Ga0105248_102040782 342
141 3300013102 Ga0157371_10000422 Ga0157371_100004225 342
142 3300013297 Ga0157378_10026828 Ga0157378_100268285 342
143 3300013308 Ga0157375_10182308 Ga0157375_101823082 342
144 3300014326 Ga0157380_10036152 Ga0157380_100361522 342
145 3300014968 Ga0157379_10160163 Ga0157379_101601632 342
146 3300025899 Ga0207642_10022558 Ga0207642_100225581 342
147 3300025907 Ga0207645_10010581 Ga0207645_100105813 342
148 3300025907 Ga0207645_10162183 Ga0207645_101621832 342
149 3300025934 Ga0207686_10003923 Ga0207686_100039231 342
150 3300025935 Ga0207709_10143820 Ga0207709_101438202 342
151 3300025936 Ga0207670_10011083 Ga0207670_100110835 342
152 3300025942 Ga0207689_10002140 Ga0207689_100021404 342
153 3300025945 Ga0207679_10002864 Ga0207679_100028645 342
154 3300025949 Ga0207667_10009133 Ga0207667_100091333 342
155 3300026023 Ga0207677_10030771 Ga0207677_100307714 342
156 3300026075 Ga0207708_10000219 Ga0207708_1000021917 342
157 3300026089 Ga0207648_10000534 Ga0207648_1000053427 342
158 3300026118 Ga0207675_100000531 Ga0207675_10000053124 342
159 3300026121 Ga0207683_10009791 Ga0207683_100097914 342
160 3300027671 Ga0209588_1016549 Ga0209588_10165493 342
161 3300031548 Ga0307408_100001382 Ga0307408_10000138214 342
162 3300031901 Ga0307406_10000931 Ga0307406_100009319 342
163 3300049571 Ga0501034_0001279 Ga0501034_0001279_28577_29617 342
164 3300049571 Ga0501034_0177688 Ga0501034_0177688_594_1634 342
165 3300049584 Ga0501068_0006293 Ga0501068_0006293_2986_4029 342
166 3300049586 Ga0501070_0060688 Ga0501070_0060688_1592_2635 342
167 3300049588 Ga0501072_0013881 Ga0501072_0013881_1674_2714 342
168 3300049742 Ga0501080_0194464 Ga0501080_0194464_750_1793 342
169 3300054114 Ga0501084_0366658 Ga0501084_0366658_17_1060 342
170 iso_pu_bacteria 2551306416 2553004586 342
171 iso_pu_bacteria 2919046199 2919047936 342
172 3300003320 rootH2_10099521 rootH2_100995211 343
173 3300003322 rootL2_10293613 rootL2_102936132 343
174 3300005563 Ga0068855_100000028 Ga0068855_10000002857 343
175 3300025245 Ga0207425_1001011 Ga0207425_10010113 343
176 3300025294 Ga0209025_1006776 Ga0209025_10067768 343
177 3300025297 Ga0209758_1000679 Ga0209758_100067927 343
178 3300046665 Ga0495661_0000049 Ga0495661_0000049_90546_91592 343
179 3300048903 Ga0496100_0007896 Ga0496100_0007896_4266_5312 343
180 3300048911 Ga0496108_0165981 Ga0496108_0165981_76_1122 343
181 3300048912 Ga0496109_0043051 Ga0496109_0043051_1170_2216 343
182 3300048925 Ga0496122_0000552 Ga0496122_0000552_52182_53228 343
183 3300048926 Ga0496123_0001585 Ga0496123_0001585_19937_20983 343
184 3300048928 Ga0496125_0001368 Ga0496125_0001368_9942_10988 343
185 3300005327 Ga0070658_10132634 Ga0070658_101326342 344
186 3300005329 Ga0070683_100112346 Ga0070683_1001123462 344
187 3300005364 Ga0070673_100159833 Ga0070673_1001598332 344
188 3300005577 Ga0068857_100159869 Ga0068857_1001598692 344
189 3300006175 Ga0070712_100085822 Ga0070712_1000858222 344
190 3300013307 Ga0157372_10201843 Ga0157372_102018432 344
191 3300025909 Ga0207705_10057039 Ga0207705_100570392 344
192 3300025944 Ga0207661_10051048 Ga0207661_100510483 344
193 3300025949 Ga0207667_10252379 Ga0207667_102523791 344
194 3300025960 Ga0207651_10129602 Ga0207651_101296022 344
195 3300028794 Ga0307515_10097942 Ga0307515_100979423 344
196 3300037471 Ga0395905_0148831 Ga0395905_0148831_124_1164 344
197 3300041460 Ga0451802_1256569 Ga0451802_1256569_155_1189 344
198 3300042461 Ga0439460_0024484 Ga0439460_0024484_149_1186 344
199 iso_pu_bacteria 2585428062 2587758683 344
200 iso_pu_bacteria 2643221611 2644075761 344
201 iso_pu_bacteria 2738541300 2738843852 344
202 iso_pu_bacteria 2738543018 2739274586 344
203 iso_pu_bacteria 2738543030 2739343630 344
204 3300002704 JGI25155J39150_1000302 JGI25155J39150_10003023 345
205 3300002704 JGI25155J39150_1000941 JGI25155J39150_10009411 345
206 3300002705 JGI25156J39149_1000039 JGI25156J39149_100003983 345
207 3300002705 JGI25156J39149_1002181 JGI25156J39149_10021815 345
208 3300002738 JGI25154J39366_1000059 JGI25154J39366_100005983 345
209 3300002738 JGI25154J39366_1000497 JGI25154J39366_100049715 345
210 3300002741 JGI25157J39369_1000057 JGI25157J39369_100005717 345
211 3300003758 Ga0055532_1000018 Ga0055532_1000018266 345
212 3300003761 Ga0055535_1007095 Ga0055535_10070952 345
213 3300025206 Ga0209435_100007 Ga0209435_100007455 345
214 3300025229 Ga0209147_100017 Ga0209147_10001718 345
215 3300025242 Ga0209258_100297 Ga0209258_10029761 345
216 3300025246 Ga0209646_1000061 Ga0209646_100006134 345
217 3300025246 Ga0209646_1000096 Ga0209646_1000096143 345
218 3300025250 Ga0209026_1000052 Ga0209026_1000052208 345
219 3300025256 Ga0209759_1000174 Ga0209759_100017418 345
220 3300025256 Ga0209759_1000209 Ga0209759_100020933 345
221 3300025272 Ga0209455_1019008 Ga0209455_10190082 345
222 3300037312 Ga0395899_0005643 Ga0395899_0005643_183_1226 345
223 3300037418 Ga0395900_0047376 Ga0395900_0047376_1343_2386 345
224 3300038443 Ga0395901_0019451 Ga0395901_0019451_5139_6182 345
225 3300044656 Ga0466969_0012519 Ga0466969_0012519_242_1282 345
226 3300044693 Ga0466961_0000421 Ga0466961_0000421_16374_17414 345
227 3300049589 Ga0501073_0054792 Ga0501073_0054792_1328_2371 345
228 iso_pu_bacteria 2511231002 2511242543 345
229 iso_pu_bacteria 2547132374 2548498602 345
230 iso_pu_bacteria 2643221609 2644059197 345
231 iso_pu_bacteria 2643221717 2644649337 345
232 iso_pu_bacteria 2738543012 2739240690 345
233 iso_pu_bacteria 2816332133 2816472233 345
234 iso_pu_bacteria 2929160207 2929165646 345
235 3300002737 JGI25162J39368_1004881 JGI25162J39368_10048812 346
236 3300006195 Ga0075366_10014644 Ga0075366_100146443 346
237 3300014497 Ga0182008_10005147 Ga0182008_100051472 346
238 3300025233 Ga0209437_100272 Ga0209437_10027242 346
239 3300025906 Ga0207699_10073140 Ga0207699_100731402 346
240 3300035410 Ga0373924_0055919 Ga0373924_0055919_106_1176 346
241 3300036401 Ga0373937_0077753 Ga0373937_0077753_32_1102 346
242 3300037312 Ga0395899_0000439 Ga0395899_0000439_33862_34908 346
243 3300037418 Ga0395900_0031706 Ga0395900_0031706_806_1852 346
244 3300038443 Ga0395901_0123389 Ga0395901_0123389_1619_2665 346
245 3300038443 Ga0395901_0125258 Ga0395901_0125258_342_1388 346
246 3300044658 Ga0466972_0074011 Ga0466972_0074011_155_1201 346
247 3300044684 Ga0466966_0013155 Ga0466966_0013155_3416_4462 346
248 3300046492 Ga0495585_0033368 Ga0495585_0033368_1215_2276 346
249 3300046519 Ga0495632_0041909 Ga0495632_0041909_516_1580 346
250 3300048904 Ga0496101_0156114 Ga0496101_0156114_492_1538 346
251 3300048913 Ga0496110_0073722 Ga0496110_0073722_886_1932 346
252 3300002987 JGI25159J45721_1001495 JGI25159J45721_100149513 347
253 3300003187 JGI25151J46595_10006031 JGI25151J46595_100060312 347
254 3300003187 JGI25151J46595_10006574 JGI25151J46595_100065746 347
255 3300003773 Ga0055537_1000047 Ga0055537_100004734 347
256 3300003775 Ga0055524_1000039 Ga0055524_100003940 347
257 3300003784 Ga0055534_1000141 Ga0055534_100014127 347
258 3300003791 Ga0055530_10000532 Ga0055530_1000053229 347
259 3300003792 Ga0055540_1000047 Ga0055540_100004730 347
260 3300003794 Ga0055531_10011051 Ga0055531_100110515 347
261 3300005262 Ga0065165_1005321 Ga0065165_10053216 347
262 3300005539 Ga0068853_100027653 Ga0068853_1000276532 347
263 3300009545 Ga0105237_10126559 Ga0105237_101265592 347
264 3300025245 Ga0207425_1008751 Ga0207425_10087512 347
265 3300025263 Ga0209565_1000080 Ga0209565_100008035 347
266 3300025273 Ga0209673_1000088 Ga0209673_1000088111 347
267 3300025284 Ga0209130_1000346 Ga0209130_100034630 347
268 3300025291 Ga0209675_1000133 Ga0209675_100013375 347
269 3300025291 Ga0209675_1024886 Ga0209675_10248861 347
270 3300025292 Ga0209676_1000073 Ga0209676_1000073221 347
271 3300025292 Ga0209676_1002444 Ga0209676_100244414 347
272 3300025294 Ga0209025_1003514 Ga0209025_100351414 347
273 3300025294 Ga0209025_1004730 Ga0209025_10047307 347
274 3300025294 Ga0209025_1009596 Ga0209025_10095963 347
275 3300025295 Ga0209564_1000313 Ga0209564_100031349 347
276 3300025295 Ga0209564_1000823 Ga0209564_100082322 347
277 3300025295 Ga0209564_1005212 Ga0209564_10052126 347
278 3300025298 Ga0209050_1000008 Ga0209050_1000008842 347
279 3300025299 Ga0209256_1000096 Ga0209256_100009696 347
280 3300025302 Ga0207426_1001354 Ga0207426_100135422 347
281 3300025303 Ga0209051_1000005 Ga0209051_1000005842 347
282 3300025304 Ga0209257_1000031 Ga0209257_1000031432 347
283 3300025304 Ga0209257_1002902 Ga0209257_10029026 347
284 3300026142 Ga0207698_10152124 Ga0207698_101521242 347
285 3300035171 Ga0373946_0025912 Ga0373946_0025912_597_1679 347
286 3300035410 Ga0373924_0001472 Ga0373924_0001472_6041_7096 347
287 3300035725 Ga0373947_0064981 Ga0373947_0064981_726_1808 347
288 3300037068 Ga0373925_0062980 Ga0373925_0062980_548_1630 347
289 3300046452 Ga0495617_013587 Ga0495617_013587_805_1866 347
290 3300046453 Ga0495627_000015 Ga0495627_000015_231847_232908 347
291 3300046460 Ga0495638_0005064 Ga0495638_0005064_1416_2477 347
292 3300046463 Ga0495653_0000009 Ga0495653_0000009_214164_215225 347
293 3300046471 Ga0495650_0000164 Ga0495650_0000164_25139_26200 347
294 3300046471 Ga0495650_0000289 Ga0495650_0000289_52797_53858 347
295 3300046471 Ga0495650_0002251 Ga0495650_0002251_13737_14798 347
296 3300046471 Ga0495650_0009697 Ga0495650_0009697_1092_2153 347
297 3300046474 Ga0495605_0001676 Ga0495605_0001676_11119_12180 347
298 3300046491 Ga0495584_0000179 Ga0495584_0000179_35383_36444 347
299 3300046491 Ga0495584_0001609 Ga0495584_0001609_10168_11229 347
300 3300046492 Ga0495585_0000587 Ga0495585_0000587_23520_24581 347
301 3300046492 Ga0495585_0060255 Ga0495585_0060255_124_1185 347
302 3300046506 Ga0495583_0000014 Ga0495583_0000014_104879_105940 347
303 3300046506 Ga0495583_0002530 Ga0495583_0002530_13746_14807 347
304 3300046506 Ga0495583_0023527 Ga0495583_0023527_1076_2137 347
305 3300046512 Ga0495610_0000008 Ga0495610_0000008_581741_582802 347
306 3300046512 Ga0495610_0001018 Ga0495610_0001018_13477_14538 347
307 3300046513 Ga0495616_0000982 Ga0495616_0000982_12114_13175 347
308 3300046522 Ga0495643_0000330 Ga0495643_0000330_9926_10987 347
309 3300046523 Ga0495644_0000087 Ga0495644_0000087_28780_29841 347
310 3300046524 Ga0495648_0000476 Ga0495648_0000476_10756_11817 347
311 3300046524 Ga0495648_0001508 Ga0495648_0001508_3426_4487 347
312 3300046524 Ga0495648_0035745 Ga0495648_0035745_1009_2070 347
313 3300046528 Ga0495642_0064906 Ga0495642_0064906_170_1231 347
314 3300046530 Ga0495654_0000058 Ga0495654_0000058_107981_109042 347
315 3300046530 Ga0495654_0002363 Ga0495654_0002363_5801_6862 347
316 3300046538 Ga0495609_0002371 Ga0495609_0002371_2675_3736 347
317 3300046538 Ga0495609_0005276 Ga0495609_0005276_5617_6678 347
318 3300046538 Ga0495609_0065665 Ga0495609_0065665_499_1560 347
319 3300046542 Ga0495597_0000996 Ga0495597_0000996_8630_9691 347
320 3300046557 Ga0495622_0000088 Ga0495622_0000088_77061_78122 347
321 3300046557 Ga0495622_0014560 Ga0495622_0014560_2491_3552 347
322 3300046558 Ga0495633_0000521 Ga0495633_0000521_24939_26000 347
323 3300046558 Ga0495633_0003990 Ga0495633_0003990_1112_2173 347
324 3300046558 Ga0495633_0005688 Ga0495633_0005688_3688_4749 347
325 3300046558 Ga0495633_0007567 Ga0495633_0007567_4388_5449 347
326 3300046615 Ga0495656_0034074 Ga0495656_0034074_780_1841 347
327 3300046616 Ga0495668_0000193 Ga0495668_0000193_33330_34391 347
328 3300046616 Ga0495668_0031449 Ga0495668_0031449_747_1808 347
329 3300046664 Ga0495659_0000041 Ga0495659_0000041_44337_45398 347
330 3300046664 Ga0495659_0000243 Ga0495659_0000243_9329_10390 347
331 3300046664 Ga0495659_0005877 Ga0495659_0005877_1509_2570 347
332 3300046665 Ga0495661_0014647 Ga0495661_0014647_182_1243 347
333 3300046665 Ga0495661_0015806 Ga0495661_0015806_2395_3456 347
334 3300046684 Ga0495669_0008396 Ga0495669_0008396_2381_3442 347
335 3300046691 Ga0495670_0000064 Ga0495670_0000064_16880_17941 347
336 3300046692 Ga0495671_0000002 Ga0495671_0000002_1105124_1106185 347
337 3300046692 Ga0495671_0000198 Ga0495671_0000198_48491_49552 347
338 3300046692 Ga0495671_0001101 Ga0495671_0001101_5520_6581 347
339 3300046694 Ga0495649_0000166 Ga0495649_0000166_47354_48415 347
340 3300046810 Ga0495660_0024680 Ga0495660_0024680_232_1293 347
341 3300047318 Ga0495636_0000067 Ga0495636_0000067_34129_35190 347
342 3300047318 Ga0495636_0000361 Ga0495636_0000361_5107_6168 347
343 3300047320 Ga0495672_0000918 Ga0495672_0000918_19236_20297 347
344 3300047320 Ga0495672_0001603 Ga0495672_0001603_16980_18041 347
345 3300047320 Ga0495672_0026249 Ga0495672_0026249_2268_3329 347
346 3300047323 Ga0495683_0014460 Ga0495683_0014460_196_1257 347
347 3300047443 Ga0495687_000566 Ga0495687_000566_34251_35312 347
348 3300047443 Ga0495687_000603 Ga0495687_000603_30344_31405 347
349 3300047445 Ga0495677_0000448 Ga0495677_0000448_973_2034 347
350 3300047445 Ga0495677_0001444 Ga0495677_0001444_8361_9422 347
351 3300047446 Ga0495679_000296 Ga0495679_000296_30043_31104 347
352 3300047446 Ga0495679_002037 Ga0495679_002037_4156_5217 347
353 3300047447 Ga0495685_000415 Ga0495685_000415_10862_11923 347
354 3300047447 Ga0495685_000442 Ga0495685_000442_1547_2608 347
355 3300047469 Ga0495673_0000061 Ga0495673_0000061_156724_157791 347
356 3300047469 Ga0495673_0000926 Ga0495673_0000926_5409_6470 347
357 3300047469 Ga0495673_0003599 Ga0495673_0003599_3826_4887 347
358 3300047470 Ga0495681_0006711 Ga0495681_0006711_5271_6332 347
359 3300049459 Ga0495678_000009 Ga0495678_000009_100249_101310 347
360 3300049459 Ga0495678_000215 Ga0495678_000215_11797_12858 347
361 3300049459 Ga0495678_000870 Ga0495678_000870_21175_22236 347
362 3300049460 Ga0495682_0005605 Ga0495682_0005605_1479_2540 347
363 3300049515 Ga0501292_005421 Ga0501292_005421_247_1290 347
364 3300049759 Ga0501262_001032 Ga0501262_001032_1420_2463 347
365 3300050492 nmdc:mga0yw44_142853_c1 nmdc:mga0yw44_142853_c1_166_1209 347
366 3300050496 nmdc:mga07m45_85267_c1 nmdc:mga07m45_85267_c1_648_1691 347
367 3300053125 Ga0500618_000173 Ga0500618_000173_39179_40240 347
368 3300053145 Ga0500586_000649 Ga0500586_000649_1233_2294 347
369 3300053145 Ga0500586_040450 Ga0500586_040450_497_1558 347
370 iso_pu_bacteria 2939631187 2939634003 347
371 3300003322 rootL2_10005895 rootL2_100058954 348
372 3300003322 rootL2_10055248 rootL2_100552482 348
373 3300005328 Ga0070676_10008441 Ga0070676_100084414 348
374 3300005331 Ga0070670_100043688 Ga0070670_1000436883 348
375 3300005364 Ga0070673_100186736 Ga0070673_1001867362 348
376 3300005445 Ga0070708_100000270 Ga0070708_10000027011 348
377 3300005456 Ga0070678_100152471 Ga0070678_1001524712 348
378 3300005457 Ga0070662_100160726 Ga0070662_1001607262 348
379 3300005459 Ga0068867_100000186 Ga0068867_10000018630 348
380 3300005459 Ga0068867_100054382 Ga0068867_1000543823 348
381 3300005467 Ga0070706_100017115 Ga0070706_1000171155 348
382 3300005468 Ga0070707_100079498 Ga0070707_1000794982 348
383 3300005617 Ga0068859_100399254 Ga0068859_1003992541 348
384 3300005842 Ga0068858_100088756 Ga0068858_1000887563 348
385 3300005843 Ga0068860_100144946 Ga0068860_1001449462 348
386 3300005843 Ga0068860_100161734 Ga0068860_1001617342 348
387 3300006038 Ga0075365_10051177 Ga0075365_100511772 348
388 3300006042 Ga0075368_10004920 Ga0075368_100049204 348
389 3300006048 Ga0075363_100053398 Ga0075363_1000533982 348
390 3300006058 Ga0075432_10037312 Ga0075432_100373121 348
391 3300006177 Ga0075362_10043390 Ga0075362_100433902 348
392 3300006178 Ga0075367_10055782 Ga0075367_100557822 348
393 3300006186 Ga0075369_10013266 Ga0075369_100132663 348
394 3300006195 Ga0075366_10007761 Ga0075366_100077613 348
395 3300006195 Ga0075366_10020137 Ga0075366_100201372 348
396 3300006195 Ga0075366_10040502 Ga0075366_100405022 348
397 3300006195 Ga0075366_10138912 Ga0075366_101389122 348
398 3300006195 Ga0075366_10242062 Ga0075366_102420621 348
399 3300006353 Ga0075370_10020573 Ga0075370_100205733 348
400 3300006353 Ga0075370_10031064 Ga0075370_100310642 348
401 3300006931 Ga0097620_100399228 Ga0097620_1003992281 348
402 3300009148 Ga0105243_10002791 Ga0105243_100027914 348
403 3300009148 Ga0105243_10015622 Ga0105243_100156222 348
404 3300014326 Ga0157380_10226271 Ga0157380_102262712 348
405 3300014745 Ga0157377_10000464 Ga0157377_100004648 348
406 3300014968 Ga0157379_10047386 Ga0157379_100473864 348
407 3300025907 Ga0207645_10008027 Ga0207645_100080274 348
408 3300025910 Ga0207684_10024199 Ga0207684_100241992 348
409 3300025922 Ga0207646_10015873 Ga0207646_100158732 348
410 3300025933 Ga0207706_10286884 Ga0207706_102868842 348
411 3300025938 Ga0207704_10011058 Ga0207704_100110582 348
412 3300025940 Ga0207691_10019676 Ga0207691_100196763 348
413 3300025940 Ga0207691_10059002 Ga0207691_100590023 348
414 3300025942 Ga0207689_10022127 Ga0207689_100221273 348
415 3300025986 Ga0207658_10032153 Ga0207658_100321532 348
416 3300026023 Ga0207677_10014829 Ga0207677_100148292 348
417 3300026035 Ga0207703_10099688 Ga0207703_100996881 348
418 3300026041 Ga0207639_10104539 Ga0207639_101045392 348
419 3300026089 Ga0207648_10000686 Ga0207648_100006868 348
420 3300026089 Ga0207648_10028615 Ga0207648_100286153 348
421 3300026116 Ga0207674_10252232 Ga0207674_102522322 348
422 3300026121 Ga0207683_10165802 Ga0207683_101658021 348
423 3300028381 Ga0268264_10089095 Ga0268264_100890951 348
424 3300028381 Ga0268264_10119155 Ga0268264_101191552 348
425 3300028786 Ga0307517_10000160 Ga0307517_1000016049 348
426 3300028786 Ga0307517_10000395 Ga0307517_1000039564 348
427 3300028794 Ga0307515_10000006 Ga0307515_10000006466 348
428 3300028794 Ga0307515_10000332 Ga0307515_1000033228 348
429 3300028794 Ga0307515_10000893 Ga0307515_1000089319 348
430 3300028794 Ga0307515_10007639 Ga0307515_1000763914 348
431 3300028794 Ga0307515_10012223 Ga0307515_1001222314 348
432 3300028794 Ga0307515_10014643 Ga0307515_100146433 348
433 3300028794 Ga0307515_10033807 Ga0307515_100338073 348
434 3300030521 Ga0307511_10013142 Ga0307511_100131426 348
435 3300030522 Ga0307512_10034891 Ga0307512_100348913 348
436 3300030522 Ga0307512_10095568 Ga0307512_100955683 348
437 3300031456 Ga0307513_10003528 Ga0307513_100035287 348
438 3300031456 Ga0307513_10020560 Ga0307513_100205608 348
439 3300031456 Ga0307513_10288299 Ga0307513_102882992 348
440 3300031507 Ga0307509_10000212 Ga0307509_1000021240 348
441 3300031507 Ga0307509_10000317 Ga0307509_1000031717 348
442 3300031507 Ga0307509_10001463 Ga0307509_100014637 348
443 3300031507 Ga0307509_10001515 Ga0307509_1000151517 348
444 3300031507 Ga0307509_10005816 Ga0307509_1000581615 348
445 3300031507 Ga0307509_10014784 Ga0307509_100147842 348
446 3300031507 Ga0307509_10133120 Ga0307509_101331203 348
447 3300031507 Ga0307509_10221396 Ga0307509_102213962 348
448 3300031616 Ga0307508_10000097 Ga0307508_1000009742 348
449 3300031616 Ga0307508_10000412 Ga0307508_100004122 348
450 3300031616 Ga0307508_10001697 Ga0307508_1000169715 348
451 3300031616 Ga0307508_10001791 Ga0307508_100017913 348
452 3300031616 Ga0307508_10006375 Ga0307508_100063753 348
453 3300031616 Ga0307508_10058425 Ga0307508_100584253 348
454 3300031649 Ga0307514_10001713 Ga0307514_1000171313 348
455 3300031649 Ga0307514_10033260 Ga0307514_100332602 348
456 3300031649 Ga0307514_10113059 Ga0307514_101130592 348
457 3300031649 Ga0307514_10134731 Ga0307514_101347312 348
458 3300031649 Ga0307514_10205485 Ga0307514_102054851 348
459 3300031730 Ga0307516_10004792 Ga0307516_100047929 348
460 3300031730 Ga0307516_10058559 Ga0307516_100585592 348
461 3300031730 Ga0307516_10115718 Ga0307516_101157182 348
462 3300033179 Ga0307507_10006339 Ga0307507_1000633917 348
463 3300033179 Ga0307507_10026906 Ga0307507_100269064 348
464 3300033179 Ga0307507_10096560 Ga0307507_100965602 348
465 3300033180 Ga0307510_10197873 Ga0307510_101978732 348
466 3300035113 Ga0373936_0007356 Ga0373936_0007356_1245_2312 348
467 3300035113 Ga0373936_0025043 Ga0373936_0025043_503_1570 348
468 3300037068 Ga0373925_0017662 Ga0373925_0017662_933_1991 348
469 3300041410 Ga0439461_0020413 Ga0439461_0020413_151_1224 348
470 3300041997 Ga0439431_0003980 Ga0439431_0003980_906_1979 348
471 3300042134 Ga0450898_002675 Ga0450898_002675_799_1872 348
472 3300042532 Ga0450893_0011593 Ga0450893_0011593_108_1181 348
473 3300044658 Ga0466972_0001573 Ga0466972_0001573_4404_5480 348
474 3300044683 Ga0466965_0008321 Ga0466965_0008321_2111_3187 348
475 3300044706 Ga0466964_0004540 Ga0466964_0004540_2110_3186 348
476 3300044735 Ga0466968_0000892 Ga0466968_0000892_7863_8939 348
477 3300044842 Ga0466957_0008010 Ga0466957_0008010_1415_2491 348
478 3300046454 Ga0495592_0000175 Ga0495592_0000175_17604_18662 348
479 3300046455 Ga0495603_0073101 Ga0495603_0073101_289_1335 348
480 3300046457 Ga0495590_0008483 Ga0495590_0008483_2432_3493 348
481 3300046457 Ga0495590_0009678 Ga0495590_0009678_766_1818 348
482 3300046459 Ga0495629_0203914 Ga0495629_0203914_31_1077 348
483 3300046460 Ga0495638_0084731 Ga0495638_0084731_493_1551 348
484 3300046460 Ga0495638_0166990 Ga0495638_0166990_160_1227 348
485 3300046471 Ga0495650_0000213 Ga0495650_0000213_20505_21560 348
486 3300046474 Ga0495605_0011586 Ga0495605_0011586_1207_2262 348
487 3300046475 Ga0495639_0102142 Ga0495639_0102142_112_1158 348
488 3300046491 Ga0495584_0012011 Ga0495584_0012011_1011_2072 348
489 3300046492 Ga0495585_0019845 Ga0495585_0019845_616_1677 348
490 3300046500 Ga0495596_0000029 Ga0495596_0000029_26642_27703 348
491 3300046500 Ga0495596_0000309 Ga0495596_0000309_8428_9489 348
492 3300046500 Ga0495596_0003951 Ga0495596_0003951_3444_4499 348
493 3300046500 Ga0495596_0006179 Ga0495596_0006179_3134_4195 348
494 3300046500 Ga0495596_0006338 Ga0495596_0006338_3349_4410 348
495 3300046500 Ga0495596_0010016 Ga0495596_0010016_1050_2111 348
496 3300046500 Ga0495596_0010603 Ga0495596_0010603_1049_2110 348
497 3300046501 Ga0495607_0135877 Ga0495607_0135877_176_1237 348
498 3300046506 Ga0495583_0003009 Ga0495583_0003009_9537_10601 348
499 3300046506 Ga0495583_0012173 Ga0495583_0012173_858_2021 348
500 3300046506 Ga0495583_0028223 Ga0495583_0028223_41_1102 348
501 3300046507 Ga0495606_0026449 Ga0495606_0026449_1796_2845 348
502 3300046513 Ga0495616_0000034 Ga0495616_0000034_102343_103404 348
503 3300046513 Ga0495616_0001531 Ga0495616_0001531_13436_14497 348
504 3300046513 Ga0495616_0002129 Ga0495616_0002129_951_2024 348
505 3300046513 Ga0495616_0005494 Ga0495616_0005494_3268_4431 348
506 3300046513 Ga0495616_0008342 Ga0495616_0008342_3544_4605 348
507 3300046513 Ga0495616_0021724 Ga0495616_0021724_2030_3109 348
508 3300046518 Ga0495631_0001648 Ga0495631_0001648_11423_12496 348
509 3300046518 Ga0495631_0004819 Ga0495631_0004819_1238_2299 348
510 3300046519 Ga0495632_0000033 Ga0495632_0000033_92607_93668 348
511 3300046519 Ga0495632_0000086 Ga0495632_0000086_58800_59861 348
512 3300046519 Ga0495632_0000321 Ga0495632_0000321_30750_31829 348
513 3300046519 Ga0495632_0001237 Ga0495632_0001237_10753_11814 348
514 3300046519 Ga0495632_0023864 Ga0495632_0023864_270_1319 348
515 3300046520 Ga0495637_0004655 Ga0495637_0004655_1094_2155 348
516 3300046522 Ga0495643_0006770 Ga0495643_0006770_194_1261 348
517 3300046522 Ga0495643_0018460 Ga0495643_0018460_1511_2572 348
518 3300046522 Ga0495643_0028483 Ga0495643_0028483_610_1671 348
519 3300046522 Ga0495643_0042087 Ga0495643_0042087_1254_2312 348
520 3300046522 Ga0495643_0086518 Ga0495643_0086518_487_1557 348
521 3300046523 Ga0495644_0000030 Ga0495644_0000030_16196_17275 348
522 3300046523 Ga0495644_0014120 Ga0495644_0014120_1260_2333 348
523 3300046523 Ga0495644_0048228 Ga0495644_0048228_133_1179 348
524 3300046524 Ga0495648_0000505 Ga0495648_0000505_11863_12924 348
525 3300046524 Ga0495648_0011019 Ga0495648_0011019_3214_4275 348
526 3300046524 Ga0495648_0013032 Ga0495648_0013032_176_1237 348
527 3300046524 Ga0495648_0027406 Ga0495648_0027406_2722_3783 348
528 3300046524 Ga0495648_0051698 Ga0495648_0051698_42_1103 348
529 3300046524 Ga0495648_0124921 Ga0495648_0124921_144_1205 348
530 3300046528 Ga0495642_0000246 Ga0495642_0000246_28602_29663 348
531 3300046528 Ga0495642_0000273 Ga0495642_0000273_2443_3504 348
532 3300046530 Ga0495654_0001164 Ga0495654_0001164_9969_11030 348
533 3300046530 Ga0495654_0019831 Ga0495654_0019831_853_1914 348
534 3300046538 Ga0495609_0000919 Ga0495609_0000919_2213_3274 348
535 3300046538 Ga0495609_0002275 Ga0495609_0002275_10226_11287 348
536 3300046538 Ga0495609_0037656 Ga0495609_0037656_300_1463 348
537 3300046542 Ga0495597_0000416 Ga0495597_0000416_15075_16124 348
538 3300046542 Ga0495597_0001025 Ga0495597_0001025_11443_12504 348
539 3300046542 Ga0495597_0015801 Ga0495597_0015801_916_1977 348
540 3300046558 Ga0495633_0020492 Ga0495633_0020492_127_1173 348
541 3300046558 Ga0495633_0028096 Ga0495633_0028096_768_1838 348
542 3300046616 Ga0495668_0000669 Ga0495668_0000669_8726_9787 348
543 3300046616 Ga0495668_0019657 Ga0495668_0019657_2244_3305 348
544 3300046648 Ga0495611_0000439 Ga0495611_0000439_11355_12434 348
545 3300046660 Ga0495625_0002865 Ga0495625_0002865_1667_2716 348
546 3300046660 Ga0495625_0010801 Ga0495625_0010801_4746_5804 348
547 3300046660 Ga0495625_0020433 Ga0495625_0020433_3361_4440 348
548 3300046660 Ga0495625_0067179 Ga0495625_0067179_317_1366 348
549 3300046660 Ga0495625_0084932 Ga0495625_0084932_802_1863 348
550 3300046660 Ga0495625_0105403 Ga0495625_0105403_833_1894 348
551 3300046660 Ga0495625_0138899 Ga0495625_0138899_62_1123 348
552 3300046665 Ga0495661_0000170 Ga0495661_0000170_40544_41623 348
553 3300046665 Ga0495661_0000843 Ga0495661_0000843_15162_16223 348
554 3300046665 Ga0495661_0001206 Ga0495661_0001206_8792_9853 348
555 3300046665 Ga0495661_0024792 Ga0495661_0024792_2645_3706 348
556 3300046665 Ga0495661_0029049 Ga0495661_0029049_656_1717 348
557 3300046665 Ga0495661_0074974 Ga0495661_0074974_848_1927 348
558 3300046681 Ga0495647_0000332 Ga0495647_0000332_7071_8117 348
559 3300046683 Ga0495658_0000659 Ga0495658_0000659_17109_18155 348
560 3300046690 Ga0495624_0038828 Ga0495624_0038828_349_1509 348
561 3300046690 Ga0495624_0039178 Ga0495624_0039178_994_2040 348
562 3300046692 Ga0495671_0000131 Ga0495671_0000131_1360_2421 348
563 3300046692 Ga0495671_0014286 Ga0495671_0014286_988_2049 348
564 3300046694 Ga0495649_0000303 Ga0495649_0000303_21122_22183 348
565 3300046694 Ga0495649_0111140 Ga0495649_0111140_139_1212 348
566 3300046794 Ga0495589_0024973 Ga0495589_0024973_575_1636 348
567 3300046794 Ga0495589_0030641 Ga0495589_0030641_1643_2689 348
568 3300046810 Ga0495660_0004863 Ga0495660_0004863_6483_7565 348
569 3300046810 Ga0495660_0053376 Ga0495660_0053376_278_1327 348
570 3300046810 Ga0495660_0087452 Ga0495660_0087452_70_1149 348
571 3300047318 Ga0495636_0014179 Ga0495636_0014179_153_1316 348
572 3300047320 Ga0495672_0000031 Ga0495672_0000031_86775_87845 348
573 3300047320 Ga0495672_0000685 Ga0495672_0000685_12442_13503 348
574 3300047320 Ga0495672_0005983 Ga0495672_0005983_6209_7270 348
575 3300047322 Ga0495680_0054184 Ga0495680_0054184_674_1720 348
576 3300047322 Ga0495680_0213911 Ga0495680_0213911_90_1166 348
577 3300047323 Ga0495683_0022503 Ga0495683_0022503_1021_2082 348
578 3300047443 Ga0495687_000002 Ga0495687_000002_456750_457811 348
579 3300047445 Ga0495677_0000512 Ga0495677_0000512_3216_4295 348
580 3300047445 Ga0495677_0003267 Ga0495677_0003267_3845_4924 348
581 3300047446 Ga0495679_005527 Ga0495679_005527_3426_4487 348
582 3300047446 Ga0495679_009576 Ga0495679_009576_2407_3570 348
583 3300047446 Ga0495679_026550 Ga0495679_026550_544_1605 348
584 3300047447 Ga0495685_002949 Ga0495685_002949_3876_4937 348
585 3300047470 Ga0495681_0000016 Ga0495681_0000016_66165_67226 348
586 3300047470 Ga0495681_0020116 Ga0495681_0020116_2175_3221 348
587 3300047470 Ga0495681_0045609 Ga0495681_0045609_317_1378 348
588 3300047472 Ga0495686_0000464 Ga0495686_0000464_41114_42175 348
589 3300047472 Ga0495686_0078668 Ga0495686_0078668_545_1591 348
590 3300048091 Ga0495626_0004000 Ga0495626_0004000_6951_8012 348
591 3300048091 Ga0495626_0007408 Ga0495626_0007408_4953_6014 348
592 3300048091 Ga0495626_0022599 Ga0495626_0022599_507_1568 348
593 3300048091 Ga0495626_0048228 Ga0495626_0048228_878_1939 348
594 3300049459 Ga0495678_000035 Ga0495678_000035_24645_25706 348
595 3300049459 Ga0495678_013147 Ga0495678_013147_1927_3000 348
596 3300049460 Ga0495682_0001155 Ga0495682_0001155_12959_14020 348
597 3300049460 Ga0495682_0002609 Ga0495682_0002609_4593_5666 348
598 3300049579 Ga0501043_0010569 Ga0501043_0010569_3811_4938 348
599 3300049580 Ga0501046_0012537 Ga0501046_0012537_3810_4937 348
600 3300049581 Ga0501047_0015658 Ga0501047_0015658_2289_3416 348
601 3300049824 Ga0501045_0049558 Ga0501045_0049558_1851_2978 348
602 3300050490 nmdc:mga03n38_5431_c1 nmdc:mga03n38_5431_c1_274_1320 348
603 3300050491 nmdc:mga00v17_67048_c1 nmdc:mga00v17_67048_c1_988_2034 348
604 3300050492 nmdc:mga0yw44_31056_c1 nmdc:mga0yw44_31056_c1_1559_2605 348
605 3300050493 nmdc:mga0k408_13676_c1 nmdc:mga0k408_13676_c1_671_1717 348
606 3300050493 nmdc:mga0k408_1832_c1 nmdc:mga0k408_1832_c1_9213_10295 348
607 3300050493 nmdc:mga0k408_18764_c1 nmdc:mga0k408_18764_c1_726_1772 348
608 3300050493 nmdc:mga0k408_3006_c2 nmdc:mga0k408_3006_c2_5570_6616 348
609 3300050493 nmdc:mga0k408_3937_c1 nmdc:mga0k408_3937_c1_1354_2412 348
610 3300050493 nmdc:mga0k408_57762_c1 nmdc:mga0k408_57762_c1_1182_2231 348
611 3300050496 nmdc:mga07m45_127_c1 nmdc:mga07m45_127_c1_13741_14787 348
612 3300050509 nmdc:mga0qj67_109220_c1 nmdc:mga0qj67_109220_c1_872_1945 348
613 3300050516 nmdc:mga0sz30_43269_c1 nmdc:mga0sz30_43269_c1_189_1235 348
614 3300050516 nmdc:mga0sz30_71771_c1 nmdc:mga0sz30_71771_c1_330_1376 348
615 3300053088 Ga0500644_0010789 Ga0500644_0010789_983_2041 348
616 3300053088 Ga0500644_0093379 Ga0500644_0093379_46_1104 348
617 3300053091 Ga0500647_0128669 Ga0500647_0128669_47_1105 348
618 3300053092 Ga0500583_0032769 Ga0500583_0032769_169_1218 348
619 3300053118 Ga0500594_0015641 Ga0500594_0015641_141_1199 348
620 3300053136 Ga0500559_0005150 Ga0500559_0005150_1731_2789 348
621 3300053154 Ga0500619_009851 Ga0500619_009851_730_1788 348
622 3300053156 Ga0500622_0008524 Ga0500622_0008524_3483_4541 348
623 3300053163 Ga0500639_008998 Ga0500639_008998_2828_3895 348
624 3300053739 Ga0500587_005663 Ga0500587_005663_577_1635 348
625 3300002704 JGI25155J39150_1000062 JGI25155J39150_100006256 349
626 3300002705 JGI25156J39149_1000012 JGI25156J39149_1000012160 349
627 3300002738 JGI25154J39366_1000029 JGI25154J39366_100002911 349
628 3300002741 JGI25157J39369_1000014 JGI25157J39369_1000014160 349
629 3300002774 JGI25150J39212_1006746 JGI25150J39212_10067463 349
630 3300002987 JGI25159J45721_1000054 JGI25159J45721_100005437 349
631 3300003187 JGI25151J46595_10004424 JGI25151J46595_100044247 349
632 3300003354 JGI25160J50197_1000088 JGI25160J50197_100008860 349
633 3300003354 JGI25160J50197_1000119 JGI25160J50197_100011937 349
634 3300003374 JGI25161J50226_1000056 JGI25161J50226_100005637 349
635 3300004625 Ga0055543_1001077 Ga0055543_10010772 349
636 3300006051 Ga0075364_10077336 Ga0075364_100773363 349
637 3300025206 Ga0209435_100002 Ga0209435_100002563 349
638 3300025208 Ga0209436_104201 Ga0209436_1042012 349
639 3300025245 Ga0207425_1009598 Ga0207425_10095982 349
640 3300025246 Ga0209646_1000001 Ga0209646_10000012706 349
641 3300025250 Ga0209026_1000040 Ga0209026_100004069 349
642 3300025256 Ga0209759_1000001 Ga0209759_10000012337 349
643 3300025258 Ga0209129_1014229 Ga0209129_10142292 349
644 3300025263 Ga0209565_1000876 Ga0209565_100087615 349
645 3300025284 Ga0209130_1000040 Ga0209130_100004060 349
646 3300025291 Ga0209675_1000471 Ga0209675_100047118 349
647 3300025294 Ga0209025_1009312 Ga0209025_10093127 349
648 3300025297 Ga0209758_1005216 Ga0209758_10052164 349
649 3300025298 Ga0209050_1001577 Ga0209050_100157712 349
650 3300025302 Ga0207426_1000188 Ga0207426_100018860 349
651 3300053117 Ga0500593_000057 Ga0500593_000057_38286_39335 349

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07883

Cupin_2

Cupin domain

133

203

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
2d40-assembly1.cif.gz_D crystal structure of z3393 from escherichia coli o157:h7 0.9754 38 349
2d40-assembly1.cif.gz_D crystal structure of z3393 from escherichia coli o157:h7 0.9721 38 349
2d40-assembly1.cif.gz_B crystal structure of z3393 from escherichia coli o157:h7 0.9713 41 348
2d40-assembly1.cif.gz_A crystal structure of z3393 from escherichia coli o157:h7 0.9706 40 349
2d40-assembly1.cif.gz_B crystal structure of z3393 from escherichia coli o157:h7 0.9679 41 348
ID Description Score Start End Superfamily
2d40B00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9666 41 348 2.60.120.10
2d40B00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9632 41 348 2.60.120.10
af_Q54FG7_190_474_2.60.120.650 Mainly Beta;Sandwich;Jelly Rolls;Cupin 0.949 263 333 2.60.120.650
3fjsA00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9481 262 333 2.60.120.10
3bu7B00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9412 13 347 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A3S4IJ63-F1-model_v4 Gentisate 1,2-dioxygenase (EC 1.13.11.4) 0.9958 238 349 GO:0047922
AF-A0A251WNB4-F1-model_v4 deleted 0.9954 229 349
AF-A0A1F2T3U1-F1-model_v4 Gentisate 1,2-dioxygenase 0.9932 227 347 GO:0051213
AF-A0A3B9ITW2-F1-model_v4 Gentisate 1,2-dioxygenase 0.993 258 349 GO:0051213
AF-A0A0K2RFM2-F1-model_v4 Cupin type-2 domain-containing protein 0.993 248 348 GO:0051213

Feature Viewer

pLDDT pTM Quality
94.34 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map