F472414

General Info

Members Datasets Scaffolds Average Seq Length
648 586 198 411

Family's Representative Sequence

Representative Sequence 3300053140|Ga0500573_0000633|Ga0500573_0000633_1815_3263
Length 482
Sequence MPFILPDFFVFSPLSAVAKTVTLPTGQFIGQKPAKGNRRDENDPRTDAGTGTKPGHGVRQVRILVMTAAPGENMRINGDRLWDSLMEMAKIGPGIAGGNNRQTLTDEDGEGRRLFQSWCEAAGMTMGVDTMGNMFFTRPGTDPNALPVYVGSHLDTQPTGGKFDGVYGVLGALELVRSMNDLGIQTRHPIVVTNWTNEEGARFAPAMIGSGVFAGMIEQDWAYSRTDAKGKTFGEELVRIGWQGDEQPGARKMHAFFELHIEQGPILEAEGKDIGVVTHGQGLWWLQVTLTGKEAHTGSTPMLLRKNASLGMGQMLQLVQEIAMAHQPDAVGGVGHIEVTPNSRNVLPGKVVFTVDFRTPHQPVLDAMKAAFETEAPKIAEQLGLGIEIESVGHFDPVTFDETCVATVRNAAERLGYSHRNIVSGAGHDACWMNRLVPTAMIFCPCVDGLSHNEAEEISKEWAAAGADVLFHAVVETAGIVA

Samples

Sample ID Description Type Environment
1 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
2 2508501123 Mesorhizobium sp. WSM3626 Isolate Nodule
3 2508501127 Mesorhizobium sp. WSM2561 Isolate Nodule
4 2509276022 Mesorhizobium australicum WSM2073 Isolate Nodule
5 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
6 2511231008 Pseudomonas sp. GM21 Isolate Nodule
7 2511231027 Phyllobacterium sp. YR531 Isolate Rhizosphere
8 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
9 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
10 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
11 2512875024 Mesorhizobium loti R88b Isolate Nodule
12 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
13 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
14 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
15 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
16 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
17 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
18 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
19 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
20 2513237351 Mesorhizobium alhagi CCNWXJ12-2 Isolate Nodule
21 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
22 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
23 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
24 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
25 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
26 2534681786 Brucella suis 92/29 Isolate Unclassified
27 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
28 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
29 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
30 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
31 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
32 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
33 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
34 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
35 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
36 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
37 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
38 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
39 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
40 2599185240 Burkholderia sp. NFPP32 Isolate Rhizoplane
41 2599185288 Pseudomonas sp. NFACC25 Isolate Rhizoplane
42 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
43 2599185355 Burkholderia sp. NFACC33-1 Isolate Rhizoplane
44 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
45 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
46 2643221550 Mesorhizobium sp. Root552 Isolate Unclassified
47 2643221551 Mesorhizobium sp. Root1471 Isolate Unclassified
48 2643221555 Mesorhizobium sp. Root554 Isolate Unclassified
49 2643221557 Ensifer sp. Root558 Isolate Unclassified
50 2643221568 Rhizobium sp. Root564 Isolate Unclassified
51 2643221582 Rhizobium sp. Root651 Isolate Unclassified
52 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
53 2643221610 Ensifer sp. Root74 Isolate Unclassified
54 2643221623 Aminobacter sp. DSM 101952 Root100 Isolate Unclassified
55 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
56 2643221653 Rhizobium sp. Root1240 Isolate Unclassified
57 2643221668 Ensifer sp. Root423 Isolate Unclassified
58 2643221675 Ensifer sp. Root1298 Isolate Unclassified
59 2643221680 Ensifer sp. Root1312 Isolate Unclassified
60 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
61 2643221719 Rhizobium sp. Root274 Isolate Unclassified
62 2643221723 Ensifer sp. Root278 Isolate Unclassified
63 2643221726 Ensifer sp. Root954 Isolate Unclassified
64 2671180139 Chelativorans sp. A52C2 Isolate Unclassified
65 2675903129 Burkholderia pyrrocinia NFIX32 Isolate Rhizoplane
66 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
67 2713897090 Paracoccus sphaerophysae HAMBI 3106 Isolate Nodule
68 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
69 2738541294 Pseudomonas sp. GV087 Isolate Unclassified
70 2738541309 Pseudomonas sp. GV047 Isolate Unclassified
71 2738543024 Aminobacter sp. AP02 Isolate Unclassified
72 2751185800 Brucella pituitosa AA2 Isolate Unclassified
73 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
74 2758568016 [Ochrobactrum] quorumnocens A44 Isolate Rhizosphere
75 2765235802 Phyllobacterium bourgognense 31-25a Isolate Rhizoplane
76 2767802442 Phyllobacterium brassicacearum 29-15 Isolate Rhizoplane
77 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
78 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
79 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
80 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
81 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
82 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
83 2818991272 Rhizobium sp. SLBN-4 Isolate Unclassified
84 2837678835 Jiella endophytica CBS5Q-3 Isolate Unclassified
85 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
86 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
87 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
88 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
89 2839993093 Phyllobacterium endophyticum PEPV15 Isolate Unclassified
90 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
91 2840878972 Albibacillus kandeliae J95 Isolate Rhizosphere
92 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
93 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
94 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
95 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
96 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
97 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
98 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
99 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
100 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
101 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
102 2842871566 Phyllobacterium sp. R-73111 Isolate Unclassified
103 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
104 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
105 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
106 2854681122 Luteovulum sphaeroides SCJ Isolate Unclassified
107 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
108 2854911287 Brucella lupini LUP21 Isolate Unclassified
109 2855020534 Paracoccus endophyticus SYSUP0003 Isolate Stem Tuber
110 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
111 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
112 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
113 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
114 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
115 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
116 2856349417 Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 Isolate Nodule
117 2856356410 Mesorhizobium sp. M4B.F.Ca.ET.088.02.2.1 Isolate Nodule
118 2857367948 Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 Isolate Nodule
119 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
120 2869162929 Mesorhizobium sanjuanii BSA136 Isolate Nodule
121 2869169390 Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 Isolate Nodule
122 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
123 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
124 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
125 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
126 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
127 2871459585 Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 Isolate Nodule
128 2871466892 Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 Isolate Nodule
129 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
130 2871481445 Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 Isolate Nodule
131 2871488783 Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 Isolate Nodule
132 2874109183 Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 Isolate Nodule
133 2874116593 Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 Isolate Nodule
134 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
135 2874131515 Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 Isolate Nodule
136 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
137 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
138 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
139 2876377896 Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 Isolate Nodule
140 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
141 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
142 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
143 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
144 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
145 2878774303 Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 Isolate Nodule
146 2878781027 Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 Isolate Nodule
147 2878788777 Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 Isolate Nodule
148 2881845957 Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 Isolate Nodule
149 2881861095 Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 Isolate Nodule
150 2882912400 Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 Isolate Nodule
151 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
152 2885318864 Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 Isolate Nodule
153 2885350715 Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 Isolate Nodule
154 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
155 2888343758 Mesorhizobium sp. AA22 Isolate Unclassified
156 2889790730 Chelativorans xinjiangense lm93 Isolate Rhizosphere
157 2889914905 Chelativorans alearense UJN715 Isolate Rhizosphere
158 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
159 2894652903 Phyllobacterium sp. SYP-B3895 Isolate Rhizosphere
160 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
161 2898795034 Rhodobacter sp. SGA-6-6 Isolate Rhizosphere
162 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
163 2902682994 Paraburkholderia atlantica CNPSo 3155 Isolate Unclassified
164 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
165 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
166 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
167 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
168 2904578770 Phyllobacterium sp. 586 Isolate Unclassified
169 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
170 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
171 2906378014 Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 Isolate Nodule
172 2906386501 Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 Isolate Nodule
173 2906393657 Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 Isolate Nodule
174 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
175 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
176 2915650412 Ochrobactrum sp. CM-21-5 Isolate Rhizosphere
177 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
178 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
179 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
180 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
181 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
182 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
183 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
184 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
185 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
186 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
187 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
188 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
189 2917554339 Chthonobacter rhizosphaerae yh7-1 Isolate Rhizosphere
190 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
191 2919119836 Phyllobacterium sp. 1468 Isolate Rhizosphere
192 2919166419 Agrobacterium cavarae 2074 Isolate Unclassified
193 2919679072 Pseudotabrizicola sp. 4114 Isolate Unclassified
194 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
195 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
196 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
197 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
198 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
199 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
200 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
201 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
202 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
203 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
204 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
205 2922178524 Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 Isolate Nodule
206 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
207 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
208 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
209 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
210 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
211 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
212 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
213 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
214 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
215 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
216 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
217 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
218 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
219 2924710171 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 Isolate Nodule
220 2924718760 Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 Isolate Nodule
221 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
222 2924741084 Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 Isolate Nodule
223 2924748358 Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 Isolate Nodule
224 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
225 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
226 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
227 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
228 2928157003 Burkholderia ambifaria 566 Isolate Unclassified
229 2928163908 Burkholderia sp. 567 Isolate Unclassified
230 2928521798 Phyllobacterium ifriqiyense 1451 Isolate Rhizosphere
231 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
232 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
233 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
234 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
235 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
236 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
237 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
238 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
239 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
240 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
241 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
242 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
243 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
244 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
245 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
246 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
247 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
248 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
249 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
250 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
251 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
252 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
253 2937843397 Mesorhizobium xinjiangense lm94 Isolate Rhizosphere
254 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
255 2937861824 Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 Isolate Nodule
256 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
257 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
258 2937980651 Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 Isolate Nodule
259 2938014810 Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 Isolate Nodule
260 2939669807 Kaistia defluvii 3207 Isolate Rhizosphere
261 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
262 2954011201 Phyllobacterium ifrigiyense W4I11 Isolate Rhizosphere
263 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
264 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
265 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
266 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
267 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
268 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
269 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
270 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
271 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
272 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
273 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
274 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
275 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
276 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
277 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
278 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
279 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
280 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
281 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
282 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
283 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
284 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
285 2958092219 Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 Isolate Nodule
286 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
287 2958144490 Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 Isolate Nodule
288 2958158011 Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 Isolate Nodule
289 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
290 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
291 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
292 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
293 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
294 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
295 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
296 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
297 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
298 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
299 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
300 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
301 2961127735 Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 Isolate Nodule
302 2961136820 Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 Isolate Nodule
303 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
304 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
305 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
306 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
307 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
308 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
309 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
310 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
311 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
312 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
313 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
314 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
315 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
316 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
317 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
318 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
319 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
320 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
321 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
322 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
323 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
324 2965032056 Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 Isolate Nodule
325 2965047637 Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 Isolate Nodule
326 2965089291 Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 Isolate Nodule
327 2965110997 Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 Isolate Nodule
328 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
329 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
330 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
331 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
332 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
333 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
334 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
335 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
336 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
337 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
338 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
339 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
340 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
341 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
342 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
343 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
344 2967996073 Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 Isolate Nodule
345 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
346 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
347 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
348 2968138860 Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 Isolate Nodule
349 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
350 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
351 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
352 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
353 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
354 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
355 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
356 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
357 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
358 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
359 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
360 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
361 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
362 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
363 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
364 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
365 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
366 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
367 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
368 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
369 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
370 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
371 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
372 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
373 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
374 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
375 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
376 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
377 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
378 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
379 2970619444 Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 Isolate Nodule
380 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
381 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
382 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
383 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
384 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
385 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
386 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
387 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
388 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
389 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
390 2977828996 Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 Isolate Nodule
391 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
392 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
393 2977898635 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 Isolate Nodule
394 2977907340 Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 Isolate Nodule
395 2977915119 Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 Isolate Nodule
396 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
397 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
398 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
399 2977986579 Mesorhizobium intechi BD68 Isolate Unclassified
400 2979772303 Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 Isolate Nodule
401 2979793036 Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 Isolate Nodule
402 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
403 2981990288 Burkholderia sp. PvR073 Isolate Rhizosphere
404 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
405 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
406 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
407 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified
408 2996336353 Mesorhizobium sp. YM1C-6-2 Isolate Unclassified
409 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
410 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
411 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
412 3000405567 Rhodobacteraceae bacterium LNNU 3342 Isolate Rhizosphere
413 3002141150 Phyllobacterium sp. 628 Isolate Unclassified
414 3004167301 Mesorhizobium loti 582 Isolate Unclassified
415 3004195979 Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 Isolate Nodule
416 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
417 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
418 3004232784 Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 Isolate Nodule
419 3004239961 Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 Isolate Nodule
420 3004248173 Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 Isolate Nodule
421 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
422 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
423 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
424 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
425 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
426 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
427 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
428 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
429 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
430 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
431 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
432 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
433 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
434 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
435 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
436 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
437 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
438 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
439 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
440 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
441 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
442 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
443 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
444 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
445 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
446 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
447 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
448 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
449 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
450 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
451 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
452 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
453 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
454 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
455 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
456 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
457 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
458 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
459 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
460 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
461 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
462 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
463 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
464 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
465 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
466 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
467 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
468 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
469 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
470 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
471 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
472 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
473 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
474 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
475 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
476 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
477 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
478 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
479 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
480 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
481 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
482 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
483 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
484 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
485 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
486 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
487 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
488 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
489 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
490 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
491 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
492 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
493 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
494 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
495 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
496 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
497 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
498 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
499 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
500 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
501 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
502 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
503 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
504 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
505 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
506 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
507 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
508 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
509 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
510 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
511 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
512 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
513 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
514 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
515 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
516 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
517 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
518 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
519 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
520 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
521 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
522 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
523 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
524 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
525 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
526 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
527 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
528 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
529 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
530 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
531 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
532 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
533 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
534 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
535 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
536 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
537 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
538 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
539 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
540 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
541 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
542 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
543 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
544 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
545 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
546 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
547 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
548 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
549 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
550 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
551 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
552 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
553 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
554 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
555 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
556 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
557 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
558 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
559 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
560 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
561 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
562 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
563 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
564 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
565 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
566 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
567 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
568 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
569 641736154 Burkholderia ambifaria IOP40-10 Isolate Rhizosphere
570 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
571 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
572 8002285264 Aminobacter anthyllidis LMG 26462 Isolate Nodule
573 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
574 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
575 8004312739 Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 Isolate Nodule
576 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
577 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
578 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
579 8004695233 Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 Isolate Nodule
580 8004727605 Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 Isolate Nodule
581 8005246636 Rhizobium wuzhouense W44 Isolate Rhizosphere
582 8045864390 Aurantimonas endophytica KCTC 52296 Isolate Unclassified
583 8054558443 Rhizobium alarense TRM95111 Isolate Nodule
584 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule
585 8056875544 Rhizobium halophilum TRM95001 Isolate Rhizosphere
586 8057132660 Paracoccus rhizosphaerae LMG 21293 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 30.25
Metatranscriptomes 0.31
Isolates 69.44

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.18
Nodule 54.32
Rhizoplane 3.4
Rhizosphere 16.67
Stem 0
Stem Tuber 0.15
Unclassified 17.28

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10013429 3300001989 Bacteria 2992
2 JGI24735J21928_10019873 3300002067 Bacteria 2062
3 JGI25152J39213_1002234 3300002773 Bacteria 7523
4 JGI25150J39212_1000091 3300002774 Bacteria 52487
5 JGI25159J45721_1000008 3300002987 Bacteria 172667
6 JGI25151J46595_10000027 3300003187 Bacteria 208739
7 JGI25160J50197_1000033 3300003354 Bacteria 172667
8 JGI25161J50226_1001306 3300003374 Bacteria 7853
9 Ga0006562J51391_1004059 3300003578 Bacteria 7408
10 Ga0006562J51391_1041354 3300003578 Bacteria 3523
11 Ga0055532_1001277 3300003758 Bacteria 7312
12 Ga0055527_1000200 3300003760 Bacteria 39489
13 Ga0055535_1000927 3300003761 Bacteria 19641
14 Ga0055542_1000601 3300003762 Bacteria 30747
15 Ga0055542_1002795 3300003762 Bacteria 5265
16 Ga0055526_1000653 3300003771 Bacteria 26790
17 Ga0055524_1003306 3300003775 Bacteria 7872
18 Ga0055536_1011754 3300003781 Bacteria 3313
19 Ga0055543_1000026 3300004625 Bacteria 136177
20 Ga0065165_1000178 3300005262 Bacteria 113319
21 Ga0065165_1000593 3300005262 Bacteria 53114
22 Ga0070660_100000243 3300005339 Bacteria 36353
23 Ga0070659_100000007 3300005366 Bacteria 204358
24 Ga0068857_100278561 3300005577 Bacteria 1538
25 Ga0068852_100088943 3300005616 Bacteria 2759
26 Ga0081539_10001979 3300005985 Bacteria 31166
27 Ga0075364_10005565 3300006051 Bacteria 7341
28 Ga0075362_10002360 3300006177 Bacteria 6320
29 Ga0099826_10002800 3300006948 Bacteria 11467
30 Ga0105251_10032230 3300009011 Bacteria 2614
31 Ga0105240_10015102 3300009093 Bacteria 10511
32 Ga0105238_10019737 3300009551 Bacteria 6863
33 Ga0105238_10107124 3300009551 Bacteria 2776
34 Ga0157373_10008186 3300013100 Bacteria 7777
35 Ga0157370_10000295 3300013104 Bacteria 63297
36 Ga0157369_10142156 3300013105 Bacteria 2539
37 Ga0171463_1007 3300013249 Bacteria 301198
38 Ga0163163_10001353 3300014325 Bacteria 20684
39 Ga0182005_1003792 3300015265 Bacteria 5022
40 Ga0183363_1084 3300015690 Bacteria 28436
41 Ga0163161_10002963 3300017792 Bacteria 12032
42 Ga0228711_1000017 3300022739 Bacteria 121084
43 Ga0228710_1000005 3300022740 Bacteria 233531
44 Ga0209672_100015 3300025228 Bacteria 529352
45 Ga0209147_100016 3300025229 Bacteria 527606
46 Ga0209258_100026 3300025242 Bacteria 527606
47 Ga0207425_1000043 3300025245 Bacteria 208791
48 Ga0209026_1000025 3300025250 Bacteria 352548
49 Ga0209148_1000181 3300025254 Bacteria 124691
50 Ga0209148_1001668 3300025254 Bacteria 9980
51 Ga0209759_1000121 3300025256 Bacteria 138469
52 Ga0209759_1016098 3300025256 Bacteria 1902
53 Ga0209129_1000072 3300025258 Bacteria 208805
54 Ga0209233_1000010 3300025261 Bacteria 1194329
55 Ga0209455_1000127 3300025272 Bacteria 162518
56 Ga0209455_1000331 3300025272 Bacteria 45428
57 Ga0209130_1000017 3300025284 Bacteria 388431
58 Ga0209676_1001868 3300025292 Bacteria 17327
59 Ga0209025_1000120 3300025294 Bacteria 208791
60 Ga0209025_1000153 3300025294 Bacteria 170548
61 Ga0209564_1000013 3300025295 Bacteria 775755
62 Ga0209758_1000111 3300025297 Bacteria 208790
63 Ga0209050_1003752 3300025298 Bacteria 10896
64 Ga0209256_1000211 3300025299 Bacteria 110131
65 Ga0207426_1000006 3300025302 Bacteria 1025969
66 Ga0207426_1000110 3300025302 Bacteria 235630
67 Ga0209051_1012412 3300025303 Bacteria 4122
68 Ga0207713_1001600 3300025735 Bacteria 17697
69 Ga0207654_10041286 3300025911 Bacteria 2604
70 Ga0207695_10011863 3300025913 Bacteria 10507
71 Ga0207695_10018023 3300025913 Bacteria 8175
72 Ga0207657_10000532 3300025919 Bacteria 40465
73 Ga0207657_10118488 3300025919 Bacteria 2179
74 Ga0207690_10000008 3300025932 Bacteria 366090
75 Ga0207667_10017571 3300025949 Bacteria 8044
76 Ga0207678_10000585 3300026067 Bacteria 33320
77 Ga0209281_1000082 3300027111 Bacteria 257684
78 Ga0209282_1000006 3300027666 Bacteria 276998
79 Ga0209282_1001136 3300027666 Bacteria 14219
80 Ga0209813_10004514 3300027866 Bacteria 3329
81 Ga0268266_10039615 3300028379 Bacteria 4014
82 Ga0268266_10141284 3300028379 Bacteria 2161
83 Ga0307515_10107881 3300028794 Bacteria 3286
84 Ga0265325_10050911 3300031241 Bacteria 2131
85 Ga0265340_10003569 3300031247 Bacteria 8753
86 Ga0265339_10004620 3300031249 Bacteria 9356
87 Ga0265339_10048153 3300031249 Bacteria 2338
88 Ga0265314_10063514 3300031711 Bacteria 2504
89 Ga0265314_10128334 3300031711 Bacteria 1585
90 Ga0265342_10006322 3300031712 Bacteria 8832
91 Ga0265342_10066289 3300031712 Bacteria 2115
92 Ga0307405_10000197 3300031731 Bacteria 22213
93 Ga0307412_10064784 3300031911 Bacteria 2470
94 Ga0315914_1000003 3300031967 Bacteria 314370
95 Ga0307409_100089557 3300031995 Bacteria 2516
96 Ga0307409_100351518 3300031995 Bacteria 1391
97 Ga0307416_100265920 3300032002 Bacteria 1680
98 Ga0315913_1000001 3300033430 Bacteria 284459
99 Ga0315915_1000008 3300033464 Bacteria 258517
100 Ga0373935_0217695 3300035692 Bacteria 1325
101 Ga0373927_0002185 3300035695 Bacteria 14378
102 Ga0373925_0002324 3300037068 Bacteria 15297
103 Ga0395900_0051845 3300037418 Bacteria 4225
104 Ga0395905_0000020 3300037471 Bacteria 337672
105 Ga0395905_0000131 3300037471 Bacteria 123639
106 Ga0395905_0054309 3300037471 Bacteria 3749
107 Ga0395901_0073867 3300038443 Bacteria 3557
108 Ga0400485_00501 3300038735 Bacteria 6223
109 Ga0400483_075845 3300039062 Bacteria 3691
110 Ga0400483_098836 3300039062 Bacteria 4185
111 Ga0400483_103660 3300039062 Bacteria 17083
112 Ga0400483_164765 3300039062 Bacteria 1809
113 Ga0400483_181595 3300039062 Bacteria 28212
114 Ga0400483_193517 3300039062 Bacteria 1942
115 Ga0451576_0000819 3300045051 Bacteria 60723
116 Ga0495638_0006070 3300046460 Bacteria 8841
117 Ga0495653_0011308 3300046463 Bacteria 7295
118 Ga0495580_0003886 3300046472 Bacteria 12633
119 Ga0495582_0051778 3300046473 Bacteria 2264
120 Ga0495605_0032180 3300046474 Bacteria 2672
121 Ga0495611_0016694 3300046648 Bacteria 3138
122 Ga0495625_0034069 3300046660 Bacteria 3760
123 Ga0495624_0002886 3300046690 Bacteria 12867
124 Ga0495600_0039143 3300046809 Bacteria 3087
125 Ga0495604_0047267 3300047317 Bacteria 3352
126 Ga0495674_0005116 3300047319 Bacteria 12600
127 Ga0495674_0005948 3300047319 Bacteria 11704
128 Ga0495674_0041223 3300047319 Bacteria 4126
129 Ga0495683_0003395 3300047323 Bacteria 9297
130 Ga0495686_0141618 3300047472 Bacteria 1419
131 Ga0495593_0002879 3300047673 Bacteria 10371
132 Ga0496100_0056513 3300048903 Bacteria 2568
133 Ga0496101_0213250 3300048904 Bacteria 1496
134 Ga0496104_0024704 3300048907 Bacteria 5530
135 Ga0496105_0001686 3300048908 Bacteria 15755
136 Ga0496108_0010872 3300048911 Bacteria 7389
137 Ga0496109_0001851 3300048912 Bacteria 17521
138 Ga0496110_0012143 3300048913 Bacteria 7077
139 Ga0496110_0272663 3300048913 Bacteria 1540
140 Ga0496111_0001765 3300048914 Bacteria 12668
141 Ga0496112_0021096 3300048915 Bacteria 6188
142 Ga0496113_0000296 3300048916 Bacteria 23547
143 Ga0496114_0047222 3300048917 Bacteria 3581
144 Ga0496115_0111485 3300048918 Bacteria 2248
145 Ga0496116_0000100 3300048919 Bacteria 194740
146 Ga0496116_0002588 3300048919 Bacteria 18844
147 Ga0496116_0014973 3300048919 Bacteria 6154
148 Ga0496116_0024233 3300048919 Bacteria 4493
149 Ga0496117_0006417 3300048920 Bacteria 11920
150 Ga0496117_0016935 3300048920 Bacteria 6111
151 Ga0496117_0018549 3300048920 Bacteria 5756
152 Ga0496117_0020840 3300048920 Bacteria 5332
153 Ga0496119_0000627 3300048922 Bacteria 47668
154 Ga0496119_0033922 3300048922 Bacteria 3373
155 Ga0496120_0007043 3300048923 Bacteria 8444
156 Ga0496122_0001309 3300048925 Bacteria 40891
157 Ga0496122_0007678 3300048925 Bacteria 11890
158 Ga0496122_0092212 3300048925 Bacteria 2060
159 Ga0496122_0108196 3300048925 Bacteria 1834
160 Ga0496123_0002726 3300048926 Bacteria 21189
161 Ga0496123_0005862 3300048926 Bacteria 12166
162 Ga0496123_0008841 3300048926 Bacteria 9178
163 Ga0496123_0055586 3300048926 Bacteria 2595
164 Ga0496124_0001796 3300048927 Bacteria 29836
165 Ga0496124_0009377 3300048927 Bacteria 10085
166 Ga0496124_0029536 3300048927 Bacteria 4882
167 Ga0496124_0035242 3300048927 Bacteria 4380
168 Ga0496124_0055445 3300048927 Bacteria 3349
169 Ga0496125_0001869 3300048928 Bacteria 28927
170 Ga0496125_0008714 3300048928 Bacteria 10556
171 Ga0496125_0035519 3300048928 Bacteria 4369
172 Ga0496125_0079806 3300048928 Bacteria 2508
173 Ga0496126_0000094 3300048929 Bacteria 208184
174 Ga0496126_0003175 3300048929 Bacteria 21152
175 Ga0496126_0005266 3300048929 Bacteria 14858
176 Ga0496126_0012520 3300048929 Bacteria 8684
177 Ga0501032_0136126 3300049569 Bacteria 1619
178 Ga0501034_0000012 3300049571 Bacteria 310504
179 Ga0501034_0186991 3300049571 Bacteria 2034
180 Ga0501047_0157039 3300049581 Bacteria 2148
181 Ga0501047_0185322 3300049581 Bacteria 1947
182 Ga0501070_0093578 3300049586 Bacteria 2486
183 Ga0501080_0063284 3300049742 Bacteria 3443
184 Ga0501083_0081740 3300049744 Bacteria 2141
185 Ga0501083_0101226 3300049744 Bacteria 1900
186 Ga0501035_0056534 3300049822 Bacteria 3500
187 nmdc:mga03683_17876_c1 3300050489 Bacteria 2689
188 nmdc:mga00v17_24386_c1 3300050491 Bacteria 3508
189 nmdc:mga0yw44_11833_c1 3300050492 Bacteria 4525
190 nmdc:mga06z11_31134_c1 3300050494 Bacteria 2589
191 nmdc:mga07m45_56651_c1 3300050496 Bacteria 2216
192 Ga0500556_0000119 3300053104 Bacteria 68528
193 Ga0500568_0000134 3300053139 Bacteria 67127
194 Ga0500573_0000633 3300053140 Bacteria 15485
195 Ga0500573_0006858 3300053140 Bacteria 6181
196 Ga0500616_0056828 3300053153 Bacteria 2041
197 Ga0500636_0000176 3300053177 Bacteria 34046
198 Ga0500611_008552 3300053727 Bacteria 1588

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2841734538 2841739182 391
2 iso_pu_bacteria 2856342000 2856344920 391
3 iso_pu_bacteria 2869162929 2869167277 391
4 iso_pu_bacteria 2871474448 2871479863 391
5 iso_pu_bacteria 2874123672 2874130585 391
6 iso_pu_bacteria 2874131515 2874137264 391
7 iso_pu_bacteria 2878774303 2878775927 391
8 iso_pu_bacteria 2878788777 2878792443 391
9 iso_pu_bacteria 2881861095 2881865047 391
10 iso_pu_bacteria 2888343758 2888346798 391
11 iso_pu_bacteria 2906393657 2906399594 391
12 iso_pu_bacteria 2924784321 2924789062 391
13 iso_pu_bacteria 2844002411 2844007445 393
14 iso_pu_bacteria 2844009547 2844013689 393
15 iso_pu_bacteria 2856328259 2856334551 393
16 iso_pu_bacteria 2856334872 2856340904 393
17 iso_pu_bacteria 2856349417 2856352100 393
18 iso_pu_bacteria 2856356410 2856361960 393
19 iso_pu_bacteria 2857367948 2857371340 393
20 iso_pu_bacteria 2869169390 2869172900 393
21 iso_pu_bacteria 2869249662 2869250803 393
22 iso_pu_bacteria 2869264136 2869267986 393
23 iso_pu_bacteria 2869271264 2869272212 393
24 iso_pu_bacteria 2871451962 2871457873 393
25 iso_pu_bacteria 2871459585 2871463562 393
26 iso_pu_bacteria 2871466892 2871471024 393
27 iso_pu_bacteria 2871481445 2871486364 393
28 iso_pu_bacteria 2871488783 2871494559 393
29 iso_pu_bacteria 2874109183 2874112209 393
30 iso_pu_bacteria 2874116593 2874122653 393
31 iso_pu_bacteria 2874162495 2874168459 393
32 iso_pu_bacteria 2876363079 2876368499 393
33 iso_pu_bacteria 2876377896 2876385156 393
34 iso_pu_bacteria 2876386047 2876388776 393
35 iso_pu_bacteria 2876399893 2876403715 393
36 iso_pu_bacteria 2876420981 2876422561 393
37 iso_pu_bacteria 2878753008 2878758859 393
38 iso_pu_bacteria 2878781027 2878785867 393
39 iso_pu_bacteria 2881845957 2881848775 393
40 iso_pu_bacteria 2882912400 2882918745 393
41 iso_pu_bacteria 2885312484 2885318004 393
42 iso_pu_bacteria 2885318864 2885323682 393
43 iso_pu_bacteria 2885350715 2885351302 393
44 iso_pu_bacteria 2888337043 2888339408 393
45 iso_pu_bacteria 2903448605 2903451295 393
46 iso_pu_bacteria 2903492973 2903503902 393
47 iso_pu_bacteria 2903521522 2903527498 393
48 iso_pu_bacteria 2903528002 2903533952 393
49 iso_pu_bacteria 2906363423 2906369839 393
50 iso_pu_bacteria 2906370794 2906377872 393
51 iso_pu_bacteria 2906378014 2906379605 393
52 iso_pu_bacteria 2906386501 2906388794 393
53 iso_pu_bacteria 2906401398 2906404081 393
54 iso_pu_bacteria 2906408224 2906408890 393
55 iso_pu_bacteria 2922151315 2922152057 393
56 iso_pu_bacteria 2922172374 2922176148 393
57 iso_pu_bacteria 2922178524 2922182383 393
58 iso_pu_bacteria 2924710171 2924710198 393
59 iso_pu_bacteria 2924718760 2924719648 393
60 iso_pu_bacteria 2924733363 2924736460 393
61 iso_pu_bacteria 2924741084 2924744224 393
62 iso_pu_bacteria 2924748358 2924753665 393
63 iso_pu_bacteria 2924762789 2924764269 393
64 iso_pu_bacteria 2924776078 2924783334 393
65 3300039062 Ga0400483_098836 Ga0400483_098836_79_1263 394
66 3300039062 Ga0400483_193517 Ga0400483_193517_568_1752 394
67 3300039062 Ga0400483_103660 Ga0400483_103660_15157_16344 395
68 3300047319 Ga0495674_0005948 Ga0495674_0005948_1954_3147 396
69 3300037471 Ga0395905_0054309 Ga0395905_0054309_2500_3693 397
70 3300048919 Ga0496116_0002588 Ga0496116_0002588_6040_7233 397
71 3300048920 Ga0496117_0006417 Ga0496117_0006417_7204_8397 397
72 3300048925 Ga0496122_0007678 Ga0496122_0007678_4520_5713 397
73 3300048926 Ga0496123_0005862 Ga0496123_0005862_9962_11155 397
74 3300048927 Ga0496124_0029536 Ga0496124_0029536_2674_3867 397
75 3300048928 Ga0496125_0008714 Ga0496125_0008714_7472_8665 397
76 3300053139 Ga0500568_0000134 Ga0500568_0000134_26818_28011 397
77 3300037471 Ga0395905_0000020 Ga0395905_0000020_54084_55373 402
78 3300047319 Ga0495674_0041223 Ga0495674_0041223_407_1696 402
79 3300006051 Ga0075364_10005565 Ga0075364_100055654 406
80 3300050491 nmdc:mga00v17_24386_c1 nmdc:mga00v17_24386_c1_1511_2779 406
81 iso_pu_bacteria 2511231008 2511277250 407
82 iso_pu_bacteria 2599185288 2599880697 407
83 iso_pu_bacteria 2738541294 2738806182 407
84 iso_pu_bacteria 2738541309 2738893542 407
85 3300013249 Ga0171463_1007 Ga0171463_1007210 409
86 3300035692 Ga0373935_0217695 Ga0373935_0217695_26_1255 409
87 3300035695 Ga0373927_0002185 Ga0373927_0002185_5234_6463 409
88 3300037068 Ga0373925_0002324 Ga0373925_0002324_7983_9212 409
89 3300038735 Ga0400485_00501 Ga0400485_00501_1503_2732 409
90 3300046474 Ga0495605_0032180 Ga0495605_0032180_1425_2657 410
91 iso_pu_bacteria 2902682994 2902685651 410
92 3300009011 Ga0105251_10032230 Ga0105251_100322302 411
93 3300017792 Ga0163161_10002963 Ga0163161_100029639 411
94 3300025735 Ga0207713_1001600 Ga0207713_100160015 411
95 3300031731 Ga0307405_10000197 Ga0307405_100001975 411
96 3300031911 Ga0307412_10064784 Ga0307412_100647843 411
97 3300046648 Ga0495611_0016694 Ga0495611_0016694_571_1806 411
98 3300048923 Ga0496120_0007043 Ga0496120_0007043_6473_7708 411
99 3300048927 Ga0496124_0055445 Ga0496124_0055445_1068_2303 411
100 3300048928 Ga0496125_0035519 Ga0496125_0035519_2574_3809 411
101 3300048929 Ga0496126_0012520 Ga0496126_0012520_6821_8056 411
102 iso_pu_bacteria 2511231027 2511392089 411
103 iso_pu_bacteria 2534681786 2535484058 411
104 iso_pu_bacteria 2537561587 2537873885 411
105 iso_pu_bacteria 2600255279 2601609809 411
106 iso_pu_bacteria 2600255308 2601746584 411
107 iso_pu_bacteria 2643221582 2643920071 411
108 iso_pu_bacteria 2713897090 2715500685 411
109 iso_pu_bacteria 2765235802 2765465951 411
110 iso_pu_bacteria 2767802442 2770196586 411
111 iso_pu_bacteria 2775506902 2776269306 411
112 iso_pu_bacteria 2775506904 2776283555 411
113 iso_pu_bacteria 2837678835 2837682336 411
114 iso_pu_bacteria 2838675328 2838675499 411
115 iso_pu_bacteria 2838714209 2838714380 411
116 iso_pu_bacteria 2838719591 2838721818 411
117 iso_pu_bacteria 2838724970 2838725141 411
118 iso_pu_bacteria 2839993093 2839993585 411
119 iso_pu_bacteria 2840764183 2840766591 411
120 iso_pu_bacteria 2841846520 2841848801 411
121 iso_pu_bacteria 2842124991 2842125168 411
122 iso_pu_bacteria 2842130223 2842130394 411
123 iso_pu_bacteria 2842152218 2842154436 411
124 iso_pu_bacteria 2842170452 2842170623 411
125 iso_pu_bacteria 2842175837 2842178056 411
126 iso_pu_bacteria 2842187318 2842187489 411
127 iso_pu_bacteria 2842211629 2842211800 411
128 iso_pu_bacteria 2842224351 2842226580 411
129 iso_pu_bacteria 2842871566 2842874936 411
130 iso_pu_bacteria 2854911287 2854914160 411
131 iso_pu_bacteria 2894652903 2894653460 411
132 iso_pu_bacteria 2899792073 2899795845 411
133 iso_pu_bacteria 2904578770 2904579718 411
134 iso_pu_bacteria 2919114240 2919114411 411
135 iso_pu_bacteria 2919119836 2919120615 411
136 iso_pu_bacteria 2926754445 2926755431 411
137 iso_pu_bacteria 2928521798 2928522517 411
138 iso_pu_bacteria 2933006813 2933009081 411
139 iso_pu_bacteria 2933594066 2933596319 411
140 iso_pu_bacteria 2954011201 2954014086 411
141 iso_pu_bacteria 3002141150 3002141934 411
142 iso_pu_bacteria 8045864390 8045868509 411
143 3300003578 Ga0006562J51391_1004059 Ga0006562J51391_10040591 412
144 3300048922 Ga0496119_0033922 Ga0496119_0033922_761_2023 412
145 3300048925 Ga0496122_0108196 Ga0496122_0108196_315_1577 412
146 iso_pu_bacteria 2503198000 2503201514 412
147 iso_pu_bacteria 2508501123 2509113118 412
148 iso_pu_bacteria 2508501127 2509143318 412
149 iso_pu_bacteria 2509276022 2509396293 412
150 iso_pu_bacteria 2510065059 2510315520 412
151 iso_pu_bacteria 2511231052 2511502526 412
152 iso_pu_bacteria 2512047086 2512533900 412
153 iso_pu_bacteria 2512875016 2512931518 412
154 iso_pu_bacteria 2512875024 2512959350 412
155 iso_pu_bacteria 2513237086 2513583159 412
156 iso_pu_bacteria 2513237089 2513601405 412
157 iso_pu_bacteria 2513237091 2513620315 412
158 iso_pu_bacteria 2513237140 2513881787 412
159 iso_pu_bacteria 2513237143 2513904931 412
160 iso_pu_bacteria 2513237156 2513983602 412
161 iso_pu_bacteria 2513237156 2513988529 412
162 iso_pu_bacteria 2513237164 2514033596 412
163 iso_pu_bacteria 2513237305 2514420864 412
164 iso_pu_bacteria 2513237351 2514589286 412
165 iso_pu_bacteria 2515154107 2515609314 412
166 iso_pu_bacteria 2516653046 2516893901 412
167 iso_pu_bacteria 2517487022 2517570621 412
168 iso_pu_bacteria 2524023207 2524448276 412
169 iso_pu_bacteria 2551306084 2551675293 412
170 iso_pu_bacteria 2551306084 2551676703 412
171 iso_pu_bacteria 2551306085 2551689423 412
172 iso_pu_bacteria 2551306086 2551696003 412
173 iso_pu_bacteria 2551306089 2551708859 412
174 iso_pu_bacteria 2551306090 2551716346 412
175 iso_pu_bacteria 2551306091 2551726446 412
176 iso_pu_bacteria 2551306092 2551731799 412
177 iso_pu_bacteria 2551306093 2551740964 412
178 iso_pu_bacteria 2588253730 2588517355 412
179 iso_pu_bacteria 2599185240 2599743484 412
180 iso_pu_bacteria 2599185352 2600196052 412
181 iso_pu_bacteria 2599185355 2600205284 412
182 iso_pu_bacteria 2643221551 2643776134 412
183 iso_pu_bacteria 2643221555 2643794581 412
184 iso_pu_bacteria 2643221557 2643804406 412
185 iso_pu_bacteria 2643221568 2643855212 412
186 iso_pu_bacteria 2643221595 2643984381 412
187 iso_pu_bacteria 2643221610 2644065177 412
188 iso_pu_bacteria 2643221623 2644129400 412
189 iso_pu_bacteria 2643221627 2644153238 412
190 iso_pu_bacteria 2643221668 2644377586 412
191 iso_pu_bacteria 2643221675 2644416849 412
192 iso_pu_bacteria 2643221680 2644449889 412
193 iso_pu_bacteria 2643221723 2644672757 412
194 iso_pu_bacteria 2643221726 2644690024 412
195 iso_pu_bacteria 2675903129 2676740581 412
196 iso_pu_bacteria 2687453392 2688598431 412
197 iso_pu_bacteria 2721755686 2723575362 412
198 iso_pu_bacteria 2738543024 2739307150 412
199 iso_pu_bacteria 2751185800 2753358603 412
200 iso_pu_bacteria 2756170246 2756675488 412
201 iso_pu_bacteria 2758568016 2758640839 412
202 iso_pu_bacteria 2775506902 2776267850 412
203 iso_pu_bacteria 2775506904 2776281821 412
204 iso_pu_bacteria 2791355094 2792638762 412
205 iso_pu_bacteria 2802428859 2802725509 412
206 iso_pu_bacteria 2802428860 2802730399 412
207 iso_pu_bacteria 2802428861 2802737629 412
208 iso_pu_bacteria 2840878972 2840879371 412
209 iso_pu_bacteria 2842922631 2842924471 412
210 iso_pu_bacteria 2855825444 2855826626 412
211 iso_pu_bacteria 2855839649 2855842017 412
212 iso_pu_bacteria 2856320880 2856327497 412
213 iso_pu_bacteria 2858800743 2858802691 412
214 iso_pu_bacteria 2869278585 2869284915 412
215 iso_pu_bacteria 2874139085 2874145858 412
216 iso_pu_bacteria 2878738818 2878745197 412
217 iso_pu_bacteria 2889790730 2889793002 412
218 iso_pu_bacteria 2889914905 2889919417 412
219 iso_pu_bacteria 2891373044 2891377707 412
220 iso_pu_bacteria 2896384573 2896391233 412
221 iso_pu_bacteria 2898795034 2898796398 412
222 iso_pu_bacteria 2915980308 2915981161 412
223 iso_pu_bacteria 2915986958 2915989936 412
224 iso_pu_bacteria 2915993759 2915998531 412
225 iso_pu_bacteria 2916000859 2916005068 412
226 iso_pu_bacteria 2916007675 2916012992 412
227 iso_pu_bacteria 2916014648 2916021092 412
228 iso_pu_bacteria 2916021584 2916023039 412
229 iso_pu_bacteria 2916028427 2916034201 412
230 iso_pu_bacteria 2916035215 2916039341 412
231 iso_pu_bacteria 2916055098 2916061510 412
232 iso_pu_bacteria 2916061851 2916062024 412
233 iso_pu_bacteria 2916068649 2916073426 412
234 iso_pu_bacteria 2917554339 2917557840 412
235 iso_pu_bacteria 2919166419 2919166783 412
236 iso_pu_bacteria 2919679072 2919681488 412
237 iso_pu_bacteria 2921208531 2921209696 412
238 iso_pu_bacteria 2921237296 2921239279 412
239 iso_pu_bacteria 2921244191 2921247813 412
240 iso_pu_bacteria 2921250672 2921251670 412
241 iso_pu_bacteria 2921257292 2921262633 412
242 iso_pu_bacteria 2921263974 2921269634 412
243 iso_pu_bacteria 2921282425 2921287153 412
244 iso_pu_bacteria 2921289301 2921294099 412
245 iso_pu_bacteria 2921296804 2921300510 412
246 iso_pu_bacteria 2924144063 2924148563 412
247 iso_pu_bacteria 2924150972 2924151510 412
248 iso_pu_bacteria 2924150972 2924151817 412
249 iso_pu_bacteria 2924158325 2924159906 412
250 iso_pu_bacteria 2924165586 2924167534 412
251 iso_pu_bacteria 2924172951 2924174475 412
252 iso_pu_bacteria 2924179722 2924183746 412
253 iso_pu_bacteria 2924186466 2924193110 412
254 iso_pu_bacteria 2924193448 2924196460 412
255 iso_pu_bacteria 2924200457 2924203910 412
256 iso_pu_bacteria 2924207177 2924210821 412
257 iso_pu_bacteria 2924207177 2924212949 412
258 iso_pu_bacteria 2924214083 2924218199 412
259 iso_pu_bacteria 2924221636 2924227400 412
260 iso_pu_bacteria 2924228884 2924233251 412
261 iso_pu_bacteria 2936996657 2937002777 412
262 iso_pu_bacteria 2937002841 2937005342 412
263 iso_pu_bacteria 2937009748 2937012877 412
264 iso_pu_bacteria 2937016420 2937021857 412
265 iso_pu_bacteria 2937023124 2937027352 412
266 iso_pu_bacteria 2937029754 2937035652 412
267 iso_pu_bacteria 2937042894 2937043854 412
268 iso_pu_bacteria 2937049772 2937050299 412
269 iso_pu_bacteria 2937056579 2937058364 412
270 iso_pu_bacteria 2937063883 2937068677 412
271 iso_pu_bacteria 2937071275 2937072398 412
272 iso_pu_bacteria 2937078374 2937080714 412
273 iso_pu_bacteria 2937091812 2937097418 412
274 iso_pu_bacteria 2937098957 2937101133 412
275 iso_pu_bacteria 2937106411 2937110230 412
276 iso_pu_bacteria 2937113482 2937117665 412
277 iso_pu_bacteria 2937119839 2937124497 412
278 iso_pu_bacteria 2937126314 2937131443 412
279 iso_pu_bacteria 2937822353 2937824437 412
280 iso_pu_bacteria 2937836603 2937839369 412
281 iso_pu_bacteria 2937843397 2937848080 412
282 iso_pu_bacteria 2937848649 2937851841 412
283 iso_pu_bacteria 2937861824 2937865310 412
284 iso_pu_bacteria 2937877337 2937882139 412
285 iso_pu_bacteria 2937972304 2937978599 412
286 iso_pu_bacteria 2937980651 2937984712 412
287 iso_pu_bacteria 2938014810 2938016090 412
288 iso_pu_bacteria 2939669807 2939672554 412
289 iso_pu_bacteria 2941499720 2941504588 412
290 iso_pu_bacteria 2957375807 2957380673 412
291 iso_pu_bacteria 2957382221 2957382530 412
292 iso_pu_bacteria 2957388812 2957389490 412
293 iso_pu_bacteria 2957395598 2957397269 412
294 iso_pu_bacteria 2957402308 2957408333 412
295 iso_pu_bacteria 2957408893 2957412911 412
296 iso_pu_bacteria 2957415311 2957418954 412
297 iso_pu_bacteria 2957422303 2957426783 412
298 iso_pu_bacteria 2957430029 2957435892 412
299 iso_pu_bacteria 2957450854 2957455318 412
300 iso_pu_bacteria 2957457609 2957460438 412
301 iso_pu_bacteria 2957464669 2957468832 412
302 iso_pu_bacteria 2957471148 2957472909 412
303 iso_pu_bacteria 2957478035 2957483573 412
304 iso_pu_bacteria 2957484790 2957489166 412
305 iso_pu_bacteria 2957491536 2957497977 412
306 iso_pu_bacteria 2957498199 2957501705 412
307 iso_pu_bacteria 2958034702 2958040617 412
308 iso_pu_bacteria 2958041894 2958056699 412
309 iso_pu_bacteria 2958064165 2958064390 412
310 iso_pu_bacteria 2958071322 2958072106 412
311 iso_pu_bacteria 2958084443 2958089261 412
312 iso_pu_bacteria 2958092219 2958096811 412
313 iso_pu_bacteria 2958122699 2958127562 412
314 iso_pu_bacteria 2958144490 2958149181 412
315 iso_pu_bacteria 2958158011 2958161819 412
316 iso_pu_bacteria 2960584000 2960586178 412
317 iso_pu_bacteria 2960597568 2960602093 412
318 iso_pu_bacteria 2960603979 2960610431 412
319 iso_pu_bacteria 2960617483 2960618009 412
320 iso_pu_bacteria 2960631154 2960634028 412
321 iso_pu_bacteria 2960637947 2960638962 412
322 iso_pu_bacteria 2960645483 2960651126 412
323 iso_pu_bacteria 2960652885 2960658497 412
324 iso_pu_bacteria 2960667422 2960670738 412
325 iso_pu_bacteria 2960674078 2960675873 412
326 iso_pu_bacteria 2960680706 2960680789 412
327 iso_pu_bacteria 2960693952 2960696570 412
328 iso_pu_bacteria 2961127735 2961130360 412
329 iso_pu_bacteria 2961136820 2961137463 412
330 iso_pu_bacteria 2961170736 2961176063 412
331 iso_pu_bacteria 2961183825 2961187970 412
332 iso_pu_bacteria 2963644680 2963647694 412
333 iso_pu_bacteria 2964607997 2964614175 412
334 iso_pu_bacteria 2964615318 2964617158 412
335 iso_pu_bacteria 2964621998 2964622765 412
336 iso_pu_bacteria 2964628898 2964632823 412
337 iso_pu_bacteria 2964636051 2964637893 412
338 iso_pu_bacteria 2964636051 2964639130 412
339 iso_pu_bacteria 2964643177 2964646262 412
340 iso_pu_bacteria 2964649959 2964651235 412
341 iso_pu_bacteria 2964656573 2964663320 412
342 iso_pu_bacteria 2964663802 2964667652 412
343 iso_pu_bacteria 2964663802 2964669750 412
344 iso_pu_bacteria 2964670856 2964673320 412
345 iso_pu_bacteria 2964678106 2964680033 412
346 iso_pu_bacteria 2964685014 2964689207 412
347 iso_pu_bacteria 2964691889 2964694817 412
348 iso_pu_bacteria 2964698721 2964699324 412
349 iso_pu_bacteria 2964705432 2964706486 412
350 iso_pu_bacteria 2964712639 2964718778 412
351 iso_pu_bacteria 2964719344 2964722228 412
352 iso_pu_bacteria 2965025482 2965031767 412
353 iso_pu_bacteria 2965032056 2965034360 412
354 iso_pu_bacteria 2965047637 2965052818 412
355 iso_pu_bacteria 2965089291 2965093312 412
356 iso_pu_bacteria 2965110997 2965115040 412
357 iso_pu_bacteria 2967664464 2967666729 412
358 iso_pu_bacteria 2967671571 2967673245 412
359 iso_pu_bacteria 2967678726 2967685836 412
360 iso_pu_bacteria 2967686174 2967690025 412
361 iso_pu_bacteria 2967693043 2967699045 412
362 iso_pu_bacteria 2967699805 2967702242 412
363 iso_pu_bacteria 2967706974 2967712884 412
364 iso_pu_bacteria 2967714385 2967720399 412
365 iso_pu_bacteria 2967721400 2967722377 412
366 iso_pu_bacteria 2967735183 2967739876 412
367 iso_pu_bacteria 2967742019 2967744917 412
368 iso_pu_bacteria 2967748971 2967749319 412
369 iso_pu_bacteria 2967755722 2967759639 412
370 iso_pu_bacteria 2967762386 2967763607 412
371 iso_pu_bacteria 2967769361 2967772715 412
372 iso_pu_bacteria 2967775926 2967776367 412
373 iso_pu_bacteria 2967996073 2968001950 412
374 iso_pu_bacteria 2968003550 2968009026 412
375 iso_pu_bacteria 2968016561 2968018466 412
376 iso_pu_bacteria 2968083720 2968090325 412
377 iso_pu_bacteria 2968138860 2968146032 412
378 iso_pu_bacteria 2970019648 2970024305 412
379 iso_pu_bacteria 2970026789 2970027567 412
380 iso_pu_bacteria 2970033650 2970035994 412
381 iso_pu_bacteria 2970040964 2970045188 412
382 iso_pu_bacteria 2970047711 2970049053 412
383 iso_pu_bacteria 2970054988 2970056238 412
384 iso_pu_bacteria 2970061556 2970066034 412
385 iso_pu_bacteria 2970068827 2970071003 412
386 iso_pu_bacteria 2970076120 2970079433 412
387 iso_pu_bacteria 2970082768 2970084599 412
388 iso_pu_bacteria 2970088815 2970094261 412
389 iso_pu_bacteria 2970095765 2970097189 412
390 iso_pu_bacteria 2970102677 2970103956 412
391 iso_pu_bacteria 2970109326 2970111882 412
392 iso_pu_bacteria 2970116247 2970120571 412
393 iso_pu_bacteria 2970129317 2970135864 412
394 iso_pu_bacteria 2970136068 2970141798 412
395 iso_pu_bacteria 2970149975 2970152469 412
396 iso_pu_bacteria 2970156795 2970162620 412
397 iso_pu_bacteria 2970164137 2970168287 412
398 iso_pu_bacteria 2970170962 2970172682 412
399 iso_pu_bacteria 2970184632 2970186256 412
400 iso_pu_bacteria 2970191845 2970196137 412
401 iso_pu_bacteria 2970469710 2970471361 412
402 iso_pu_bacteria 2970489779 2970492898 412
403 iso_pu_bacteria 2970503327 2970508729 412
404 iso_pu_bacteria 2970510686 2970511075 412
405 iso_pu_bacteria 2970524798 2970528578 412
406 iso_pu_bacteria 2970547951 2970552038 412
407 iso_pu_bacteria 2970593180 2970599530 412
408 iso_pu_bacteria 2970619444 2970621216 412
409 iso_pu_bacteria 2970627176 2970630717 412
410 iso_pu_bacteria 2977523885 2977524428 412
411 iso_pu_bacteria 2977537788 2977543325 412
412 iso_pu_bacteria 2977544691 2977549655 412
413 iso_pu_bacteria 2977551784 2977553037 412
414 iso_pu_bacteria 2977558990 2977559942 412
415 iso_pu_bacteria 2977565890 2977568833 412
416 iso_pu_bacteria 2977572785 2977574075 412
417 iso_pu_bacteria 2977579622 2977585934 412
418 iso_pu_bacteria 2977821940 2977827399 412
419 iso_pu_bacteria 2977828996 2977832829 412
420 iso_pu_bacteria 2977851361 2977857731 412
421 iso_pu_bacteria 2977872689 2977873003 412
422 iso_pu_bacteria 2977898635 2977900429 412
423 iso_pu_bacteria 2977907340 2977908960 412
424 iso_pu_bacteria 2977915119 2977922626 412
425 iso_pu_bacteria 2977922695 2977924202 412
426 iso_pu_bacteria 2977935797 2977936029 412
427 iso_pu_bacteria 2977950692 2977954917 412
428 iso_pu_bacteria 2977986579 2977987418 412
429 iso_pu_bacteria 2979772303 2979777413 412
430 iso_pu_bacteria 2979793036 2979796432 412
431 iso_pu_bacteria 2979808191 2979811623 412
432 iso_pu_bacteria 2987666974 2987669264 412
433 iso_pu_bacteria 2987673487 2987677952 412
434 iso_pu_bacteria 2989771324 2989773325 412
435 iso_pu_bacteria 2996310559 2996314088 412
436 iso_pu_bacteria 2996336353 2996339079 412
437 iso_pu_bacteria 2996348954 2996350153 412
438 iso_pu_bacteria 2996386984 2996391461 412
439 iso_pu_bacteria 3000135777 3000140679 412
440 iso_pu_bacteria 3000405567 3000407583 412
441 iso_pu_bacteria 3004167301 3004168881 412
442 iso_pu_bacteria 3004195979 3004198029 412
443 iso_pu_bacteria 3004211236 3004215937 412
444 iso_pu_bacteria 3004218560 3004223687 412
445 iso_pu_bacteria 3004232784 3004239528 412
446 iso_pu_bacteria 3004239961 3004240715 412
447 iso_pu_bacteria 3004248173 3004248995 412
448 iso_pu_bacteria 3004268573 3004274927 412
449 iso_pu_bacteria 3004275668 3004276852 412
450 iso_pu_bacteria 3004334049 3004334377 412
451 iso_pu_bacteria 637000159 637074618 412
452 iso_pu_bacteria 648276728 648739515 412
453 iso_pu_bacteria 649633066 649872958 412
454 iso_pu_bacteria 8002285264 8002289058 412
455 iso_pu_bacteria 8003992118 8003994452 412
456 iso_pu_bacteria 8004300914 8004302604 412
457 iso_pu_bacteria 8004312739 8004319028 412
458 iso_pu_bacteria 8004374579 8004380380 412
459 iso_pu_bacteria 8004633249 8004635779 412
460 iso_pu_bacteria 8004640170 8004640839 412
461 iso_pu_bacteria 8004695233 8004699639 412
462 iso_pu_bacteria 8004727605 8004729813 412
463 iso_pu_bacteria 8054558443 8054561897 412
464 iso_pu_bacteria 8055617313 8055620762 412
465 iso_pu_bacteria 2515154113 2515635260 413
466 iso_pu_bacteria 2582581283 2585167576 413
467 iso_pu_bacteria 2585427594 2585847717 413
468 iso_pu_bacteria 2643221550 2643771125 413
469 iso_pu_bacteria 2643221653 2644299005 413
470 iso_pu_bacteria 2643221689 2644500635 413
471 iso_pu_bacteria 2643221719 2644657233 413
472 iso_pu_bacteria 2671180139 2671695419 413
473 iso_pu_bacteria 2818991272 2819240980 413
474 iso_pu_bacteria 2854896431 2854900522 413
475 iso_pu_bacteria 8005246636 8005249813 413
476 iso_pu_bacteria 8056875544 8056875950 413
477 3300003578 Ga0006562J51391_1041354 Ga0006562J51391_10413541 414
478 3300005262 Ga0065165_1000593 Ga0065165_100059327 414
479 3300005985 Ga0081539_10001979 Ga0081539_1000197918 414
480 3300006948 Ga0099826_10002800 Ga0099826_100028008 414
481 3300013100 Ga0157373_10008186 Ga0157373_100081867 414
482 3300013104 Ga0157370_10000295 Ga0157370_1000029543 414
483 3300025302 Ga0207426_1000110 Ga0207426_1000110106 414
484 3300027666 Ga0209282_1001136 Ga0209282_10011369 414
485 3300027866 Ga0209813_10004514 Ga0209813_100045142 414
486 3300031995 Ga0307409_100351518 Ga0307409_1003515181 414
487 3300032002 Ga0307416_100265920 Ga0307416_1002659202 414
488 3300046463 Ga0495653_0011308 Ga0495653_0011308_675_1922 414
489 3300046472 Ga0495580_0003886 Ga0495580_0003886_3868_5115 414
490 3300046473 Ga0495582_0051778 Ga0495582_0051778_179_1426 414
491 3300046660 Ga0495625_0034069 Ga0495625_0034069_289_1536 414
492 3300046690 Ga0495624_0002886 Ga0495624_0002886_7519_8766 414
493 3300047319 Ga0495674_0005116 Ga0495674_0005116_7499_8746 414
494 3300047673 Ga0495593_0002879 Ga0495593_0002879_3460_4707 414
495 3300048922 Ga0496119_0000627 Ga0496119_0000627_46012_47259 414
496 3300049822 Ga0501035_0056534 Ga0501035_0056534_1986_3233 414
497 3300053104 Ga0500556_0000119 Ga0500556_0000119_15948_17195 414
498 iso_pu_bacteria 2854681122 2854681688 414
499 iso_pu_bacteria 2928157003 2928157343 414
500 iso_pu_bacteria 2928163908 2928165189 414
501 iso_pu_bacteria 2981990288 2981990326 414
502 iso_pu_bacteria 641736154 642419829 414
503 3300002987 JGI25159J45721_1000008 JGI25159J45721_100000890 415
504 3300003354 JGI25160J50197_1000033 JGI25160J50197_100003385 415
505 3300003374 JGI25161J50226_1001306 JGI25161J50226_10013063 415
506 3300003762 Ga0055542_1000601 Ga0055542_100060125 415
507 3300003771 Ga0055526_1000653 Ga0055526_100065314 415
508 3300003775 Ga0055524_1003306 Ga0055524_10033061 415
509 3300003781 Ga0055536_1011754 Ga0055536_10117541 415
510 3300004625 Ga0055543_1000026 Ga0055543_100002655 415
511 3300005262 Ga0065165_1000178 Ga0065165_100017885 415
512 3300006177 Ga0075362_10002360 Ga0075362_100023606 415
513 3300009551 Ga0105238_10107124 Ga0105238_101071243 415
514 3300014325 Ga0163163_10001353 Ga0163163_1000135320 415
515 3300015690 Ga0183363_1084 Ga0183363_108411 415
516 3300022739 Ga0228711_1000017 Ga0228711_100001776 415
517 3300022740 Ga0228710_1000005 Ga0228710_1000005177 415
518 3300025250 Ga0209026_1000025 Ga0209026_1000025113 415
519 3300025254 Ga0209148_1000181 Ga0209148_100018177 415
520 3300025256 Ga0209759_1000121 Ga0209759_1000121119 415
521 3300025261 Ga0209233_1000010 Ga0209233_1000010294 415
522 3300025272 Ga0209455_1000127 Ga0209455_100012777 415
523 3300025284 Ga0209130_1000017 Ga0209130_100001792 415
524 3300025292 Ga0209676_1001868 Ga0209676_100186811 415
525 3300025294 Ga0209025_1000153 Ga0209025_100015385 415
526 3300025295 Ga0209564_1000013 Ga0209564_1000013541 415
527 3300025298 Ga0209050_1003752 Ga0209050_10037528 415
528 3300025299 Ga0209256_1000211 Ga0209256_100021132 415
529 3300025302 Ga0207426_1000006 Ga0207426_100000691 415
530 3300025303 Ga0209051_1012412 Ga0209051_10124121 415
531 3300025911 Ga0207654_10041286 Ga0207654_100412861 415
532 3300025919 Ga0207657_10118488 Ga0207657_101184882 415
533 3300027111 Ga0209281_1000082 Ga0209281_1000082125 415
534 3300027666 Ga0209282_1000006 Ga0209282_1000006147 415
535 3300028379 Ga0268266_10141284 Ga0268266_101412841 415
536 3300031241 Ga0265325_10050911 Ga0265325_100509112 415
537 3300031247 Ga0265340_10003569 Ga0265340_100035696 415
538 3300031249 Ga0265339_10004620 Ga0265339_100046203 415
539 3300031249 Ga0265339_10048153 Ga0265339_100481532 415
540 3300031711 Ga0265314_10063514 Ga0265314_100635142 415
541 3300031711 Ga0265314_10128334 Ga0265314_101283342 415
542 3300031712 Ga0265342_10006322 Ga0265342_100063224 415
543 3300031712 Ga0265342_10066289 Ga0265342_100662892 415
544 3300031967 Ga0315914_1000003 Ga0315914_1000003202 415
545 3300031995 Ga0307409_100089557 Ga0307409_1000895573 415
546 3300033430 Ga0315913_1000001 Ga0315913_1000001153 415
547 3300033464 Ga0315915_1000008 Ga0315915_1000008134 415
548 3300037418 Ga0395900_0051845 Ga0395900_0051845_1639_2889 415
549 3300038443 Ga0395901_0073867 Ga0395901_0073867_1192_2442 415
550 3300039062 Ga0400483_181595 Ga0400483_181595_2883_4133 415
551 3300045051 Ga0451576_0000819 Ga0451576_0000819_1798_3048 415
552 3300046460 Ga0495638_0006070 Ga0495638_0006070_4872_6122 415
553 3300047472 Ga0495686_0141618 Ga0495686_0141618_25_1275 415
554 3300048903 Ga0496100_0056513 Ga0496100_0056513_1171_2421 415
555 3300048904 Ga0496101_0213250 Ga0496101_0213250_119_1369 415
556 3300048907 Ga0496104_0024704 Ga0496104_0024704_3323_4573 415
557 3300048908 Ga0496105_0001686 Ga0496105_0001686_12124_13374 415
558 3300048911 Ga0496108_0010872 Ga0496108_0010872_3741_4991 415
559 3300048912 Ga0496109_0001851 Ga0496109_0001851_4783_6033 415
560 3300048913 Ga0496110_0012143 Ga0496110_0012143_4413_5663 415
561 3300048913 Ga0496110_0272663 Ga0496110_0272663_214_1464 415
562 3300048914 Ga0496111_0001765 Ga0496111_0001765_5819_7069 415
563 3300048915 Ga0496112_0021096 Ga0496112_0021096_1488_2738 415
564 3300048916 Ga0496113_0000296 Ga0496113_0000296_16918_18168 415
565 3300048917 Ga0496114_0047222 Ga0496114_0047222_712_1962 415
566 3300048918 Ga0496115_0111485 Ga0496115_0111485_56_1306 415
567 3300048920 Ga0496117_0020840 Ga0496117_0020840_883_2133 415
568 3300048925 Ga0496122_0001309 Ga0496122_0001309_8772_10022 415
569 3300048926 Ga0496123_0002726 Ga0496123_0002726_11168_12418 415
570 3300048927 Ga0496124_0001796 Ga0496124_0001796_23935_25185 415
571 3300048928 Ga0496125_0001869 Ga0496125_0001869_4086_5336 415
572 3300048928 Ga0496125_0079806 Ga0496125_0079806_1027_2277 415
573 3300048929 Ga0496126_0003175 Ga0496126_0003175_5539_6789 415
574 3300048929 Ga0496126_0005266 Ga0496126_0005266_12789_14039 415
575 3300049569 Ga0501032_0136126 Ga0501032_0136126_149_1399 415
576 3300049571 Ga0501034_0000012 Ga0501034_0000012_140947_142197 415
577 3300049571 Ga0501034_0186991 Ga0501034_0186991_305_1555 415
578 3300049581 Ga0501047_0157039 Ga0501047_0157039_38_1288 415
579 3300049581 Ga0501047_0185322 Ga0501047_0185322_138_1388 415
580 3300049586 Ga0501070_0093578 Ga0501070_0093578_738_1988 415
581 3300049742 Ga0501080_0063284 Ga0501080_0063284_1964_3214 415
582 3300049744 Ga0501083_0081740 Ga0501083_0081740_471_1721 415
583 3300049744 Ga0501083_0101226 Ga0501083_0101226_330_1580 415
584 3300050489 nmdc:mga03683_17876_c1 nmdc:mga03683_17876_c1_1050_2300 415
585 3300050492 nmdc:mga0yw44_11833_c1 nmdc:mga0yw44_11833_c1_1202_2452 415
586 3300050494 nmdc:mga06z11_31134_c1 nmdc:mga06z11_31134_c1_541_1791 415
587 3300050496 nmdc:mga07m45_56651_c1 nmdc:mga07m45_56651_c1_129_1379 415
588 3300053153 Ga0500616_0056828 Ga0500616_0056828_530_1780 415
589 3300053727 Ga0500611_008552 Ga0500611_008552_154_1404 415
590 3300002773 JGI25152J39213_1002234 JGI25152J39213_10022347 416
591 3300002774 JGI25150J39212_1000091 JGI25150J39212_100009123 416
592 3300003187 JGI25151J46595_10000027 JGI25151J46595_1000002736 416
593 3300009093 Ga0105240_10015102 Ga0105240_100151027 416
594 3300025245 Ga0207425_1000043 Ga0207425_100004335 416
595 3300025256 Ga0209759_1016098 Ga0209759_10160981 416
596 3300025258 Ga0209129_1000072 Ga0209129_1000072159 416
597 3300025294 Ga0209025_1000120 Ga0209025_1000120159 416
598 3300025297 Ga0209758_1000111 Ga0209758_1000111160 416
599 3300025913 Ga0207695_10011863 Ga0207695_100118635 416
600 3300028379 Ga0268266_10039615 Ga0268266_100396153 416
601 3300028794 Ga0307515_10107881 Ga0307515_101078813 416
602 3300037471 Ga0395905_0000131 Ga0395905_0000131_22643_23896 416
603 3300039062 Ga0400483_075845 Ga0400483_075845_463_1725 416
604 3300039062 Ga0400483_164765 Ga0400483_164765_166_1428 416
605 3300046809 Ga0495600_0039143 Ga0495600_0039143_566_1819 416
606 3300047317 Ga0495604_0047267 Ga0495604_0047267_617_1870 416
607 3300048919 Ga0496116_0014973 Ga0496116_0014973_1619_2872 416
608 3300048920 Ga0496117_0018549 Ga0496117_0018549_2124_3377 416
609 3300048926 Ga0496123_0008841 Ga0496123_0008841_1650_2942 416
610 3300048927 Ga0496124_0035242 Ga0496124_0035242_2551_3804 416
611 3300053140 Ga0500573_0006858 Ga0500573_0006858_4526_5821 416
612 iso_pu_bacteria 2915650412 2915651044 416
613 iso_pu_bacteria 8057132660 8057134119 416
614 3300013105 Ga0157369_10142156 Ga0157369_101421562 417
615 3300048919 Ga0496116_0000100 Ga0496116_0000100_89985_91283 417
616 3300048919 Ga0496116_0024233 Ga0496116_0024233_2747_4042 417
617 3300048920 Ga0496117_0016935 Ga0496117_0016935_4108_5403 417
618 3300048925 Ga0496122_0092212 Ga0496122_0092212_210_1508 417
619 3300048926 Ga0496123_0055586 Ga0496123_0055586_157_1455 417
620 3300048927 Ga0496124_0009377 Ga0496124_0009377_2747_4042 417
621 3300048929 Ga0496126_0000094 Ga0496126_0000094_204380_205678 417
622 3300053140 Ga0500573_0000633 Ga0500573_0000633_1815_3263 417
623 3300053177 Ga0500636_0000176 Ga0500636_0000176_24239_25546 417
624 iso_pu_bacteria 2582581304 2585259131 417
625 3300001989 JGI24739J22299_10013429 JGI24739J22299_100134292 418
626 3300002067 JGI24735J21928_10019873 JGI24735J21928_100198732 418
627 3300003758 Ga0055532_1001277 Ga0055532_10012773 418
628 3300003760 Ga0055527_1000200 Ga0055527_10002006 418
629 3300003761 Ga0055535_1000927 Ga0055535_100092715 418
630 3300003762 Ga0055542_1002795 Ga0055542_10027954 418
631 3300005339 Ga0070660_100000243 Ga0070660_1000002438 418
632 3300005366 Ga0070659_100000007 Ga0070659_100000007141 418
633 3300005577 Ga0068857_100278561 Ga0068857_1002785611 418
634 3300005616 Ga0068852_100088943 Ga0068852_1000889432 418
635 3300009551 Ga0105238_10019737 Ga0105238_100197374 418
636 3300015265 Ga0182005_1003792 Ga0182005_10037924 418
637 3300025228 Ga0209672_100015 Ga0209672_100015261 418
638 3300025229 Ga0209147_100016 Ga0209147_100016203 418
639 3300025242 Ga0209258_100026 Ga0209258_100026261 418
640 3300025254 Ga0209148_1001668 Ga0209148_100166810 418
641 3300025272 Ga0209455_1000331 Ga0209455_100033115 418
642 3300025913 Ga0207695_10018023 Ga0207695_100180233 418
643 3300025919 Ga0207657_10000532 Ga0207657_100005328 418
644 3300025932 Ga0207690_10000008 Ga0207690_10000008164 418
645 3300025949 Ga0207667_10017571 Ga0207667_100175714 418
646 3300026067 Ga0207678_10000585 Ga0207678_100005857 418
647 3300047323 Ga0495683_0003395 Ga0495683_0003395_6349_7632 418
648 iso_pu_bacteria 2855020534 2855023339 418

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01546

Peptidase_M20

Peptidase family M20/M25/M40

149

476

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
5thw-assembly2.cif.gz_D crystal structure of amidase, hydantoinase/carbamoylase family from burkholderia multivorans 0.9807 10 414
5thw-assembly2.cif.gz_D crystal structure of amidase, hydantoinase/carbamoylase family from burkholderia multivorans 0.9643 10 414
5tp4-assembly1.cif.gz_A crystal structure of a hydantoinase/carbamoylase family amidase from burkholderia ambifaria 0.9639 10 417
5tp4-assembly1.cif.gz_A crystal structure of a hydantoinase/carbamoylase family amidase from burkholderia ambifaria 0.9546 10 417
4wjb-assembly1.cif.gz_D x-ray crystal structure of a putative amidohydrolase/peptidase from burkholderia cenocepacia 0.9543 8 415
ID Description Score Start End Superfamily
5i4mA02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.991 217 329 3.30.70.360
5i4mB01 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.9758 10 414 3.40.630.10
af_C0P5R8_269_385_3.40.630.10 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.9733 217 330 3.40.630.10
3n5fB02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9728 217 330 3.30.70.360
5i4mA02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9655 217 329 3.30.70.360
ID Description Score Start End GO Terms
AF-A0A382V0H9-F1-model_v4 Zn-dependent hydrolase 1.002 8 112 GO:0016813
AF-A0A356HR59-F1-model_v4 deleted 1 8 135
AF-X1QY92-F1-model_v4 Peptidase M20 dimerisation domain-containing protein 0.9953 10 131 GO:0016813
AF-A0A6I2IWC1-F1-model_v4 deleted 0.9942 217 292
AF-A0A0B4CDR3-F1-model_v4 Allantoate amidohydrolase 0.9895 10 412 GO:0016813
GO:0046872

Feature Viewer

pLDDT pTM Quality
93.87 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map