F472547

General Info

Members Datasets Scaffolds Average Seq Length
650 229 558 175

Family's Representative Sequence

Representative Sequence 3300046520|Ga0495637_0005095|Ga0495637_0005095_3658_4251
Length 197
Sequence MRLGELIPAPYRLLAKRVLLVVLVGGSAAITWQVQEWRYGSQLAEQSRLHTETLNQITLASAAQQRAEQDKRLALEQRLATSEQTHYRALSDVQRDQGRLRDRLATADLRLSVLLDATTGAGNGSVSATTATGRVVHGPTRAELDPAHAQRIVAITDEGDRGLIALQACQAYVSELGDGFVTKPFPAHVEQSSREQK

Samples

Sample ID Description Type Environment
1 2511231004 Pseudomonas sp. GM102 Isolate Nodule
2 2511231010 Pseudomonas sp. GM25 Isolate Nodule
3 2511231011 Pseudomonas sp. GM30 Isolate Nodule
4 2511231012 Pseudomonas sp. GM33 Isolate Nodule
5 2511231016 Pseudomonas sp. GM50 Isolate Nodule
6 2511231018 Pseudomonas sp. GM60 Isolate Nodule
7 2511231019 Pseudomonas sp. GM67 Isolate Nodule
8 2511231023 Pseudomonas sp. GM80 Isolate Nodule
9 2511231156 Pseudomonas ogarae F113 Isolate Rhizosphere
10 2512047018 Pseudomonas chlororaphis chlororaphis GP72 Isolate Rhizosphere
11 2599185188 Pseudomonas sp. NFACC45 Isolate Rhizoplane
12 2599185306 Pseudomonas sp. NFACC16-2 Isolate Rhizoplane
13 2599185308 Pseudomonas sp. NFACC17-2 Isolate Rhizoplane
14 2599185309 Pseudomonas sp. NFACC49-2 Isolate Rhizoplane
15 2599185310 Pseudomonas sp. NFACC09-4 Isolate Rhizoplane
16 2599185313 Pseudomonas sp. NFACC05-1 Isolate Rhizoplane
17 2599185314 Pseudomonas sp. NFACC23-1 Isolate Rhizoplane
18 2599185317 Pseudomonas sp. NFACC06-1 Isolate Rhizoplane
19 2599185318 Pseudomonas sp. NFACC13-1 Isolate Rhizoplane
20 2599185320 Pseudomonas sp. NFACC36 Isolate Rhizoplane
21 2599185323 Pseudomonas sp. NFACC37-1 Isolate Rhizoplane
22 2600254930 Pseudomonas sp. NFIX10 Isolate Rhizoplane
23 2600254931 Pseudomonas sp. NFIX28 Isolate Rhizoplane
24 2600255318 Pseudomonas putida NFIX47 Isolate Rhizoplane
25 2603880185 Pseudomonas sp. NFIX46 Isolate Rhizoplane
26 2603880199 Pseudomonas sp. NFIX49 Isolate Rhizoplane
27 2623620443 Pseudomonas sp. DR 5-09 Isolate Unclassified
28 2623620446 Pseudomonas sp. GR 6-02 Isolate Unclassified
29 2667528176 Pseudomonas sp. NFACC11-2 Isolate Rhizoplane
30 2675903515 Pseudomonas thivervalensis DSM 13194 Isolate Unclassified
31 2713897149 Pseudomonas fluorescens SF4c Isolate Rhizosphere
32 2718217725 Pseudomonas fluorescens CREA-C16 Isolate Rhizosphere
33 2738543025 Pseudomonas sp. GV091 Isolate Unclassified
34 2740892503 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
35 2744054620 Pseudomonas thivervalensis LMG 21626 Isolate Unclassified
36 2784132063 Pseudomonas sp. 424 Isolate Unclassified
37 2791355520 Pseudomonas sp. s211(2017) Isolate Unclassified
38 2808606361 Pseudomonas sp. SJZ075 Isolate Rhizosphere
39 2808606376 Pseudomonas sp. SJZ074 Isolate Rhizosphere
40 2808606377 Pseudomonas sp. SJZ083 Isolate Rhizosphere
41 2808606378 Pseudomonas sp. SJZ078 Isolate Rhizosphere
42 2808606380 Pseudomonas sp. SJZ085 Isolate Rhizosphere
43 2808606381 Pseudomonas sp. SJZ077 Isolate Rhizosphere
44 2808606382 Pseudomonas sp. SJZ080 Isolate Rhizosphere
45 2808606383 Pseudomonas sp. SJZ124 Isolate Rhizosphere
46 2808606389 Pseudomonas sp. SJZ101 Isolate Rhizosphere
47 2808606445 Pseudomonas sp. SJZ131 Isolate Rhizosphere
48 2818991456 Pseudomonas koreensis 3286 Isolate Rhizosphere
49 2825651385 Pseudomonas brassicacearum L13-6-12 Isolate Rhizosphere
50 2842843487 Pseudomonas sp. R-72074 Isolate Unclassified
51 2860339153 Pseudomonas sp. JAI111 Isolate Rhizosphere
52 2878029506 Pseudomonas fluorescens DR397 Isolate Rhizosphere
53 2880230671 Pseudomonas fluorescens LBUM677 Isolate Unclassified
54 2904518522 Pseudomonas fluorescens 4488 Isolate Rhizosphere
55 2919063839 Pseudomonas pharyngis 1098 Isolate Rhizosphere
56 2919155634 Pseudomonas fulva 1992 Isolate Unclassified
57 2919481497 Pseudomonas brassicacearum 3432 Isolate Unclassified
58 2919697872 Pseudomonas frederiksbergensis 4169 Isolate Unclassified
59 2923153595 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
60 2931396565 Pseudomonas sp. DR48 Isolate Rhizosphere
61 2969304461 Pseudomonas sp. R84 Isolate Rhizosphere
62 2974289157 Pseudomonas fluorescens SORGH_AS 191 Isolate Unclassified
63 3007395558 Pseudomonas chlororaphis PCL1601 Isolate Rhizosphere
64 3007419365 Pseudomonas vanderleydeniana RW8P3 Isolate Unclassified
65 3007718800 Pseudomonas fluorescens BW11P2 Isolate Rhizosphere
66 3007803356 Pseudomonas sp. CM27 Isolate Unclassified
67 3007855910 Pseudomonas khorasanensis SWRI153 Isolate Rhizosphere
68 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
69 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
70 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
71 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
72 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
73 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
74 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
75 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
76 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
77 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
78 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
79 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
80 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
81 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
82 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
83 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
84 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
85 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
86 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
87 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
88 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
89 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
90 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
91 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
92 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
93 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
94 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
95 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
96 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
97 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
98 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
99 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
100 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
101 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
102 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
103 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
104 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
105 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
106 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
107 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
108 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
109 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
110 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
116 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
117 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
118 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
119 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
120 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
121 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
122 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
123 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
124 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
125 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
126 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
127 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
128 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
129 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
130 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
131 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
132 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
133 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
134 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
135 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
136 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
137 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
138 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
139 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
140 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
141 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
142 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
143 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
144 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
145 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
146 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
147 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
148 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
149 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
150 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
151 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
152 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
153 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
154 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
155 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
156 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
157 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
158 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
159 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
160 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
161 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
162 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
163 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
164 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
165 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
166 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
167 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
168 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
169 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
170 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
171 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
172 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
173 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
174 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
175 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
176 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
177 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
178 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
179 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
180 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
181 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
182 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
183 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
184 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
185 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
186 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
187 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
188 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
189 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
190 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
191 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
192 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
193 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
194 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
195 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
196 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
197 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
198 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
199 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
200 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
201 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
202 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
203 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
204 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
205 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
206 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
207 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
208 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
209 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
210 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
211 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
212 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
213 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
214 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
215 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
216 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
217 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
218 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
219 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
220 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
221 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
222 3300053722 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 endosphere Metagenome Endosphere
223 8015687852 Pseudomonas chlororaphis aurantiaca RP4 Isolate Rhizosphere
224 8029995093 Pseudomonas atacamensis SM1 Isolate Rhizosphere
225 8055770955 Pseudomonas chlororaphis qlu-1 Isolate Rhizosphere
226 8056155041 Pseudomonas farris SWRI79 Isolate Rhizosphere
227 8056172158 Pseudomonas ekonensis COR58 Isolate Rhizosphere
228 8056177738 Pseudomonas azerbaijanoccidentalis SWRI74 Isolate Rhizosphere
229 8056569372 Pseudomonas serboccidentalis IT-P374 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 85.85
Metatranscriptomes 0
Isolates 14.15

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.08
Nodule 2
Rhizoplane 4
Rhizosphere 74.92
Stem 0
Stem Tuber 0
Unclassified 14

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25163J39215_1000465 3300002771 Bacteria 12263
2 JGI25164J39214_1000233 3300002772 Bacteria 42959
3 JGI25165J46597_1000429 3300003214 Bacteria 42959
4 Ga0055525_1005857 3300003759 Bacteria 1042
5 Ga0055530_10000588 3300003791 Bacteria 31464
6 Ga0055530_10000829 3300003791 Bacteria 25569
7 Ga0055540_1000609 3300003792 Bacteria 25569
8 Ga0055540_1000983 3300003792 Bacteria 18381
9 Ga0055531_10000458 3300003794 Bacteria 37744
10 Ga0065714_10009781 3300005288 Bacteria 3467
11 Ga0065714_10064861 3300005288 Bacteria 16760
12 Ga0065704_10070431 3300005289 Bacteria 25069
13 Ga0070669_100005428 3300005353 Bacteria 9197
14 Ga0070659_100566258 3300005366 Bacteria 974
15 Ga0070662_100192788 3300005457 Bacteria 1613
16 Ga0075364_10068642 3300006051 Bacteria 2331
17 Ga0075362_10127412 3300006177 Bacteria 1208
18 Ga0079104_1000621 3300006946 Bacteria 34776
19 Ga0099826_10212204 3300006948 Bacteria 1050
20 Ga0105251_10003164 3300009011 Bacteria 12184
21 Ga0105251_10062271 3300009011 Bacteria 1752
22 Ga0105251_10133387 3300009011 Bacteria 1125
23 Ga0105251_10194720 3300009011 Bacteria 913
24 Ga0105244_10005404 3300009036 Bacteria 8501
25 Ga0105244_10006848 3300009036 Bacteria 7320
26 Ga0105244_10032851 3300009036 Bacteria 2742
27 Ga0105244_10111747 3300009036 Bacteria 1329
28 Ga0105244_10116312 3300009036 Bacteria 1298
29 Ga0105250_10000545 3300009092 Bacteria 25795
30 Ga0105250_10005130 3300009092 Bacteria 5917
31 Ga0105246_10000014 3300011119 Bacteria 66861
32 Ga0157373_10002051 3300013100 Bacteria 15261
33 Ga0157373_10002125 3300013100 Bacteria 15004
34 Ga0157373_10002330 3300013100 Bacteria 14406
35 Ga0157373_10066552 3300013100 Bacteria 2549
36 Ga0157373_10269076 3300013100 Bacteria 1206
37 Ga0157371_10004447 3300013102 Bacteria 12230
38 Ga0157371_10004849 3300013102 Bacteria 11568
39 Ga0157371_10011779 3300013102 Bacteria 6716
40 Ga0157371_10661970 3300013102 Bacteria 780
41 Ga0157370_10000626 3300013104 Bacteria 44083
42 Ga0157370_10056224 3300013104 Bacteria 3745
43 Ga0157370_10101551 3300013104 Bacteria 2694
44 Ga0157370_10140171 3300013104 Bacteria 2253
45 Ga0157370_10224285 3300013104 Bacteria 1740
46 Ga0157370_10243185 3300013104 Bacteria 1665
47 Ga0157370_10395007 3300013104 Bacteria 1273
48 Ga0157370_10431004 3300013104 Bacteria 1213
49 Ga0157369_10002861 3300013105 Bacteria 20613
50 Ga0157369_10006159 3300013105 Bacteria 13922
51 Ga0157369_10027046 3300013105 Bacteria 6361
52 Ga0157369_10031878 3300013105 Bacteria 5800
53 Ga0157369_10131102 3300013105 Bacteria 2657
54 Ga0163162_10000917 3300013306 Bacteria 27407
55 Ga0163162_10001313 3300013306 Bacteria 23233
56 Ga0157375_10353791 3300013308 Bacteria 1635
57 Ga0157375_11506367 3300013308 Bacteria 794
58 Ga0182008_10001026 3300014497 Bacteria 19402
59 Ga0182008_10001578 3300014497 Bacteria 15174
60 Ga0182008_10002851 3300014497 Bacteria 10704
61 Ga0182008_10004653 3300014497 Bacteria 7982
62 Ga0182008_10006382 3300014497 Bacteria 6601
63 Ga0182008_10007839 3300014497 Bacteria 5870
64 Ga0182008_10009392 3300014497 Bacteria 5281
65 Ga0182008_10011490 3300014497 Bacteria 4706
66 Ga0182008_10011610 3300014497 Bacteria 4678
67 Ga0182008_10013796 3300014497 Bacteria 4244
68 Ga0182008_10096394 3300014497 Bacteria 1460
69 Ga0182008_10115167 3300014497 Bacteria 1333
70 Ga0182008_10161065 3300014497 Bacteria 1129
71 Ga0182008_10197996 3300014497 Bacteria 1021
72 Ga0182008_10242717 3300014497 Bacteria 927
73 Ga0182006_1004969 3300015261 Bacteria 6414
74 Ga0182006_1005185 3300015261 Bacteria 6249
75 Ga0182006_1064203 3300015261 Bacteria 1377
76 Ga0182007_10002558 3300015262 Bacteria 8953
77 Ga0182005_1000157 3300015265 Bacteria 47479
78 Ga0182005_1000301 3300015265 Bacteria 30196
79 Ga0182005_1000630 3300015265 Bacteria 16828
80 Ga0182005_1001662 3300015265 Bacteria 8639
81 Ga0182005_1007733 3300015265 Bacteria 3208
82 Ga0182005_1082692 3300015265 Bacteria 887
83 Ga0182005_1117543 3300015265 Bacteria 755
84 Ga0163161_10002369 3300017792 Bacteria 13501
85 Ga0209760_100046 3300025207 Bacteria 107840
86 Ga0209563_100213 3300025230 Bacteria 30239
87 Ga0207427_100029 3300025231 Bacteria 376678
88 Ga0209437_100009 3300025233 Bacteria 915954
89 Ga0209759_1017683 3300025256 Bacteria 1747
90 Ga0209233_1000032 3300025261 Bacteria 623596
91 Ga0209675_1002393 3300025291 Bacteria 9681
92 Ga0209675_1003103 3300025291 Bacteria 8112
93 Ga0209676_1000016 3300025292 Bacteria 655561
94 Ga0209676_1000397 3300025292 Bacteria 79463
95 Ga0209676_1004620 3300025292 Bacteria 7584
96 Ga0209676_1020618 3300025292 Bacteria 2233
97 Ga0209050_1000079 3300025298 Bacteria 277803
98 Ga0209050_1000208 3300025298 Bacteria 131310
99 Ga0209050_1012141 3300025298 Bacteria 3989
100 Ga0209050_1019123 3300025298 Bacteria 2620
101 Ga0209051_1000054 3300025303 Bacteria 280804
102 Ga0209051_1000219 3300025303 Bacteria 96484
103 Ga0209051_1008755 3300025303 Bacteria 5314
104 Ga0209257_1000342 3300025304 Bacteria 97045
105 Ga0209257_1007132 3300025304 Bacteria 6874
106 Ga0207696_1000189 3300025711 Bacteria 95393
107 Ga0207696_1001799 3300025711 Bacteria 11065
108 Ga0207655_1001336 3300025728 Bacteria 23242
109 Ga0207655_1001572 3300025728 Bacteria 20529
110 Ga0207655_1006950 3300025728 Bacteria 7418
111 Ga0207655_1008923 3300025728 Bacteria 6294
112 Ga0207655_1023046 3300025728 Bacteria 3100
113 Ga0207655_1062435 3300025728 Bacteria 1432
114 Ga0207713_1000231 3300025735 Bacteria 74756
115 Ga0207713_1000384 3300025735 Bacteria 47943
116 Ga0207713_1000751 3300025735 Bacteria 30209
117 Ga0207713_1002569 3300025735 Bacteria 13108
118 Ga0207713_1003124 3300025735 Bacteria 11487
119 Ga0207713_1007333 3300025735 Bacteria 6532
120 Ga0207713_1018878 3300025735 Bacteria 3396
121 Ga0207713_1033138 3300025735 Bacteria 2260
122 Ga0207681_10006809 3300025923 Bacteria 7008
123 Ga0207706_10071938 3300025933 Bacteria 3042
124 Ga0209281_1000823 3300027111 Bacteria 28032
125 Ga0207428_10018588 3300027907 Bacteria 5933
126 Ga0207428_10208825 3300027907 Bacteria 1467
127 Ga0207428_10814021 3300027907 Bacteria 663
128 Ga0307511_10039462 3300030521 Bacteria 4034
129 Ga0307408_100146877 3300031548 Bacteria 1857
130 Ga0307408_100310536 3300031548 Bacteria 1324
131 Ga0307405_10245782 3300031731 Bacteria 1328
132 Ga0307413_11027976 3300031824 Bacteria 708
133 Ga0307412_10000700 3300031911 Bacteria 19290
134 Ga0307412_10113034 3300031911 Bacteria 1942
135 Ga0307412_10362513 3300031911 Bacteria 1167
136 Ga0307411_10000289 3300032005 Bacteria 16753
137 Ga0307411_10084826 3300032005 Bacteria 2192
138 Ga0237819_01550 3300038705 Bacteria 5813
139 Ga0439438_000068 3300041405 Bacteria 48180
140 Ga0439438_000217 3300041405 Bacteria 26429
141 Ga0439438_000528 3300041405 Bacteria 17362
142 Ga0439438_001073 3300041405 Bacteria 12219
143 Ga0439438_030545 3300041405 Bacteria 1436
144 Ga0439438_045065 3300041405 Bacteria 1135
145 Ga0439447_003230 3300041407 Bacteria 5798
146 Ga0439447_009051 3300041407 Bacteria 3041
147 Ga0439466_0003836 3300041411 Bacteria 5800
148 Ga0439466_0011450 3300041411 Bacteria 3282
149 Ga0439466_0040431 3300041411 Bacteria 1559
150 Ga0439442_014506 3300042002 Bacteria 1622
151 Ga0439445_0004360 3300042004 Bacteria 3204
152 Ga0439432_000058 3300042006 Bacteria 33525
153 Ga0439432_000181 3300042006 Bacteria 22425
154 Ga0439432_000208 3300042006 Bacteria 20892
155 Ga0439432_008831 3300042006 Bacteria 3524
156 Ga0439432_068738 3300042006 Bacteria 1082
157 Ga0439451_000013 3300042009 Bacteria 42803
158 Ga0439451_000036 3300042009 Bacteria 27247
159 Ga0439451_002776 3300042009 Bacteria 3560
160 Ga0439451_008515 3300042009 Bacteria 2080
161 Ga0439452_001135 3300042010 Bacteria 11643
162 Ga0439452_002688 3300042010 Bacteria 6446
163 Ga0439456_000197 3300042013 Bacteria 17192
164 Ga0439456_038431 3300042013 Bacteria 1035
165 Ga0439456_043366 3300042013 Bacteria 978
166 Ga0439463_000741 3300042016 Bacteria 9041
167 Ga0439463_010497 3300042016 Bacteria 2274
168 Ga0439463_014339 3300042016 Bacteria 1953
169 Ga0439463_030015 3300042016 Bacteria 1370
170 Ga0439463_091467 3300042016 Bacteria 783
171 Ga0439463_180947 3300042016 Bacteria 547
172 Ga0450911_002032 3300042115 Bacteria 4180
173 Ga0450900_009484 3300042136 Bacteria 1234
174 Ga0450902_008060 3300042137 Bacteria 1639
175 Ga0450903_019031 3300042138 Bacteria 1066
176 Ga0450905_000005 3300042142 Bacteria 37929
177 Ga0450905_015719 3300042142 Bacteria 1087
178 Ga0450907_012433 3300042146 Bacteria 1417
179 Ga0450908_010040 3300042184 Bacteria 1752
180 Ga0450893_0000405 3300042532 Bacteria 6075
181 Ga0495617_003122 3300046452 Bacteria 6309
182 Ga0495617_003515 3300046452 Bacteria 5869
183 Ga0495617_019541 3300046452 Bacteria 2291
184 Ga0495617_028688 3300046452 Bacteria 1870
185 Ga0495617_038265 3300046452 Bacteria 1605
186 Ga0495617_063730 3300046452 Bacteria 1217
187 Ga0495617_106934 3300046452 Bacteria 906
188 Ga0495627_000369 3300046453 Bacteria 41831
189 Ga0495627_001429 3300046453 Bacteria 14024
190 Ga0495627_001935 3300046453 Bacteria 10789
191 Ga0495627_004239 3300046453 Bacteria 6055
192 Ga0495590_0000110 3300046457 Bacteria 49979
193 Ga0495591_000136 3300046458 Bacteria 79867
194 Ga0495591_000848 3300046458 Bacteria 21496
195 Ga0495591_024824 3300046458 Bacteria 1891
196 Ga0495591_024978 3300046458 Bacteria 1881
197 Ga0495638_0002528 3300046460 Bacteria 14885
198 Ga0495638_0005083 3300046460 Bacteria 9859
199 Ga0495638_0005509 3300046460 Bacteria 9408
200 Ga0495638_0011165 3300046460 Bacteria 6202
201 Ga0495638_0054661 3300046460 Bacteria 2481
202 Ga0495638_0055624 3300046460 Bacteria 2457
203 Ga0495638_0057396 3300046460 Bacteria 2414
204 Ga0495638_0082406 3300046460 Bacteria 1951
205 Ga0495653_0002771 3300046463 Bacteria 13980
206 Ga0495650_0001308 3300046471 Bacteria 25268
207 Ga0495650_0002037 3300046471 Bacteria 17667
208 Ga0495650_0002352 3300046471 Bacteria 15605
209 Ga0495650_0002719 3300046471 Bacteria 13713
210 Ga0495650_0002920 3300046471 Bacteria 12978
211 Ga0495650_0014926 3300046471 Bacteria 4009
212 Ga0495650_0019003 3300046471 Bacteria 3398
213 Ga0495650_0045717 3300046471 Bacteria 1842
214 Ga0495605_0000189 3300046474 Bacteria 76904
215 Ga0495605_0000277 3300046474 Bacteria 57651
216 Ga0495605_0002808 3300046474 Bacteria 10587
217 Ga0495605_0011692 3300046474 Bacteria 4885
218 Ga0495605_0027869 3300046474 Bacteria 2921
219 Ga0495605_0318843 3300046474 Bacteria 655
220 Ga0495639_0003673 3300046475 Bacteria 6607
221 Ga0495584_0000108 3300046491 Bacteria 56594
222 Ga0495584_0000471 3300046491 Bacteria 27636
223 Ga0495584_0005255 3300046491 Bacteria 6862
224 Ga0495584_0063958 3300046491 Bacteria 1850
225 Ga0495584_0083407 3300046491 Bacteria 1609
226 Ga0495584_0084215 3300046491 Bacteria 1601
227 Ga0495584_0321347 3300046491 Bacteria 786
228 Ga0495585_0000144 3300046492 Bacteria 77523
229 Ga0495585_0000317 3300046492 Bacteria 47885
230 Ga0495585_0002676 3300046492 Bacteria 12482
231 Ga0495585_0047913 3300046492 Bacteria 2377
232 Ga0495594_0005645 3300046499 Bacteria 6434
233 Ga0495596_0001348 3300046500 Bacteria 14144
234 Ga0495607_0000255 3300046501 Bacteria 57210
235 Ga0495607_0001021 3300046501 Bacteria 25727
236 Ga0495607_0003782 3300046501 Bacteria 11439
237 Ga0495607_0003857 3300046501 Bacteria 11295
238 Ga0495607_0006989 3300046501 Bacteria 7858
239 Ga0495607_0011832 3300046501 Bacteria 5785
240 Ga0495607_0026745 3300046501 Bacteria 3576
241 Ga0495607_0028574 3300046501 Bacteria 3440
242 Ga0495607_0031645 3300046501 Bacteria 3236
243 Ga0495607_0226152 3300046501 Bacteria 912
244 Ga0495583_0000614 3300046506 Bacteria 48111
245 Ga0495583_0002839 3300046506 Bacteria 14130
246 Ga0495583_0017648 3300046506 Bacteria 3782
247 Ga0495583_0026500 3300046506 Bacteria 2873
248 Ga0495583_0038966 3300046506 Bacteria 2241
249 Ga0495606_0000604 3300046507 Bacteria 56852
250 Ga0495606_0000621 3300046507 Bacteria 55917
251 Ga0495606_0005192 3300046507 Bacteria 12590
252 Ga0495606_0037968 3300046507 Bacteria 3264
253 Ga0495606_0274286 3300046507 Bacteria 925
254 Ga0495606_0395359 3300046507 Bacteria 721
255 Ga0495610_0000722 3300046512 Bacteria 31430
256 Ga0495610_0013527 3300046512 Bacteria 4847
257 Ga0495616_0000275 3300046513 Bacteria 41769
258 Ga0495616_0008540 3300046513 Bacteria 6057
259 Ga0495616_0008880 3300046513 Bacteria 5911
260 Ga0495616_0133794 3300046513 Bacteria 1134
261 Ga0495616_0200498 3300046513 Bacteria 877
262 Ga0495620_0000082 3300046515 Bacteria 78939
263 Ga0495620_0012305 3300046515 Bacteria 4430
264 Ga0495631_0000038 3300046518 Bacteria 80483
265 Ga0495631_0000072 3300046518 Bacteria 64445
266 Ga0495631_0008962 3300046518 Bacteria 5018
267 Ga0495631_0036540 3300046518 Bacteria 2192
268 Ga0495632_0002873 3300046519 Bacteria 12707
269 Ga0495632_0004117 3300046519 Bacteria 10010
270 Ga0495632_0024114 3300046519 Bacteria 3238
271 Ga0495632_0027968 3300046519 Bacteria 2946
272 Ga0495632_0091423 3300046519 Bacteria 1442
273 Ga0495632_0144875 3300046519 Bacteria 1100
274 Ga0495632_0227790 3300046519 Bacteria 841
275 Ga0495637_0000130 3300046520 Bacteria 55897
276 Ga0495637_0000131 3300046520 Bacteria 55720
277 Ga0495637_0001020 3300046520 Bacteria 17613
278 Ga0495637_0002081 3300046520 Bacteria 11257
279 Ga0495637_0002711 3300046520 Bacteria 9648
280 Ga0495637_0002734 3300046520 Bacteria 9602
281 Ga0495637_0005095 3300046520 Bacteria 6741
282 Ga0495637_0008910 3300046520 Bacteria 4910
283 Ga0495637_0016586 3300046520 Bacteria 3441
284 Ga0495643_0000381 3300046522 Bacteria 58799
285 Ga0495643_0000550 3300046522 Bacteria 46413
286 Ga0495643_0001211 3300046522 Bacteria 24989
287 Ga0495643_0032499 3300046522 Bacteria 2896
288 Ga0495643_0096550 3300046522 Bacteria 1519
289 Ga0495643_0135366 3300046522 Bacteria 1233
290 Ga0495644_0000006 3300046523 Bacteria 113088
291 Ga0495644_0004788 3300046523 Bacteria 5317
292 Ga0495648_0000532 3300046524 Bacteria 41042
293 Ga0495648_0002355 3300046524 Bacteria 17545
294 Ga0495648_0002615 3300046524 Bacteria 16440
295 Ga0495648_0011831 3300046524 Bacteria 6545
296 Ga0495648_0018303 3300046524 Bacteria 4967
297 Ga0495648_0048308 3300046524 Bacteria 2621
298 Ga0495648_0130270 3300046524 Bacteria 1338
299 Ga0495648_0305127 3300046524 Bacteria 744
300 Ga0495666_0002135 3300046526 Bacteria 9820
301 Ga0495666_0025973 3300046526 Bacteria 2890
302 Ga0495642_0006597 3300046528 Bacteria 4455
303 Ga0495654_0001825 3300046530 Bacteria 14172
304 Ga0495654_0008183 3300046530 Bacteria 5792
305 Ga0495654_0014046 3300046530 Bacteria 4271
306 Ga0495654_0014303 3300046530 Bacteria 4225
307 Ga0495654_0018872 3300046530 Bacteria 3609
308 Ga0495654_0028662 3300046530 Bacteria 2845
309 Ga0495654_0049249 3300046530 Bacteria 2064
310 Ga0495654_0086506 3300046530 Bacteria 1460
311 Ga0495654_0145035 3300046530 Bacteria 1054
312 Ga0495609_0000242 3300046538 Bacteria 51624
313 Ga0495609_0000278 3300046538 Bacteria 47477
314 Ga0495609_0000698 3300046538 Bacteria 25844
315 Ga0495609_0004822 3300046538 Bacteria 7275
316 Ga0495609_0007268 3300046538 Bacteria 5546
317 Ga0495609_0074670 3300046538 Bacteria 1486
318 Ga0495609_0101754 3300046538 Bacteria 1244
319 Ga0495609_0116531 3300046538 Bacteria 1150
320 Ga0495597_0000194 3300046542 Bacteria 55549
321 Ga0495597_0000599 3300046542 Bacteria 29580
322 Ga0495597_0005315 3300046542 Bacteria 6828
323 Ga0495597_0042676 3300046542 Bacteria 2022
324 Ga0495597_0068570 3300046542 Bacteria 1532
325 Ga0495622_0004368 3300046557 Bacteria 6583
326 Ga0495622_0122023 3300046557 Bacteria 1189
327 Ga0495633_0000241 3300046558 Bacteria 66294
328 Ga0495633_0072868 3300046558 Bacteria 1601
329 Ga0495633_0234138 3300046558 Bacteria 839
330 Ga0495656_0002764 3300046615 Bacteria 5866
331 Ga0495668_0000328 3300046616 Bacteria 64806
332 Ga0495668_0082272 3300046616 Bacteria 1766
333 Ga0495668_0210719 3300046616 Bacteria 1064
334 Ga0495611_0001278 3300046648 Bacteria 12873
335 Ga0495611_0041342 3300046648 Bacteria 2056
336 Ga0495611_0064813 3300046648 Bacteria 1664
337 Ga0495625_0000790 3300046660 Bacteria 43942
338 Ga0495625_0001772 3300046660 Bacteria 24952
339 Ga0495625_0002977 3300046660 Bacteria 17580
340 Ga0495625_0006722 3300046660 Bacteria 10188
341 Ga0495625_0013717 3300046660 Bacteria 6496
342 Ga0495625_0022059 3300046660 Bacteria 4888
343 Ga0495625_0025747 3300046660 Bacteria 4456
344 Ga0495625_0098655 3300046660 Bacteria 2009
345 Ga0495625_0191940 3300046660 Bacteria 1352
346 Ga0495625_0286876 3300046660 Bacteria 1057
347 Ga0495625_0452024 3300046660 Bacteria 793
348 Ga0495659_0001182 3300046664 Bacteria 9064
349 Ga0495659_0001820 3300046664 Bacteria 7072
350 Ga0495659_0003189 3300046664 Bacteria 5253
351 Ga0495659_0003821 3300046664 Bacteria 4787
352 Ga0495661_0007655 3300046665 Bacteria 7526
353 Ga0495661_0022887 3300046665 Bacteria 4061
354 Ga0495661_0025390 3300046665 Bacteria 3827
355 Ga0495661_0062199 3300046665 Bacteria 2212
356 Ga0495669_0000239 3300046684 Bacteria 32132
357 Ga0495669_0020137 3300046684 Bacteria 2884
358 Ga0495669_0041888 3300046684 Bacteria 2034
359 Ga0495669_0089113 3300046684 Bacteria 1422
360 Ga0495613_0000334 3300046689 Bacteria 42527
361 Ga0495624_0000142 3300046690 Bacteria 51675
362 Ga0495670_0000032 3300046691 Bacteria 83433
363 Ga0495670_0000045 3300046691 Bacteria 66604
364 Ga0495670_0004726 3300046691 Bacteria 6688
365 Ga0495670_0016572 3300046691 Bacteria 3623
366 Ga0495670_0030971 3300046691 Bacteria 2657
367 Ga0495670_0252485 3300046691 Bacteria 940
368 Ga0495671_0004272 3300046692 Bacteria 8580
369 Ga0495671_0006330 3300046692 Bacteria 6846
370 Ga0495671_0010571 3300046692 Bacteria 5102
371 Ga0495671_0024176 3300046692 Bacteria 3167
372 Ga0495671_0060010 3300046692 Bacteria 1878
373 Ga0495671_0068903 3300046692 Bacteria 1739
374 Ga0495671_0115990 3300046692 Bacteria 1307
375 Ga0495649_0000155 3300046694 Bacteria 60280
376 Ga0495649_0000273 3300046694 Bacteria 45898
377 Ga0495649_0000484 3300046694 Bacteria 34196
378 Ga0495649_0001131 3300046694 Bacteria 20745
379 Ga0495649_0001227 3300046694 Bacteria 19749
380 Ga0495649_0001607 3300046694 Bacteria 16838
381 Ga0495649_0016840 3300046694 Bacteria 4138
382 Ga0495649_0324831 3300046694 Bacteria 780
383 Ga0495589_0000011 3300046794 Bacteria 250370
384 Ga0495589_0000221 3300046794 Bacteria 48417
385 Ga0495589_0002066 3300046794 Bacteria 11370
386 Ga0495589_0007855 3300046794 Bacteria 5584
387 Ga0495589_0015769 3300046794 Bacteria 3884
388 Ga0495589_0027537 3300046794 Bacteria 2873
389 Ga0495589_0029720 3300046794 Bacteria 2755
390 Ga0495589_0031727 3300046794 Bacteria 2659
391 Ga0495589_0055782 3300046794 Bacteria 1946
392 Ga0495589_0110815 3300046794 Bacteria 1324
393 Ga0495660_0001183 3300046810 Bacteria 18405
394 Ga0495660_0001453 3300046810 Bacteria 16187
395 Ga0495660_0002765 3300046810 Bacteria 11065
396 Ga0495660_0004204 3300046810 Bacteria 8744
397 Ga0495660_0019741 3300046810 Bacteria 3867
398 Ga0495660_0021442 3300046810 Bacteria 3699
399 Ga0495660_0053486 3300046810 Bacteria 2191
400 Ga0495660_0084944 3300046810 Bacteria 1655
401 Ga0495660_0090637 3300046810 Bacteria 1589
402 Ga0495660_0103161 3300046810 Bacteria 1465
403 Ga0495660_0171808 3300046810 Bacteria 1055
404 Ga0495660_0198222 3300046810 Bacteria 960
405 Ga0495604_0003583 3300047317 Bacteria 12373
406 Ga0495636_0013898 3300047318 Bacteria 3198
407 Ga0495636_0019632 3300047318 Bacteria 2718
408 Ga0495674_0000139 3300047319 Bacteria 55581
409 Ga0495672_0000416 3300047320 Bacteria 51489
410 Ga0495672_0001760 3300047320 Bacteria 20879
411 Ga0495672_0003511 3300047320 Bacteria 13363
412 Ga0495672_0004519 3300047320 Bacteria 11351
413 Ga0495672_0004675 3300047320 Bacteria 11091
414 Ga0495672_0005714 3300047320 Bacteria 9792
415 Ga0495672_0009740 3300047320 Bacteria 6926
416 Ga0495672_0055723 3300047320 Bacteria 2305
417 Ga0495672_0072292 3300047320 Bacteria 1948
418 Ga0495672_0093639 3300047320 Bacteria 1645
419 Ga0495683_0000661 3300047323 Bacteria 25500
420 Ga0495683_0001214 3300047323 Bacteria 17559
421 Ga0495683_0001533 3300047323 Bacteria 14980
422 Ga0495683_0003422 3300047323 Bacteria 9261
423 Ga0495683_0004579 3300047323 Bacteria 7810
424 Ga0495683_0038672 3300047323 Bacteria 2415
425 Ga0495683_0238386 3300047323 Bacteria 803
426 Ga0495687_000480 3300047443 Bacteria 48403
427 Ga0495687_001234 3300047443 Bacteria 24422
428 Ga0495687_003686 3300047443 Bacteria 10907
429 Ga0495687_011590 3300047443 Bacteria 4727
430 Ga0495687_156083 3300047443 Bacteria 774
431 Ga0495677_0004508 3300047445 Bacteria 5334
432 Ga0495679_000701 3300047446 Bacteria 21798
433 Ga0495685_163057 3300047447 Bacteria 721
434 Ga0495673_0000405 3300047469 Bacteria 50318
435 Ga0495673_0000894 3300047469 Bacteria 27447
436 Ga0495673_0000945 3300047469 Bacteria 26309
437 Ga0495673_0011845 3300047469 Bacteria 4660
438 Ga0495673_0022241 3300047469 Bacteria 3111
439 Ga0495673_0044954 3300047469 Bacteria 1966
440 Ga0495673_0078919 3300047469 Bacteria 1367
441 Ga0495673_0081238 3300047469 Bacteria 1343
442 Ga0495673_0192361 3300047469 Bacteria 767
443 Ga0495681_0000233 3300047470 Bacteria 46046
444 Ga0495681_0007998 3300047470 Bacteria 6677
445 Ga0495681_0070950 3300047470 Bacteria 1578
446 Ga0495681_0138340 3300047470 Bacteria 1031
447 Ga0495681_0323131 3300047470 Bacteria 592
448 Ga0495686_0251562 3300047472 Bacteria 993
449 Ga0495593_0000011 3300047673 Bacteria 85092
450 Ga0495593_0000027 3300047673 Bacteria 61044
451 Ga0495593_0000074 3300047673 Bacteria 42545
452 Ga0495593_0028242 3300047673 Bacteria 3082
453 Ga0495602_0000177 3300048088 Bacteria 59676
454 Ga0495626_0000208 3300048091 Bacteria 70166
455 Ga0495626_0000460 3300048091 Bacteria 41479
456 Ga0495626_0000610 3300048091 Bacteria 34893
457 Ga0495626_0000846 3300048091 Bacteria 27375
458 Ga0495626_0001049 3300048091 Bacteria 23640
459 Ga0495626_0006673 3300048091 Bacteria 6541
460 Ga0495626_0018026 3300048091 Bacteria 3555
461 Ga0495626_0052854 3300048091 Bacteria 1871
462 Ga0495626_0192722 3300048091 Bacteria 839
463 Ga0496101_0695066 3300048904 Bacteria 803
464 Ga0496105_0058834 3300048908 Bacteria 3172
465 Ga0496106_0007822 3300048909 Bacteria 7910
466 Ga0496107_0070301 3300048910 Bacteria 2541
467 Ga0496112_0321985 3300048915 Bacteria 1490
468 Ga0496116_0000435 3300048919 Bacteria 58557
469 Ga0496116_0000573 3300048919 Bacteria 49181
470 Ga0496116_0000713 3300048919 Bacteria 42646
471 Ga0496116_0002565 3300048919 Bacteria 18966
472 Ga0496116_0002911 3300048919 Bacteria 17487
473 Ga0496116_0023430 3300048919 Bacteria 4597
474 Ga0496116_0158479 3300048919 Bacteria 1245
475 Ga0496116_0279623 3300048919 Bacteria 809
476 Ga0496117_0000604 3300048920 Bacteria 58763
477 Ga0496117_0000924 3300048920 Bacteria 44955
478 Ga0496117_0001037 3300048920 Bacteria 42394
479 Ga0496117_0001163 3300048920 Bacteria 39549
480 Ga0496117_0004158 3300048920 Bacteria 16179
481 Ga0496117_0005048 3300048920 Bacteria 14148
482 Ga0496117_0005142 3300048920 Bacteria 13962
483 Ga0496117_0009622 3300048920 Bacteria 8946
484 Ga0496117_0022849 3300048920 Bacteria 5008
485 Ga0496117_0026642 3300048920 Bacteria 4520
486 Ga0496117_0034539 3300048920 Bacteria 3808
487 Ga0496117_0036704 3300048920 Bacteria 3663
488 Ga0496118_0000293 3300048921 Bacteria 86751
489 Ga0496118_0000613 3300048921 Bacteria 58782
490 Ga0496118_0000965 3300048921 Bacteria 44933
491 Ga0496118_0001045 3300048921 Bacteria 43184
492 Ga0496118_0001081 3300048921 Bacteria 42396
493 Ga0496118_0001201 3300048921 Bacteria 39864
494 Ga0496118_0003782 3300048921 Bacteria 18691
495 Ga0496118_0004709 3300048921 Bacteria 15974
496 Ga0496118_0023820 3300048921 Bacteria 5306
497 Ga0496118_0028168 3300048921 Bacteria 4739
498 Ga0496118_0030008 3300048921 Bacteria 4549
499 Ga0496119_0004487 3300048922 Bacteria 13873
500 Ga0496119_0029290 3300048922 Bacteria 3738
501 Ga0496119_0035491 3300048922 Bacteria 3266
502 Ga0496119_0047944 3300048922 Bacteria 2653
503 Ga0496119_0205217 3300048922 Bacteria 1017
504 Ga0496120_0000911 3300048923 Bacteria 41287
505 Ga0496120_0003616 3300048923 Bacteria 13875
506 Ga0496121_0000623 3300048924 Bacteria 65968
507 Ga0496121_0003753 3300048924 Bacteria 21264
508 Ga0496121_0005834 3300048924 Bacteria 15608
509 Ga0496121_0038231 3300048924 Bacteria 4253
510 Ga0496121_0038294 3300048924 Bacteria 4249
511 Ga0496121_0040896 3300048924 Bacteria 4060
512 Ga0496121_0056778 3300048924 Bacteria 3249
513 Ga0496121_0065642 3300048924 Bacteria 2951
514 Ga0496121_0398437 3300048924 Bacteria 902
515 Ga0496122_0001227 3300048925 Bacteria 43362
516 Ga0496122_0001720 3300048925 Bacteria 33957
517 Ga0496122_0024597 3300048925 Bacteria 5264
518 Ga0496122_0031245 3300048925 Bacteria 4437
519 Ga0496122_0076117 3300048925 Bacteria 2363
520 Ga0496122_0192848 3300048925 Bacteria 1200
521 Ga0496123_0000997 3300048926 Bacteria 43371
522 Ga0496123_0001001 3300048926 Bacteria 43234
523 Ga0496123_0025621 3300048926 Bacteria 4441
524 Ga0496123_0031268 3300048926 Bacteria 3876
525 Ga0496123_0111885 3300048926 Bacteria 1558
526 Ga0496124_0001000 3300048927 Bacteria 44782
527 Ga0496124_0003444 3300048927 Bacteria 19348
528 Ga0496124_0009667 3300048927 Bacteria 9876
529 Ga0496124_0048096 3300048927 Bacteria 3647
530 Ga0496124_0059833 3300048927 Bacteria 3198
531 Ga0496124_0173369 3300048927 Bacteria 1667
532 Ga0496124_0359996 3300048927 Bacteria 1025
533 Ga0496125_0010432 3300048928 Bacteria 9398
534 Ga0496125_0096857 3300048928 Bacteria 2189
535 Ga0495678_000559 3300049459 Bacteria 35715
536 Ga0495678_001025 3300049459 Bacteria 23716
537 Ga0495678_001652 3300049459 Bacteria 16964
538 Ga0495678_002751 3300049459 Bacteria 11538
539 Ga0495678_003117 3300049459 Bacteria 10504
540 Ga0495678_003374 3300049459 Bacteria 9938
541 Ga0495678_005716 3300049459 Bacteria 6764
542 Ga0495678_032489 3300049459 Bacteria 2163
543 Ga0495678_033800 3300049459 Bacteria 2108
544 Ga0495678_073453 3300049459 Bacteria 1247
545 Ga0495678_080724 3300049459 Bacteria 1168
546 Ga0495678_082396 3300049459 Bacteria 1151
547 Ga0495678_102775 3300049459 Bacteria 987
548 Ga0495682_0005373 3300049460 Bacteria 5332
549 Ga0495682_0005866 3300049460 Bacteria 5045
550 Ga0495682_0026374 3300049460 Bacteria 2157
551 Ga0495682_0026897 3300049460 Bacteria 2135
552 Ga0495682_0058840 3300049460 Bacteria 1389
553 Ga0495682_0063633 3300049460 Bacteria 1330
554 Ga0495682_0188085 3300049460 Bacteria 733
555 Ga0501241_000027 3300049758 Bacteria 58612
556 Ga0501241_000107 3300049758 Bacteria 18065
557 Ga0500586_005710 3300053145 Bacteria 3172
558 Ga0500649_058210 3300053722 Bacteria 1615

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009011 Ga0105251_10003164 Ga0105251_100031647 146
2 3300025735 Ga0207713_1003124 Ga0207713_10031247 146
3 3300046616 Ga0495668_0000328 Ga0495668_0000328_54850_55374 146
4 3300048925 Ga0496122_0001227 Ga0496122_0001227_6482_7036 146
5 3300048926 Ga0496123_0000997 Ga0496123_0000997_36336_36890 146
6 3300048928 Ga0496125_0010432 Ga0496125_0010432_6465_7019 146
7 iso_pu_bacteria 2818991456 2819656514 147
8 3300013102 Ga0157371_10011779 Ga0157371_100117792 148
9 3300046460 Ga0495638_0055624 Ga0495638_0055624_769_1281 148
10 3300046691 Ga0495670_0016572 Ga0495670_0016572_1348_1911 150
11 3300048927 Ga0496124_0009667 Ga0496124_0009667_4293_4847 152
12 3300048920 Ga0496117_0004158 Ga0496117_0004158_14190_14744 154
13 3300048921 Ga0496118_0004709 Ga0496118_0004709_11876_12430 154
14 3300025735 Ga0207713_1033138 Ga0207713_10331381 155
15 3300048927 Ga0496124_0003444 Ga0496124_0003444_313_870 155
16 3300046471 Ga0495650_0002719 Ga0495650_0002719_6360_6881 156
17 3300042016 Ga0439463_180947 Ga0439463_180947_40_525 157
18 3300046520 Ga0495637_0002081 Ga0495637_0002081_7722_8204 157
19 3300046526 Ga0495666_0002135 Ga0495666_0002135_6201_6749 157
20 3300042009 Ga0439451_000036 Ga0439451_000036_21424_21900 158
21 3300046453 Ga0495627_000369 Ga0495627_000369_25352_25828 158
22 3300046491 Ga0495584_0321347 Ga0495584_0321347_168_644 158
23 3300046660 Ga0495625_0000790 Ga0495625_0000790_18118_18594 158
24 3300047469 Ga0495673_0000945 Ga0495673_0000945_25349_25825 158
25 3300031911 Ga0307412_10000700 Ga0307412_100007006 159
26 3300046522 Ga0495643_0135366 Ga0495643_0135366_701_1198 159
27 3300005289 Ga0065704_10070431 Ga0065704_100704319 160
28 3300042016 Ga0439463_091467 Ga0439463_091467_34_516 160
29 3300046512 Ga0495610_0013527 Ga0495610_0013527_4198_4734 160
30 3300046664 Ga0495659_0001820 Ga0495659_0001820_1775_2317 160
31 3300046665 Ga0495661_0007655 Ga0495661_0007655_357_899 160
32 3300046691 Ga0495670_0000032 Ga0495670_0000032_50748_51290 160
33 3300046694 Ga0495649_0000484 Ga0495649_0000484_19067_19567 160
34 3300048928 Ga0496125_0096857 Ga0496125_0096857_1018_1578 160
35 3300014497 Ga0182008_10006382 Ga0182008_100063825 161
36 3300015265 Ga0182005_1007733 Ga0182005_10077334 161
37 3300046460 Ga0495638_0005083 Ga0495638_0005083_3366_3899 161
38 3300046501 Ga0495607_0001021 Ga0495607_0001021_19136_19675 161
39 3300046524 Ga0495648_0000532 Ga0495648_0000532_21765_22304 161
40 3300046538 Ga0495609_0000698 Ga0495609_0000698_1963_2502 161
41 3300046660 Ga0495625_0013717 Ga0495625_0013717_821_1312 161
42 3300049460 Ga0495682_0188085 Ga0495682_0188085_229_720 161
43 3300046452 Ga0495617_003122 Ga0495617_003122_5607_6107 162
44 3300046520 Ga0495637_0002734 Ga0495637_0002734_8717_9217 162
45 3300046524 Ga0495648_0011831 Ga0495648_0011831_602_1102 162
46 3300046530 Ga0495654_0086506 Ga0495654_0086506_826_1326 162
47 3300046491 Ga0495584_0083407 Ga0495584_0083407_595_1104 163
48 3300046694 Ga0495649_0001131 Ga0495649_0001131_8467_9009 163
49 3300049459 Ga0495678_003374 Ga0495678_003374_6077_6616 163
50 iso_pu_bacteria 2713897149 2715759464 163
51 iso_pu_bacteria 2919063839 2919064757 163
52 iso_pu_bacteria 2919063839 2919065218 163
53 iso_pu_bacteria 2969304461 2969305340 163
54 iso_pu_bacteria 3007718800 3007720673 163
55 iso_pu_bacteria 8056172158 8056175101 163
56 3300042142 Ga0450905_000005 Ga0450905_000005_1186_1686 164
57 3300046660 Ga0495625_0025747 Ga0495625_0025747_1771_2268 164
58 3300046810 Ga0495660_0001183 Ga0495660_0001183_3236_3733 164
59 iso_pu_bacteria 2511231011 2511296041 164
60 iso_pu_bacteria 2623620443 2624480534 164
61 iso_pu_bacteria 2784132063 2784260278 164
62 iso_pu_bacteria 2784132063 2784263717 164
63 iso_pu_bacteria 2842843487 2842847280 164
64 iso_pu_bacteria 2880230671 2880233252 164
65 iso_pu_bacteria 2974289157 2974292598 164
66 iso_pu_bacteria 3007718800 3007720947 164
67 iso_pu_bacteria 3007855910 3007860364 164
68 iso_pu_bacteria 8056569372 8056574057 164
69 3300013105 Ga0157369_10002861 Ga0157369_1000286121 165
70 3300042016 Ga0439463_000741 Ga0439463_000741_404_901 165
71 3300046460 Ga0495638_0057396 Ga0495638_0057396_520_1062 165
72 3300046506 Ga0495583_0000614 Ga0495583_0000614_13135_13677 165
73 3300046515 Ga0495620_0012305 Ga0495620_0012305_3778_4320 165
74 3300046522 Ga0495643_0001211 Ga0495643_0001211_518_1060 165
75 3300046660 Ga0495625_0001772 Ga0495625_0001772_9961_10503 165
76 3300046692 Ga0495671_0115990 Ga0495671_0115990_545_1087 165
77 3300046810 Ga0495660_0171808 Ga0495660_0171808_266_772 165
78 3300047320 Ga0495672_0055723 Ga0495672_0055723_279_782 165
79 3300047443 Ga0495687_001234 Ga0495687_001234_18837_19340 165
80 3300049460 Ga0495682_0005373 Ga0495682_0005373_855_1367 165
81 iso_pu_bacteria 2599185313 2600007243 165
82 iso_pu_bacteria 2599185323 2600068228 165
83 iso_pu_bacteria 2599185323 2600068935 165
84 iso_pu_bacteria 2808606361 2808856499 165
85 iso_pu_bacteria 2808606376 2808924585 165
86 iso_pu_bacteria 2808606378 2808936353 165
87 iso_pu_bacteria 2808606380 2808946582 165
88 iso_pu_bacteria 2808606383 2808964774 165
89 iso_pu_bacteria 2808606389 2808999666 165
90 3300046474 Ga0495605_0027869 Ga0495605_0027869_265_780 166
91 3300046491 Ga0495584_0063958 Ga0495584_0063958_586_1101 166
92 3300046501 Ga0495607_0031645 Ga0495607_0031645_2093_2608 166
93 3300046506 Ga0495583_0038966 Ga0495583_0038966_1096_1611 166
94 3300046519 Ga0495632_0027968 Ga0495632_0027968_242_745 166
95 3300046542 Ga0495597_0042676 Ga0495597_0042676_1473_1979 166
96 3300046810 Ga0495660_0084944 Ga0495660_0084944_560_1075 166
97 3300047318 Ga0495636_0013898 Ga0495636_0013898_631_1146 166
98 3300047469 Ga0495673_0022241 Ga0495673_0022241_631_1146 166
99 3300048091 Ga0495626_0052854 Ga0495626_0052854_416_931 166
100 3300048919 Ga0496116_0002911 Ga0496116_0002911_320_862 166
101 3300048920 Ga0496117_0001037 Ga0496117_0001037_10559_11101 166
102 3300048921 Ga0496118_0001045 Ga0496118_0001045_10540_11082 166
103 3300049459 Ga0495678_073453 Ga0495678_073453_540_1040 166
104 iso_pu_bacteria 2599185188 2599505117 166
105 iso_pu_bacteria 2599185309 2599982334 166
106 iso_pu_bacteria 2599185317 2600031350 166
107 iso_pu_bacteria 2599185318 2600037450 166
108 iso_pu_bacteria 2600254930 2600361068 166
109 iso_pu_bacteria 2791355520 2794597427 166
110 iso_pu_bacteria 2919155634 2919158481 166
111 iso_pu_bacteria 8056569372 8056569870 166
112 3300009011 Ga0105251_10062271 Ga0105251_100622713 167
113 3300013100 Ga0157373_10002125 Ga0157373_1000212518 167
114 3300014497 Ga0182008_10001578 Ga0182008_100015782 167
115 3300014497 Ga0182008_10011610 Ga0182008_100116103 167
116 3300015261 Ga0182006_1064203 Ga0182006_10642031 167
117 3300046453 Ga0495627_001429 Ga0495627_001429_6308_6817 167
118 3300046458 Ga0495591_000848 Ga0495591_000848_5681_6184 167
119 3300046463 Ga0495653_0002771 Ga0495653_0002771_3108_3629 167
120 3300046558 Ga0495633_0072868 Ga0495633_0072868_27_542 167
121 3300047469 Ga0495673_0192361 Ga0495673_0192361_207_716 167
122 3300047673 Ga0495593_0000027 Ga0495593_0000027_50641_51162 167
123 3300048904 Ga0496101_0695066 Ga0496101_0695066_13_519 167
124 3300048920 Ga0496117_0000604 Ga0496117_0000604_49700_50236 167
125 3300048920 Ga0496117_0022849 Ga0496117_0022849_1720_2235 167
126 3300048920 Ga0496117_0036704 Ga0496117_0036704_87_590 167
127 3300048921 Ga0496118_0000613 Ga0496118_0000613_49700_50236 167
128 3300048921 Ga0496118_0001081 Ga0496118_0001081_34223_34726 167
129 3300048921 Ga0496118_0028168 Ga0496118_0028168_2724_3239 167
130 3300048922 Ga0496119_0047944 Ga0496119_0047944_957_1493 167
131 3300048924 Ga0496121_0038294 Ga0496121_0038294_812_1327 167
132 3300048924 Ga0496121_0056778 Ga0496121_0056778_210_713 167
133 3300048927 Ga0496124_0173369 Ga0496124_0173369_1058_1594 167
134 3300005366 Ga0070659_100566258 Ga0070659_1005662582 168
135 3300011119 Ga0105246_10000014 Ga0105246_1000001450 168
136 3300013100 Ga0157373_10269076 Ga0157373_102690762 168
137 3300013104 Ga0157370_10056224 Ga0157370_100562242 168
138 3300013105 Ga0157369_10027046 Ga0157369_100270468 168
139 3300014497 Ga0182008_10011490 Ga0182008_100114905 168
140 3300015265 Ga0182005_1000630 Ga0182005_100063017 168
141 3300025292 Ga0209676_1000397 Ga0209676_100039764 168
142 3300025298 Ga0209050_1012141 Ga0209050_10121412 168
143 3300025728 Ga0207655_1023046 Ga0207655_10230464 168
144 3300025735 Ga0207713_1018878 Ga0207713_10188782 168
145 3300031548 Ga0307408_100310536 Ga0307408_1003105362 168
146 3300031824 Ga0307413_11027976 Ga0307413_110279761 168
147 3300031911 Ga0307412_10362513 Ga0307412_103625131 168
148 3300042013 Ga0439456_043366 Ga0439456_043366_446_958 168
149 3300042184 Ga0450908_010040 Ga0450908_010040_598_1116 168
150 3300046452 Ga0495617_038265 Ga0495617_038265_636_1142 168
151 3300046460 Ga0495638_0002528 Ga0495638_0002528_2076_2582 168
152 3300046460 Ga0495638_0005509 Ga0495638_0005509_573_1091 168
153 3300046474 Ga0495605_0002808 Ga0495605_0002808_8085_8591 168
154 3300046501 Ga0495607_0000255 Ga0495607_0000255_16863_17375 168
155 3300046501 Ga0495607_0011832 Ga0495607_0011832_1275_1781 168
156 3300046501 Ga0495607_0028574 Ga0495607_0028574_463_969 168
157 3300046513 Ga0495616_0000275 Ga0495616_0000275_34485_34991 168
158 3300046522 Ga0495643_0000381 Ga0495643_0000381_2400_2912 168
159 3300046523 Ga0495644_0000006 Ga0495644_0000006_39382_39888 168
160 3300046524 Ga0495648_0002615 Ga0495648_0002615_1703_2209 168
161 3300046528 Ga0495642_0006597 Ga0495642_0006597_455_1006 168
162 3300046530 Ga0495654_0018872 Ga0495654_0018872_3067_3576 168
163 3300046794 Ga0495589_0002066 Ga0495589_0002066_2395_2901 168
164 3300047323 Ga0495683_0001214 Ga0495683_0001214_2530_3036 168
165 3300047323 Ga0495683_0001533 Ga0495683_0001533_5615_6121 168
166 3300047323 Ga0495683_0238386 Ga0495683_0238386_107_619 168
167 3300047443 Ga0495687_003686 Ga0495687_003686_9481_9987 168
168 3300047446 Ga0495679_000701 Ga0495679_000701_13632_14150 168
169 3300047470 Ga0495681_0323131 Ga0495681_0323131_43_561 168
170 3300048919 Ga0496116_0002565 Ga0496116_0002565_6517_7044 168
171 3300048919 Ga0496116_0023430 Ga0496116_0023430_572_1090 168
172 3300048920 Ga0496117_0009622 Ga0496117_0009622_1674_2201 168
173 3300048920 Ga0496117_0026642 Ga0496117_0026642_478_996 168
174 3300048920 Ga0496117_0034539 Ga0496117_0034539_797_1330 168
175 3300048921 Ga0496118_0030008 Ga0496118_0030008_490_1008 168
176 3300048922 Ga0496119_0004487 Ga0496119_0004487_11719_12246 168
177 3300048922 Ga0496119_0029290 Ga0496119_0029290_664_1203 168
178 3300048923 Ga0496120_0003616 Ga0496120_0003616_1628_2155 168
179 3300048925 Ga0496122_0024597 Ga0496122_0024597_3637_4161 168
180 3300048925 Ga0496122_0076117 Ga0496122_0076117_290_796 168
181 3300048926 Ga0496123_0025621 Ga0496123_0025621_438_956 168
182 3300048927 Ga0496124_0359996 Ga0496124_0359996_26_553 168
183 iso_pu_bacteria 2511231004 2511258160 168
184 iso_pu_bacteria 2511231010 2511290142 168
185 iso_pu_bacteria 2511231016 2511326634 168
186 iso_pu_bacteria 2600255318 2601800248 168
187 iso_pu_bacteria 2603880185 2606074485 168
188 iso_pu_bacteria 2603880199 2606127348 168
189 iso_pu_bacteria 2623620443 2624479001 168
190 iso_pu_bacteria 2623620446 2624494001 168
191 iso_pu_bacteria 2713897149 2715758721 168
192 iso_pu_bacteria 2878029506 2878030959 168
193 iso_pu_bacteria 2919063839 2919064527 168
194 iso_pu_bacteria 8056155041 8056159567 168
195 3300015261 Ga0182006_1005185 Ga0182006_10051854 169
196 3300046530 Ga0495654_0028662 Ga0495654_0028662_1755_2264 169
197 3300048921 Ga0496118_0023820 Ga0496118_0023820_2048_2572 169
198 3300048924 Ga0496121_0065642 Ga0496121_0065642_2155_2679 169
199 3300053145 Ga0500586_005710 Ga0500586_005710_584_1093 169
200 iso_pu_bacteria 3007395558 3007400367 169
201 3300003791 Ga0055530_10000829 Ga0055530_1000082934 170
202 3300003792 Ga0055540_1000609 Ga0055540_100060934 170
203 3300014497 Ga0182008_10161065 Ga0182008_101610652 170
204 3300025292 Ga0209676_1004620 Ga0209676_10046202 170
205 3300025298 Ga0209050_1000079 Ga0209050_100007991 170
206 3300025303 Ga0209051_1000054 Ga0209051_100005494 170
207 3300025304 Ga0209257_1007132 Ga0209257_10071323 170
208 3300041405 Ga0439438_000528 Ga0439438_000528_2010_2528 170
209 3300042004 Ga0439445_0004360 Ga0439445_0004360_186_698 170
210 3300042016 Ga0439463_014339 Ga0439463_014339_172_684 170
211 3300046457 Ga0495590_0000110 Ga0495590_0000110_1370_1885 170
212 3300046491 Ga0495584_0000108 Ga0495584_0000108_25362_25877 170
213 3300046507 Ga0495606_0000604 Ga0495606_0000604_53859_54374 170
214 3300046519 Ga0495632_0144875 Ga0495632_0144875_135_650 170
215 3300046520 Ga0495637_0000130 Ga0495637_0000130_9504_10019 170
216 3300046542 Ga0495597_0005315 Ga0495597_0005315_2718_3233 170
217 3300046794 Ga0495589_0007855 Ga0495589_0007855_3469_3981 170
218 3300047320 Ga0495672_0093639 Ga0495672_0093639_104_619 170
219 iso_pu_bacteria 3007803356 3007803385 170
220 3300013104 Ga0157370_10395007 Ga0157370_103950072 171
221 3300042009 Ga0439451_002776 Ga0439451_002776_1029_1577 171
222 3300048919 Ga0496116_0279623 Ga0496116_0279623_273_794 171
223 3300048920 Ga0496117_0001163 Ga0496117_0001163_24894_25415 171
224 3300048921 Ga0496118_0000293 Ga0496118_0000293_14105_14626 171
225 iso_pu_bacteria 2919697872 2919703041 171
226 3300003791 Ga0055530_10000588 Ga0055530_100005882 172
227 3300003792 Ga0055540_1000983 Ga0055540_10009832 172
228 3300003794 Ga0055531_10000458 Ga0055531_1000045826 172
229 3300005288 Ga0065714_10009781 Ga0065714_100097815 172
230 3300005353 Ga0070669_100005428 Ga0070669_1000054282 172
231 3300006051 Ga0075364_10068642 Ga0075364_100686424 172
232 3300006177 Ga0075362_10127412 Ga0075362_101274122 172
233 3300009011 Ga0105251_10133387 Ga0105251_101333872 172
234 3300009011 Ga0105251_10194720 Ga0105251_101947201 172
235 3300009036 Ga0105244_10116312 Ga0105244_101163122 172
236 3300009092 Ga0105250_10005130 Ga0105250_100051302 172
237 3300013105 Ga0157369_10006159 Ga0157369_100061591 172
238 3300015262 Ga0182007_10002558 Ga0182007_100025582 172
239 3300025291 Ga0209675_1003103 Ga0209675_10031034 172
240 3300025292 Ga0209676_1000016 Ga0209676_1000016122 172
241 3300025298 Ga0209050_1000208 Ga0209050_10002082 172
242 3300025303 Ga0209051_1000219 Ga0209051_100021969 172
243 3300025304 Ga0209257_1000342 Ga0209257_100034234 172
244 3300025711 Ga0207696_1001799 Ga0207696_100179914 172
245 3300025728 Ga0207655_1008923 Ga0207655_10089239 172
246 3300025735 Ga0207713_1002569 Ga0207713_100256916 172
247 3300025735 Ga0207713_1007333 Ga0207713_10073336 172
248 3300025923 Ga0207681_10006809 Ga0207681_1000680910 172
249 3300027907 Ga0207428_10018588 Ga0207428_100185882 172
250 3300041407 Ga0439447_003230 Ga0439447_003230_4722_5240 172
251 3300042009 Ga0439451_008515 Ga0439451_008515_964_1482 172
252 3300046474 Ga0495605_0011692 Ga0495605_0011692_465_983 172
253 3300046475 Ga0495639_0003673 Ga0495639_0003673_686_1204 172
254 3300046491 Ga0495584_0005255 Ga0495584_0005255_655_1173 172
255 3300046499 Ga0495594_0005645 Ga0495594_0005645_648_1166 172
256 3300046518 Ga0495631_0008962 Ga0495631_0008962_4358_4876 172
257 3300046519 Ga0495632_0002873 Ga0495632_0002873_2022_2561 172
258 3300046520 Ga0495637_0002711 Ga0495637_0002711_638_1156 172
259 3300046522 Ga0495643_0096550 Ga0495643_0096550_920_1459 172
260 3300046524 Ga0495648_0048308 Ga0495648_0048308_169_687 172
261 3300046526 Ga0495666_0025973 Ga0495666_0025973_1790_2308 172
262 3300046538 Ga0495609_0004822 Ga0495609_0004822_6008_6547 172
263 3300046538 Ga0495609_0116531 Ga0495609_0116531_63_581 172
264 3300046557 Ga0495622_0004368 Ga0495622_0004368_5399_5917 172
265 3300046660 Ga0495625_0098655 Ga0495625_0098655_203_721 172
266 3300046664 Ga0495659_0001182 Ga0495659_0001182_7852_8370 172
267 3300046664 Ga0495659_0003189 Ga0495659_0003189_4575_5093 172
268 3300046665 Ga0495661_0025390 Ga0495661_0025390_382_900 172
269 3300046684 Ga0495669_0000239 Ga0495669_0000239_30839_31378 172
270 3300046691 Ga0495670_0004726 Ga0495670_0004726_541_1059 172
271 3300046691 Ga0495670_0030971 Ga0495670_0030971_1710_2231 172
272 3300046692 Ga0495671_0006330 Ga0495671_0006330_671_1189 172
273 3300046694 Ga0495649_0016840 Ga0495649_0016840_2940_3458 172
274 3300046794 Ga0495589_0015769 Ga0495589_0015769_3058_3576 172
275 3300046810 Ga0495660_0002765 Ga0495660_0002765_9795_10334 172
276 3300046810 Ga0495660_0053486 Ga0495660_0053486_304_822 172
277 3300047320 Ga0495672_0005714 Ga0495672_0005714_8603_9121 172
278 3300047323 Ga0495683_0003422 Ga0495683_0003422_542_1060 172
279 3300047323 Ga0495683_0004579 Ga0495683_0004579_475_993 172
280 3300047443 Ga0495687_011590 Ga0495687_011590_3908_4426 172
281 3300047470 Ga0495681_0138340 Ga0495681_0138340_88_606 172
282 3300047673 Ga0495593_0028242 Ga0495593_0028242_639_1157 172
283 3300048091 Ga0495626_0006673 Ga0495626_0006673_362_880 172
284 3300048908 Ga0496105_0058834 Ga0496105_0058834_546_1064 172
285 3300048910 Ga0496107_0070301 Ga0496107_0070301_202_720 172
286 3300048919 Ga0496116_0158479 Ga0496116_0158479_57_575 172
287 3300048925 Ga0496122_0031245 Ga0496122_0031245_653_1171 172
288 3300048926 Ga0496123_0031268 Ga0496123_0031268_2720_3238 172
289 3300049459 Ga0495678_005716 Ga0495678_005716_5686_6204 172
290 3300049460 Ga0495682_0005866 Ga0495682_0005866_433_951 172
291 3300049460 Ga0495682_0058840 Ga0495682_0058840_413_952 172
292 3300014497 Ga0182008_10096394 Ga0182008_100963943 173
293 3300041405 Ga0439438_000217 Ga0439438_000217_9886_10428 173
294 3300048091 Ga0495626_0000208 Ga0495626_0000208_50524_51060 173
295 iso_pu_bacteria 2825651385 2825652796 173
296 iso_pu_bacteria 2511231018 2511338083 174
297 iso_pu_bacteria 2511231018 2511338860 174
298 iso_pu_bacteria 2511231019 2511341859 174
299 iso_pu_bacteria 2511231019 2511343939 174
300 iso_pu_bacteria 2511231023 2511372053 174
301 iso_pu_bacteria 2511231156 2511826276 174
302 iso_pu_bacteria 2512047018 2512326299 174
303 iso_pu_bacteria 2599185306 2599966153 174
304 iso_pu_bacteria 2599185306 2599969194 174
305 iso_pu_bacteria 2599185308 2599976887 174
306 iso_pu_bacteria 2599185308 2599978233 174
307 iso_pu_bacteria 2599185310 2599989476 174
308 iso_pu_bacteria 2599185314 2600011056 174
309 iso_pu_bacteria 2599185314 2600012297 174
310 iso_pu_bacteria 2599185320 2600048437 174
311 iso_pu_bacteria 2600254931 2600362613 174
312 iso_pu_bacteria 2667528176 2671126259 174
313 iso_pu_bacteria 2675903515 2678264621 174
314 iso_pu_bacteria 2718217725 2718633406 174
315 iso_pu_bacteria 2718217725 2718634958 174
316 iso_pu_bacteria 2738543025 2739313854 174
317 iso_pu_bacteria 2740892503 2743735839 174
318 iso_pu_bacteria 2744054620 2745005075 174
319 iso_pu_bacteria 2808606377 2808929463 174
320 iso_pu_bacteria 2808606381 2808951429 174
321 iso_pu_bacteria 2808606382 2808957953 174
322 iso_pu_bacteria 2808606445 2809215940 174
323 iso_pu_bacteria 2818991456 2819656395 174
324 iso_pu_bacteria 2842843487 2842844443 174
325 iso_pu_bacteria 2860339153 2860340491 174
326 iso_pu_bacteria 2878029506 2878031214 174
327 iso_pu_bacteria 2904518522 2904522828 174
328 iso_pu_bacteria 2919481497 2919486146 174
329 iso_pu_bacteria 2919697872 2919701092 174
330 iso_pu_bacteria 2923153595 2923154848 174
331 iso_pu_bacteria 2931396565 2931399606 174
332 iso_pu_bacteria 3007419365 3007421715 174
333 iso_pu_bacteria 8015687852 8015689078 174
334 iso_pu_bacteria 8029995093 8029998964 174
335 iso_pu_bacteria 8055770955 8055772197 174
336 iso_pu_bacteria 8056177738 8056181316 174
337 3300014497 Ga0182008_10007839 Ga0182008_100078392 175
338 3300046453 Ga0495627_004239 Ga0495627_004239_605_1132 175
339 3300046460 Ga0495638_0011165 Ga0495638_0011165_598_1125 175
340 3300046660 Ga0495625_0022059 Ga0495625_0022059_346_873 175
341 3300048922 Ga0496119_0205217 Ga0496119_0205217_408_935 175
342 3300014497 Ga0182008_10242717 Ga0182008_102427172 176
343 3300046507 Ga0495606_0000621 Ga0495606_0000621_53128_53658 176
344 3300046520 Ga0495637_0001020 Ga0495637_0001020_8727_9269 176
345 3300046538 Ga0495609_0000242 Ga0495609_0000242_48844_49374 176
346 3300046691 Ga0495670_0000045 Ga0495670_0000045_63801_64331 176
347 3300046794 Ga0495589_0000011 Ga0495589_0000011_247558_248088 176
348 3300046810 Ga0495660_0019741 Ga0495660_0019741_2261_2791 176
349 3300047470 Ga0495681_0070950 Ga0495681_0070950_885_1415 176
350 3300049459 Ga0495678_032489 Ga0495678_032489_163_699 176
351 3300009036 Ga0105244_10006848 Ga0105244_100068485 177
352 3300013100 Ga0157373_10002330 Ga0157373_1000233017 177
353 3300025728 Ga0207655_1006950 Ga0207655_10069505 177
354 3300042006 Ga0439432_000058 Ga0439432_000058_10900_11439 177
355 3300046452 Ga0495617_003515 Ga0495617_003515_5099_5638 177
356 3300046471 Ga0495650_0014926 Ga0495650_0014926_3358_3897 177
357 3300046492 Ga0495585_0000317 Ga0495585_0000317_4604_5194 177
358 3300046501 Ga0495607_0026745 Ga0495607_0026745_590_1180 177
359 3300046513 Ga0495616_0008540 Ga0495616_0008540_1287_1826 177
360 3300046538 Ga0495609_0074670 Ga0495609_0074670_128_667 177
361 3300046648 Ga0495611_0001278 Ga0495611_0001278_1562_2152 177
362 3300046648 Ga0495611_0041342 Ga0495611_0041342_539_1072 177
363 3300046684 Ga0495669_0041888 Ga0495669_0041888_740_1279 177
364 3300046689 Ga0495613_0000334 Ga0495613_0000334_9902_10441 177
365 3300046692 Ga0495671_0060010 Ga0495671_0060010_977_1516 177
366 3300046694 Ga0495649_0000273 Ga0495649_0000273_32935_33474 177
367 3300047470 Ga0495681_0000233 Ga0495681_0000233_41913_42446 177
368 3300048091 Ga0495626_0000846 Ga0495626_0000846_13829_14368 177
369 3300049459 Ga0495678_001025 Ga0495678_001025_696_1235 177
370 3300049460 Ga0495682_0063633 Ga0495682_0063633_765_1304 177
371 3300053722 Ga0500649_058210 Ga0500649_058210_596_1186 177
372 3300002771 JGI25163J39215_1000465 JGI25163J39215_100046515 178
373 3300002772 JGI25164J39214_1000233 JGI25164J39214_10002332 178
374 3300003214 JGI25165J46597_1000429 JGI25165J46597_100042949 178
375 3300003759 Ga0055525_1005857 Ga0055525_10058572 178
376 3300005288 Ga0065714_10064861 Ga0065714_1006486112 178
377 3300005457 Ga0070662_100192788 Ga0070662_1001927882 178
378 3300006946 Ga0079104_1000621 Ga0079104_10006214 178
379 3300006948 Ga0099826_10212204 Ga0099826_102122042 178
380 3300009036 Ga0105244_10005404 Ga0105244_100054046 178
381 3300009036 Ga0105244_10032851 Ga0105244_100328511 178
382 3300009036 Ga0105244_10111747 Ga0105244_101117472 178
383 3300009092 Ga0105250_10000545 Ga0105250_1000054511 178
384 3300013100 Ga0157373_10002051 Ga0157373_1000205119 178
385 3300013100 Ga0157373_10066552 Ga0157373_100665521 178
386 3300013102 Ga0157371_10004447 Ga0157371_1000444711 178
387 3300013102 Ga0157371_10004849 Ga0157371_100048498 178
388 3300013102 Ga0157371_10661970 Ga0157371_106619702 178
389 3300013104 Ga0157370_10000626 Ga0157370_1000062650 178
390 3300013104 Ga0157370_10101551 Ga0157370_101015511 178
391 3300013104 Ga0157370_10140171 Ga0157370_101401712 178
392 3300013104 Ga0157370_10224285 Ga0157370_102242852 178
393 3300013104 Ga0157370_10243185 Ga0157370_102431852 178
394 3300013104 Ga0157370_10431004 Ga0157370_104310042 178
395 3300013105 Ga0157369_10031878 Ga0157369_100318784 178
396 3300013105 Ga0157369_10131102 Ga0157369_101311021 178
397 3300013306 Ga0163162_10000917 Ga0163162_1000091732 178
398 3300013306 Ga0163162_10001313 Ga0163162_1000131312 178
399 3300013308 Ga0157375_10353791 Ga0157375_103537913 178
400 3300013308 Ga0157375_11506367 Ga0157375_115063671 178
401 3300014497 Ga0182008_10001026 Ga0182008_100010266 178
402 3300014497 Ga0182008_10002851 Ga0182008_1000285111 178
403 3300014497 Ga0182008_10004653 Ga0182008_100046539 178
404 3300014497 Ga0182008_10009392 Ga0182008_100093926 178
405 3300014497 Ga0182008_10013796 Ga0182008_100137962 178
406 3300014497 Ga0182008_10115167 Ga0182008_101151672 178
407 3300014497 Ga0182008_10197996 Ga0182008_101979962 178
408 3300015261 Ga0182006_1004969 Ga0182006_10049696 178
409 3300015265 Ga0182005_1000157 Ga0182005_100015755 178
410 3300015265 Ga0182005_1000301 Ga0182005_100030128 178
411 3300015265 Ga0182005_1001662 Ga0182005_10016624 178
412 3300015265 Ga0182005_1082692 Ga0182005_10826921 178
413 3300015265 Ga0182005_1117543 Ga0182005_11175432 178
414 3300017792 Ga0163161_10002369 Ga0163161_1000236919 178
415 3300025207 Ga0209760_100046 Ga0209760_10004621 178
416 3300025230 Ga0209563_100213 Ga0209563_1002132 178
417 3300025231 Ga0207427_100029 Ga0207427_100029284 178
418 3300025233 Ga0209437_100009 Ga0209437_100009539 178
419 3300025256 Ga0209759_1017683 Ga0209759_10176831 178
420 3300025261 Ga0209233_1000032 Ga0209233_1000032539 178
421 3300025291 Ga0209675_1002393 Ga0209675_100239312 178
422 3300025292 Ga0209676_1020618 Ga0209676_10206183 178
423 3300025298 Ga0209050_1019123 Ga0209050_10191233 178
424 3300025303 Ga0209051_1008755 Ga0209051_10087556 178
425 3300025711 Ga0207696_1000189 Ga0207696_100018973 178
426 3300025728 Ga0207655_1001336 Ga0207655_100133615 178
427 3300025728 Ga0207655_1001572 Ga0207655_10015728 178
428 3300025728 Ga0207655_1062435 Ga0207655_10624352 178
429 3300025735 Ga0207713_1000231 Ga0207713_100023150 178
430 3300025735 Ga0207713_1000384 Ga0207713_100038448 178
431 3300025735 Ga0207713_1000751 Ga0207713_100075134 178
432 3300025933 Ga0207706_10071938 Ga0207706_100719382 178
433 3300027111 Ga0209281_1000823 Ga0209281_10008235 178
434 3300027907 Ga0207428_10208825 Ga0207428_102088252 178
435 3300027907 Ga0207428_10814021 Ga0207428_108140212 178
436 3300030521 Ga0307511_10039462 Ga0307511_100394623 178
437 3300031548 Ga0307408_100146877 Ga0307408_1001468772 178
438 3300031731 Ga0307405_10245782 Ga0307405_102457821 178
439 3300031911 Ga0307412_10113034 Ga0307412_101130342 178
440 3300032005 Ga0307411_10000289 Ga0307411_1000028916 178
441 3300032005 Ga0307411_10084826 Ga0307411_100848262 178
442 3300038705 Ga0237819_01550 Ga0237819_01550_1518_2060 178
443 3300041405 Ga0439438_000068 Ga0439438_000068_9733_10269 178
444 3300041405 Ga0439438_001073 Ga0439438_001073_2732_3286 178
445 3300041405 Ga0439438_030545 Ga0439438_030545_203_745 178
446 3300041405 Ga0439438_045065 Ga0439438_045065_194_730 178
447 3300041407 Ga0439447_009051 Ga0439447_009051_203_745 178
448 3300041411 Ga0439466_0003836 Ga0439466_0003836_559_1095 178
449 3300041411 Ga0439466_0011450 Ga0439466_0011450_1681_2223 178
450 3300041411 Ga0439466_0040431 Ga0439466_0040431_434_970 178
451 3300042002 Ga0439442_014506 Ga0439442_014506_693_1235 178
452 3300042006 Ga0439432_000181 Ga0439432_000181_12467_13009 178
453 3300042006 Ga0439432_000208 Ga0439432_000208_6186_6728 178
454 3300042006 Ga0439432_008831 Ga0439432_008831_1928_2470 178
455 3300042006 Ga0439432_068738 Ga0439432_068738_440_982 178
456 3300042009 Ga0439451_000013 Ga0439451_000013_6241_6783 178
457 3300042010 Ga0439452_001135 Ga0439452_001135_2518_3072 178
458 3300042010 Ga0439452_002688 Ga0439452_002688_5243_5779 178
459 3300042013 Ga0439456_000197 Ga0439456_000197_14910_15458 178
460 3300042013 Ga0439456_038431 Ga0439456_038431_163_699 178
461 3300042016 Ga0439463_010497 Ga0439463_010497_1688_2224 178
462 3300042016 Ga0439463_030015 Ga0439463_030015_567_1109 178
463 3300042115 Ga0450911_002032 Ga0450911_002032_2947_3483 178
464 3300042136 Ga0450900_009484 Ga0450900_009484_660_1199 178
465 3300042137 Ga0450902_008060 Ga0450902_008060_500_1036 178
466 3300042138 Ga0450903_019031 Ga0450903_019031_58_600 178
467 3300042142 Ga0450905_015719 Ga0450905_015719_218_754 178
468 3300042146 Ga0450907_012433 Ga0450907_012433_68_604 178
469 3300042532 Ga0450893_0000405 Ga0450893_0000405_5065_5607 178
470 3300046452 Ga0495617_019541 Ga0495617_019541_165_707 178
471 3300046452 Ga0495617_028688 Ga0495617_028688_887_1423 178
472 3300046452 Ga0495617_063730 Ga0495617_063730_373_915 178
473 3300046452 Ga0495617_106934 Ga0495617_106934_137_679 178
474 3300046453 Ga0495627_001935 Ga0495627_001935_9161_9703 178
475 3300046458 Ga0495591_000136 Ga0495591_000136_28559_29101 178
476 3300046458 Ga0495591_024824 Ga0495591_024824_956_1492 178
477 3300046458 Ga0495591_024978 Ga0495591_024978_456_998 178
478 3300046460 Ga0495638_0054661 Ga0495638_0054661_620_1156 178
479 3300046460 Ga0495638_0082406 Ga0495638_0082406_1223_1759 178
480 3300046471 Ga0495650_0001308 Ga0495650_0001308_4283_4837 178
481 3300046471 Ga0495650_0002037 Ga0495650_0002037_2770_3312 178
482 3300046471 Ga0495650_0002352 Ga0495650_0002352_2812_3354 178
483 3300046471 Ga0495650_0002920 Ga0495650_0002920_12318_12857 178
484 3300046471 Ga0495650_0019003 Ga0495650_0019003_330_872 178
485 3300046471 Ga0495650_0045717 Ga0495650_0045717_641_1177 178
486 3300046474 Ga0495605_0000189 Ga0495605_0000189_39538_40080 178
487 3300046474 Ga0495605_0000277 Ga0495605_0000277_37700_38242 178
488 3300046474 Ga0495605_0318843 Ga0495605_0318843_40_582 178
489 3300046491 Ga0495584_0000471 Ga0495584_0000471_17308_17847 178
490 3300046491 Ga0495584_0084215 Ga0495584_0084215_33_575 178
491 3300046492 Ga0495585_0000144 Ga0495585_0000144_30952_31494 178
492 3300046492 Ga0495585_0002676 Ga0495585_0002676_1718_2260 178
493 3300046492 Ga0495585_0047913 Ga0495585_0047913_694_1230 178
494 3300046500 Ga0495596_0001348 Ga0495596_0001348_4282_4824 178
495 3300046501 Ga0495607_0003782 Ga0495607_0003782_9884_10426 178
496 3300046501 Ga0495607_0003857 Ga0495607_0003857_10679_11221 178
497 3300046501 Ga0495607_0006989 Ga0495607_0006989_4425_4967 178
498 3300046501 Ga0495607_0226152 Ga0495607_0226152_345_887 178
499 3300046506 Ga0495583_0002839 Ga0495583_0002839_4484_5026 178
500 3300046506 Ga0495583_0017648 Ga0495583_0017648_2313_2876 178
501 3300046506 Ga0495583_0026500 Ga0495583_0026500_685_1221 178
502 3300046507 Ga0495606_0005192 Ga0495606_0005192_9540_10082 178
503 3300046507 Ga0495606_0037968 Ga0495606_0037968_1617_2159 178
504 3300046507 Ga0495606_0274286 Ga0495606_0274286_204_740 178
505 3300046507 Ga0495606_0395359 Ga0495606_0395359_35_577 178
506 3300046512 Ga0495610_0000722 Ga0495610_0000722_4484_5026 178
507 3300046513 Ga0495616_0008880 Ga0495616_0008880_668_1204 178
508 3300046513 Ga0495616_0133794 Ga0495616_0133794_159_701 178
509 3300046513 Ga0495616_0200498 Ga0495616_0200498_42_584 178
510 3300046515 Ga0495620_0000082 Ga0495620_0000082_33239_33778 178
511 3300046518 Ga0495631_0000038 Ga0495631_0000038_41185_41727 178
512 3300046518 Ga0495631_0000072 Ga0495631_0000072_36723_37265 178
513 3300046518 Ga0495631_0036540 Ga0495631_0036540_1037_1573 178
514 3300046519 Ga0495632_0004117 Ga0495632_0004117_8804_9340 178
515 3300046519 Ga0495632_0024114 Ga0495632_0024114_681_1223 178
516 3300046519 Ga0495632_0091423 Ga0495632_0091423_257_799 178
517 3300046519 Ga0495632_0227790 Ga0495632_0227790_288_830 178
518 3300046520 Ga0495637_0000131 Ga0495637_0000131_34089_34631 178
519 3300046520 Ga0495637_0005095 Ga0495637_0005095_3658_4251 178
520 3300046520 Ga0495637_0008910 Ga0495637_0008910_663_1199 178
521 3300046520 Ga0495637_0016586 Ga0495637_0016586_1390_1932 178
522 3300046522 Ga0495643_0000550 Ga0495643_0000550_10043_10585 178
523 3300046522 Ga0495643_0032499 Ga0495643_0032499_1674_2210 178
524 3300046523 Ga0495644_0004788 Ga0495644_0004788_542_1078 178
525 3300046524 Ga0495648_0002355 Ga0495648_0002355_545_1087 178
526 3300046524 Ga0495648_0018303 Ga0495648_0018303_290_826 178
527 3300046524 Ga0495648_0130270 Ga0495648_0130270_545_1087 178
528 3300046524 Ga0495648_0305127 Ga0495648_0305127_70_612 178
529 3300046530 Ga0495654_0001825 Ga0495654_0001825_8687_9229 178
530 3300046530 Ga0495654_0008183 Ga0495654_0008183_5238_5780 178
531 3300046530 Ga0495654_0014046 Ga0495654_0014046_2757_3311 178
532 3300046530 Ga0495654_0014303 Ga0495654_0014303_2957_3493 178
533 3300046530 Ga0495654_0049249 Ga0495654_0049249_1405_1947 178
534 3300046530 Ga0495654_0145035 Ga0495654_0145035_54_590 178
535 3300046538 Ga0495609_0000278 Ga0495609_0000278_12945_13487 178
536 3300046538 Ga0495609_0007268 Ga0495609_0007268_4321_4857 178
537 3300046538 Ga0495609_0101754 Ga0495609_0101754_517_1059 178
538 3300046542 Ga0495597_0000194 Ga0495597_0000194_40179_40721 178
539 3300046542 Ga0495597_0000599 Ga0495597_0000599_18764_19312 178
540 3300046542 Ga0495597_0068570 Ga0495597_0068570_342_878 178
541 3300046557 Ga0495622_0122023 Ga0495622_0122023_543_1085 178
542 3300046558 Ga0495633_0000241 Ga0495633_0000241_47532_48071 178
543 3300046558 Ga0495633_0234138 Ga0495633_0234138_68_604 178
544 3300046615 Ga0495656_0002764 Ga0495656_0002764_4658_5194 178
545 3300046616 Ga0495668_0082272 Ga0495668_0082272_362_898 178
546 3300046616 Ga0495668_0210719 Ga0495668_0210719_365_907 178
547 3300046648 Ga0495611_0064813 Ga0495611_0064813_467_1003 178
548 3300046660 Ga0495625_0002977 Ga0495625_0002977_2553_3146 178
549 3300046660 Ga0495625_0006722 Ga0495625_0006722_1439_1981 178
550 3300046660 Ga0495625_0191940 Ga0495625_0191940_672_1208 178
551 3300046660 Ga0495625_0286876 Ga0495625_0286876_33_596 178
552 3300046660 Ga0495625_0452024 Ga0495625_0452024_116_652 178
553 3300046664 Ga0495659_0003821 Ga0495659_0003821_3649_4185 178
554 3300046665 Ga0495661_0022887 Ga0495661_0022887_499_1041 178
555 3300046665 Ga0495661_0062199 Ga0495661_0062199_664_1200 178
556 3300046684 Ga0495669_0020137 Ga0495669_0020137_682_1218 178
557 3300046684 Ga0495669_0089113 Ga0495669_0089113_537_1073 178
558 3300046690 Ga0495624_0000142 Ga0495624_0000142_1868_2404 178
559 3300046691 Ga0495670_0252485 Ga0495670_0252485_367_903 178
560 3300046692 Ga0495671_0004272 Ga0495671_0004272_4734_5276 178
561 3300046692 Ga0495671_0010571 Ga0495671_0010571_4064_4600 178
562 3300046692 Ga0495671_0024176 Ga0495671_0024176_1965_2501 178
563 3300046692 Ga0495671_0068903 Ga0495671_0068903_416_958 178
564 3300046694 Ga0495649_0000155 Ga0495649_0000155_45661_46203 178
565 3300046694 Ga0495649_0001227 Ga0495649_0001227_11486_12028 178
566 3300046694 Ga0495649_0001607 Ga0495649_0001607_5626_6180 178
567 3300046694 Ga0495649_0324831 Ga0495649_0324831_159_701 178
568 3300046794 Ga0495589_0000221 Ga0495589_0000221_10973_11515 178
569 3300046794 Ga0495589_0027537 Ga0495589_0027537_1809_2351 178
570 3300046794 Ga0495589_0029720 Ga0495589_0029720_1706_2248 178
571 3300046794 Ga0495589_0031727 Ga0495589_0031727_1959_2501 178
572 3300046794 Ga0495589_0055782 Ga0495589_0055782_16_558 178
573 3300046794 Ga0495589_0110815 Ga0495589_0110815_654_1190 178
574 3300046810 Ga0495660_0001453 Ga0495660_0001453_11123_11665 178
575 3300046810 Ga0495660_0004204 Ga0495660_0004204_6630_7172 178
576 3300046810 Ga0495660_0021442 Ga0495660_0021442_2886_3428 178
577 3300046810 Ga0495660_0090637 Ga0495660_0090637_64_600 178
578 3300046810 Ga0495660_0103161 Ga0495660_0103161_157_693 178
579 3300046810 Ga0495660_0198222 Ga0495660_0198222_187_729 178
580 3300047317 Ga0495604_0003583 Ga0495604_0003583_10737_11279 178
581 3300047318 Ga0495636_0019632 Ga0495636_0019632_498_1034 178
582 3300047319 Ga0495674_0000139 Ga0495674_0000139_45179_45721 178
583 3300047320 Ga0495672_0000416 Ga0495672_0000416_49187_49723 178
584 3300047320 Ga0495672_0001760 Ga0495672_0001760_16181_16735 178
585 3300047320 Ga0495672_0003511 Ga0495672_0003511_1076_1618 178
586 3300047320 Ga0495672_0004519 Ga0495672_0004519_10204_10740 178
587 3300047320 Ga0495672_0004675 Ga0495672_0004675_8895_9437 178
588 3300047320 Ga0495672_0009740 Ga0495672_0009740_5837_6379 178
589 3300047320 Ga0495672_0072292 Ga0495672_0072292_672_1208 178
590 3300047323 Ga0495683_0000661 Ga0495683_0000661_188_730 178
591 3300047323 Ga0495683_0038672 Ga0495683_0038672_1630_2169 178
592 3300047443 Ga0495687_000480 Ga0495687_000480_36444_36986 178
593 3300047443 Ga0495687_156083 Ga0495687_156083_53_589 178
594 3300047445 Ga0495677_0004508 Ga0495677_0004508_647_1183 178
595 3300047447 Ga0495685_163057 Ga0495685_163057_108_644 178
596 3300047469 Ga0495673_0000405 Ga0495673_0000405_21107_21649 178
597 3300047469 Ga0495673_0000894 Ga0495673_0000894_2822_3364 178
598 3300047469 Ga0495673_0011845 Ga0495673_0011845_562_1098 178
599 3300047469 Ga0495673_0044954 Ga0495673_0044954_508_1101 178
600 3300047469 Ga0495673_0078919 Ga0495673_0078919_158_700 178
601 3300047469 Ga0495673_0081238 Ga0495673_0081238_704_1240 178
602 3300047470 Ga0495681_0007998 Ga0495681_0007998_1020_1556 178
603 3300047472 Ga0495686_0251562 Ga0495686_0251562_252_788 178
604 3300047673 Ga0495593_0000011 Ga0495593_0000011_8227_8769 178
605 3300047673 Ga0495593_0000074 Ga0495593_0000074_33926_34468 178
606 3300048088 Ga0495602_0000177 Ga0495602_0000177_17865_18407 178
607 3300048091 Ga0495626_0000460 Ga0495626_0000460_34099_34653 178
608 3300048091 Ga0495626_0000610 Ga0495626_0000610_21051_21593 178
609 3300048091 Ga0495626_0001049 Ga0495626_0001049_22669_23211 178
610 3300048091 Ga0495626_0018026 Ga0495626_0018026_1880_2416 178
611 3300048091 Ga0495626_0192722 Ga0495626_0192722_103_639 178
612 3300048909 Ga0496106_0007822 Ga0496106_0007822_6354_6926 178
613 3300048915 Ga0496112_0321985 Ga0496112_0321985_505_1041 178
614 3300048919 Ga0496116_0000435 Ga0496116_0000435_26139_26681 178
615 3300048919 Ga0496116_0000573 Ga0496116_0000573_29683_30225 178
616 3300048919 Ga0496116_0000713 Ga0496116_0000713_29732_30274 178
617 3300048920 Ga0496117_0000924 Ga0496117_0000924_41106_41642 178
618 3300048920 Ga0496117_0005048 Ga0496117_0005048_12665_13207 178
619 3300048920 Ga0496117_0005142 Ga0496117_0005142_5777_6319 178
620 3300048921 Ga0496118_0000965 Ga0496118_0000965_3307_3843 178
621 3300048921 Ga0496118_0001201 Ga0496118_0001201_25802_26344 178
622 3300048921 Ga0496118_0003782 Ga0496118_0003782_11064_11606 178
623 3300048922 Ga0496119_0035491 Ga0496119_0035491_2337_2879 178
624 3300048923 Ga0496120_0000911 Ga0496120_0000911_35068_35610 178
625 3300048924 Ga0496121_0000623 Ga0496121_0000623_35999_36571 178
626 3300048924 Ga0496121_0003753 Ga0496121_0003753_3300_3842 178
627 3300048924 Ga0496121_0005834 Ga0496121_0005834_1590_2132 178
628 3300048924 Ga0496121_0038231 Ga0496121_0038231_2794_3330 178
629 3300048924 Ga0496121_0040896 Ga0496121_0040896_3263_3805 178
630 3300048924 Ga0496121_0398437 Ga0496121_0398437_182_724 178
631 3300048925 Ga0496122_0001720 Ga0496122_0001720_1021_1584 178
632 3300048925 Ga0496122_0192848 Ga0496122_0192848_463_1005 178
633 3300048926 Ga0496123_0001001 Ga0496123_0001001_32362_32925 178
634 3300048926 Ga0496123_0111885 Ga0496123_0111885_731_1273 178
635 3300048927 Ga0496124_0001000 Ga0496124_0001000_9530_10084 178
636 3300048927 Ga0496124_0048096 Ga0496124_0048096_331_873 178
637 3300048927 Ga0496124_0059833 Ga0496124_0059833_1752_2294 178
638 3300049459 Ga0495678_000559 Ga0495678_000559_474_1016 178
639 3300049459 Ga0495678_001652 Ga0495678_001652_14814_15350 178
640 3300049459 Ga0495678_002751 Ga0495678_002751_1439_1987 178
641 3300049459 Ga0495678_003117 Ga0495678_003117_9944_10486 178
642 3300049459 Ga0495678_033800 Ga0495678_033800_127_669 178
643 3300049459 Ga0495678_080724 Ga0495678_080724_529_1065 178
644 3300049459 Ga0495678_082396 Ga0495678_082396_179_721 178
645 3300049459 Ga0495678_102775 Ga0495678_102775_10_546 178
646 3300049460 Ga0495682_0026374 Ga0495682_0026374_926_1462 178
647 3300049460 Ga0495682_0026897 Ga0495682_0026897_672_1208 178
648 3300049758 Ga0501241_000027 Ga0501241_000027_40461_41003 178
649 3300049758 Ga0501241_000107 Ga0501241_000107_12675_13217 178
650 iso_pu_bacteria 2511231012 2511299764 178

Feature Viewer

pLDDT pTM Quality
77.81 0.37 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map