F472364

General Info

Members Datasets Scaffolds Average Seq Length
648 257 1296 160

Family's Representative Sequence

Representative Sequence 3300009177|Ga0105248_10397906|Ga0105248_103979061
Length 194
Sequence LVVEKKSWPDRGADSGNLITVELCCESLGGFRVASIKFTLNGKPQTVDAVPEMPLLWVLRDTLNMTGTKFGCGMALCGACTVHINGDAVRSCITPIQNVAGKTVTTIEGLSADGSHPVQQAWVEQDVPQCGYCQSGQIMSAASLLSKKTQPTDSDIDEAMRGNICRCGTYGHIRTAIHRAAELASVAKVQGGKV

Samples

Sample ID Description Type Environment
1 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
22 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
25 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
26 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
27 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
33 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
34 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
35 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
36 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
42 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
48 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
53 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
54 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
55 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
56 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
57 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
58 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
59 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
60 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
61 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
63 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
64 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
65 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
66 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
67 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
68 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
70 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
71 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
72 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
73 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
74 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
75 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
77 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
78 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
79 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
80 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
81 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
82 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
83 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
84 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
85 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
86 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
87 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
88 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
89 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
90 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
91 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
92 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
93 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
94 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
95 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
96 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
97 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
98 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
99 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
100 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
101 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
102 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
156 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
157 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
158 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
159 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
160 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
161 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
162 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
163 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
164 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
165 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
166 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
167 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
168 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
169 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
170 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
171 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
172 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
173 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
174 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
175 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
176 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
177 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
178 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
179 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
180 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
181 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
182 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
183 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
184 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
185 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
186 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
187 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
188 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
189 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
190 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
191 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
192 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
193 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
194 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
195 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
196 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
197 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
198 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
199 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
200 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
201 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
202 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
203 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
204 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
205 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
206 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
207 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
208 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
209 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
210 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
211 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
212 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
213 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
214 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
215 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
216 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
217 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
218 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
219 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
220 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
221 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
222 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
223 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
224 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
225 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
226 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
227 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
228 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
229 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
230 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
231 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
232 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
233 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
234 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
235 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
236 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
237 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
238 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
239 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
240 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
241 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
242 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
243 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
244 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
245 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
246 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
247 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
248 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
249 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
250 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
251 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
252 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
253 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
254 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
255 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
256 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
257 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.92
Metatranscriptomes 1.08
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.16
Rhizosphere 97.53
Stem 0
Stem Tuber 0
Unclassified 0.15

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105248_10397906 3300009177 Bacteria 1551
2 Ga0065715_10261102 3300005293 Bacteria 1138
3 Ga0070658_10124585 3300005327 Bacteria 2144
4 Ga0070676_10434054 3300005328 Bacteria 920
5 Ga0070683_100000049 3300005329 Bacteria 93310
6 Ga0070683_100796960 3300005329 Bacteria 906
7 Ga0070683_100879282 3300005329 Bacteria 859
8 Ga0070683_101296880 3300005329 Bacteria 700
9 Ga0070683_101982322 3300005329 Bacteria 559
10 Ga0070670_100139167 3300005331 Bacteria 2099
11 Ga0070670_100581120 3300005331 Bacteria 1001
12 Ga0068869_101662778 3300005334 Bacteria 569
13 Ga0070666_10004972 3300005335 Bacteria 8127
14 Ga0070666_10188003 3300005335 Bacteria 1450
15 Ga0070680_100299658 3300005336 Bacteria 1363
16 Ga0070682_100800249 3300005337 Bacteria 766
17 Ga0068868_100047108 3300005338 Bacteria 3377
18 Ga0068868_100054696 3300005338 Bacteria 3146
19 Ga0068868_100086900 3300005338 Bacteria 2514
20 Ga0068868_100170506 3300005338 Bacteria 1801
21 Ga0068868_100281435 3300005338 Bacteria 1408
22 Ga0068868_101029309 3300005338 Bacteria 755
23 Ga0070660_100037406 3300005339 Bacteria 3679
24 Ga0070660_100091902 3300005339 Bacteria 2395
25 Ga0070660_100132930 3300005339 Bacteria 1992
26 Ga0070660_100731078 3300005339 Bacteria 831
27 Ga0070689_100098961 3300005340 Bacteria 2307
28 Ga0070691_10049098 3300005341 Bacteria 2010
29 Ga0070691_10261864 3300005341 Bacteria 931
30 Ga0070661_100134913 3300005344 Bacteria 1856
31 Ga0070661_100675917 3300005344 Bacteria 840
32 Ga0070668_100295962 3300005347 Bacteria 1356
33 Ga0070671_100022163 3300005355 Bacteria 5189
34 Ga0070671_100061375 3300005355 Bacteria 3131
35 Ga0070671_100534827 3300005355 Bacteria 1010
36 Ga0070671_100612643 3300005355 Bacteria 941
37 Ga0070673_100182112 3300005364 Bacteria 1799
38 Ga0070659_100004814 3300005366 Bacteria 9645
39 Ga0070659_100056262 3300005366 Bacteria 3102
40 Ga0070659_100587361 3300005366 Bacteria 956
41 Ga0070667_100181526 3300005367 Bacteria 1861
42 Ga0070667_100820678 3300005367 Bacteria 864
43 Ga0070709_10036969 3300005434 Bacteria 2978
44 Ga0070709_10164627 3300005434 Bacteria 1545
45 Ga0070709_11053631 3300005434 Bacteria 649
46 Ga0070714_100214592 3300005435 Bacteria 1766
47 Ga0070714_100596050 3300005435 Bacteria 1061
48 Ga0070713_100040221 3300005436 Bacteria 3800
49 Ga0070713_100060040 3300005436 Bacteria 3178
50 Ga0070713_100179274 3300005436 Bacteria 1903
51 Ga0070713_100322473 3300005436 Bacteria 1427
52 Ga0070713_100569249 3300005436 Bacteria 1074
53 Ga0070710_10479288 3300005437 Bacteria 848
54 Ga0070711_100268594 3300005439 Bacteria 1345
55 Ga0070711_100376522 3300005439 Bacteria 1147
56 Ga0070711_100510014 3300005439 Bacteria 993
57 Ga0070711_100764171 3300005439 Bacteria 817
58 Ga0070711_101076795 3300005439 Bacteria 692
59 Ga0070705_100395175 3300005440 Bacteria 1022
60 Ga0070708_100141162 3300005445 Bacteria 2234
61 Ga0070708_100185097 3300005445 Bacteria 1947
62 Ga0070708_100903873 3300005445 Bacteria 829
63 Ga0070663_100462077 3300005455 Bacteria 1048
64 Ga0070662_100507358 3300005457 Bacteria 1007
65 Ga0070681_10215413 3300005458 Bacteria 1837
66 Ga0070681_10969856 3300005458 Bacteria 770
67 Ga0068867_101496267 3300005459 Bacteria 628
68 Ga0070685_10642112 3300005466 Bacteria 768
69 Ga0070685_10645942 3300005466 Bacteria 766
70 Ga0070706_100066065 3300005467 Bacteria 3345
71 Ga0070706_100434358 3300005467 Bacteria 1222
72 Ga0070706_101055358 3300005467 Bacteria 748
73 Ga0070706_101644436 3300005467 Bacteria 585
74 Ga0070707_100003828 3300005468 Bacteria 14183
75 Ga0070707_100014125 3300005468 Bacteria 7483
76 Ga0070707_100140925 3300005468 Bacteria 2346
77 Ga0070707_100183183 3300005468 Bacteria 2042
78 Ga0070707_100246732 3300005468 Bacteria 1738
79 Ga0070707_100630092 3300005468 Bacteria 1035
80 Ga0070698_100025715 3300005471 Bacteria 6132
81 Ga0070698_100564158 3300005471 Bacteria 1078
82 Ga0070699_100680499 3300005518 Bacteria 939
83 Ga0070679_100313704 3300005530 Bacteria 1518
84 Ga0070679_100338156 3300005530 Bacteria 1454
85 Ga0070679_100753632 3300005530 Bacteria 916
86 Ga0070684_100000040 3300005535 Bacteria 93306
87 Ga0070684_100044093 3300005535 Bacteria 3856
88 Ga0070684_100111784 3300005535 Bacteria 2450
89 Ga0070684_100213005 3300005535 Bacteria 1761
90 Ga0070684_101098182 3300005535 Bacteria 747
91 Ga0070697_100001104 3300005536 Bacteria 20398
92 Ga0070697_100333727 3300005536 Bacteria 1307
93 Ga0068853_100235016 3300005539 Bacteria 1678
94 Ga0068853_100385464 3300005539 Bacteria 1309
95 Ga0068853_100665786 3300005539 Bacteria 991
96 Ga0070695_101635922 3300005545 Bacteria 538
97 Ga0070696_100272702 3300005546 Bacteria 1287
98 Ga0070665_100001236 3300005548 Bacteria 31039
99 Ga0070665_100099539 3300005548 Bacteria 2911
100 Ga0070665_100279112 3300005548 Bacteria 1672
101 Ga0070665_100693014 3300005548 Bacteria 1032
102 Ga0068855_100075884 3300005563 Bacteria 3902
103 Ga0068855_100222186 3300005563 Bacteria 2117
104 Ga0070664_100111552 3300005564 Bacteria 2387
105 Ga0070664_100440518 3300005564 Bacteria 1195
106 Ga0070664_100494990 3300005564 Bacteria 1126
107 Ga0068857_100017791 3300005577 Bacteria 6231
108 Ga0068857_100511355 3300005577 Bacteria 1128
109 Ga0068854_100140801 3300005578 Bacteria 1851
110 Ga0068854_100447610 3300005578 Bacteria 1078
111 Ga0068854_100572827 3300005578 Bacteria 961
112 Ga0068856_100001953 3300005614 Bacteria 21469
113 Ga0068856_100012595 3300005614 Bacteria 8188
114 Ga0068856_100013316 3300005614 Bacteria 7965
115 Ga0068856_100274708 3300005614 Bacteria 1701
116 Ga0068856_100457229 3300005614 Bacteria 1297
117 Ga0068856_101736874 3300005614 Bacteria 636
118 Ga0068856_101750076 3300005614 Bacteria 634
119 Ga0068852_100009023 3300005616 Bacteria 7379
120 Ga0068852_100027740 3300005616 Bacteria 4620
121 Ga0068852_100177458 3300005616 Bacteria 2001
122 Ga0068852_100240761 3300005616 Bacteria 1729
123 Ga0068852_100289179 3300005616 Bacteria 1583
124 Ga0068852_101257557 3300005616 Bacteria 762
125 Ga0068859_100016026 3300005617 Bacteria 7532
126 Ga0068859_100274556 3300005617 Bacteria 1778
127 Ga0068859_100610302 3300005617 Bacteria 1184
128 Ga0068859_101204490 3300005617 Bacteria 834
129 Ga0068864_100273113 3300005618 Bacteria 1576
130 Ga0068864_100321175 3300005618 Bacteria 1454
131 Ga0068864_100715944 3300005618 Bacteria 979
132 Ga0068866_10129147 3300005718 Bacteria 1435
133 Ga0068851_10097743 3300005834 Bacteria 1554
134 Ga0068863_100029313 3300005841 Bacteria 5253
135 Ga0068863_100093918 3300005841 Bacteria 2846
136 Ga0068863_100134064 3300005841 Bacteria 2366
137 Ga0068863_100176157 3300005841 Bacteria 2053
138 Ga0068858_100001361 3300005842 Bacteria 25157
139 Ga0068858_100004222 3300005842 Bacteria 14147
140 Ga0068858_100025491 3300005842 Bacteria 5501
141 Ga0068858_100179242 3300005842 Bacteria 2000
142 Ga0068858_100706342 3300005842 Bacteria 981
143 Ga0068858_101358967 3300005842 Bacteria 700
144 Ga0068860_100013734 3300005843 Bacteria 7941
145 Ga0068860_100015074 3300005843 Bacteria 7554
146 Ga0068860_100495845 3300005843 Bacteria 1219
147 Ga0070717_10350457 3300006028 Bacteria 1320
148 Ga0070717_10995985 3300006028 Bacteria 763
149 Ga0070715_10095556 3300006163 Bacteria 1376
150 Ga0070716_100000584 3300006173 Bacteria 15326
151 Ga0070716_100022435 3300006173 Bacteria 3337
152 Ga0070716_100031881 3300006173 Bacteria 2869
153 Ga0070716_100192762 3300006173 Bacteria 1348
154 Ga0070716_100313213 3300006173 Bacteria 1097
155 Ga0070716_100386373 3300006173 Bacteria 1002
156 Ga0070712_100034098 3300006175 Bacteria 3448
157 Ga0070712_100173649 3300006175 Bacteria 1674
158 Ga0070712_100505010 3300006175 Bacteria 1014
159 Ga0097621_100005103 3300006237 Bacteria 9221
160 Ga0097621_100006873 3300006237 Bacteria 8094
161 Ga0097621_100014110 3300006237 Bacteria 5973
162 Ga0097621_100042041 3300006237 Bacteria 3680
163 Ga0097621_100502225 3300006237 Bacteria 1099
164 Ga0097621_101159673 3300006237 Bacteria 727
165 Ga0068871_100001730 3300006358 Bacteria 14702
166 Ga0068871_100011595 3300006358 Bacteria 6470
167 Ga0068871_100165465 3300006358 Bacteria 1893
168 Ga0068871_100345109 3300006358 Bacteria 1316
169 Ga0068871_100545007 3300006358 Bacteria 1050
170 Ga0068871_101269253 3300006358 Bacteria 692
171 Ga0068871_101323515 3300006358 Bacteria 678
172 Ga0075431_101086766 3300006847 Bacteria 765
173 Ga0075433_10150999 3300006852 Bacteria 2067
174 Ga0075433_10284496 3300006852 Bacteria 1465
175 Ga0075434_100045976 3300006871 Bacteria 4332
176 Ga0075434_100050904 3300006871 Bacteria 4114
177 Ga0075434_100262853 3300006871 Bacteria 1745
178 Ga0075434_100652008 3300006871 Bacteria 1071
179 Ga0068865_100795639 3300006881 Bacteria 815
180 Ga0075436_100000964 3300006914 Bacteria 19302
181 Ga0075436_100001002 3300006914 Bacteria 18960
182 Ga0097620_100016026 3300006931 Bacteria 7532
183 Ga0097620_100274555 3300006931 Bacteria 1778
184 Ga0097620_100610248 3300006931 Bacteria 1184
185 Ga0097620_101204824 3300006931 Bacteria 834
186 Ga0075435_100069287 3300007076 Bacteria 2876
187 Ga0075435_100222806 3300007076 Bacteria 1602
188 Ga0099794_10012354 3300007265 Bacteria 3683
189 Ga0099794_10013851 3300007265 Bacteria 3520
190 Ga0099794_10023501 3300007265 Bacteria 2820
191 Ga0099794_10026499 3300007265 Bacteria 2680
192 Ga0099794_10465680 3300007265 Bacteria 663
193 Ga0099795_10022719 3300007788 Bacteria 2073
194 Ga0099795_10096793 3300007788 Bacteria 1152
195 Ga0099795_10109474 3300007788 Bacteria 1093
196 Ga0105240_10003523 3300009093 Bacteria 24291
197 Ga0105240_10036560 3300009093 Bacteria 6314
198 Ga0105240_10395581 3300009093 Bacteria 1558
199 Ga0105240_10758038 3300009093 Bacteria 1055
200 Ga0105245_10001528 3300009098 Bacteria 20966
201 Ga0105245_10005750 3300009098 Bacteria 10884
202 Ga0105245_10097330 3300009098 Bacteria 2717
203 Ga0105245_11284035 3300009098 Bacteria 781
204 Ga0105247_10895604 3300009101 Bacteria 685
205 Ga0114129_10300310 3300009147 Bacteria 2140
206 Ga0105241_10019184 3300009174 Bacteria 5043
207 Ga0105241_10239813 3300009174 Bacteria 1532
208 Ga0105241_10862891 3300009174 Bacteria 838
209 Ga0105241_11066203 3300009174 Bacteria 759
210 Ga0105241_11575203 3300009174 Bacteria 635
211 Ga0105242_10007652 3300009176 Bacteria 8314
212 Ga0105242_10170273 3300009176 Bacteria 1914
213 Ga0105242_10225299 3300009176 Bacteria 1677
214 Ga0105242_10265502 3300009176 Bacteria 1552
215 Ga0105242_10275759 3300009176 Bacteria 1525
216 Ga0105242_11124893 3300009176 Bacteria 801
217 Ga0105248_10009467 3300009177 Bacteria 10722
218 Ga0105248_10021516 3300009177 Bacteria 7144
219 Ga0105248_10090072 3300009177 Bacteria 3454
220 Ga0105248_10099752 3300009177 Bacteria 3272
221 Ga0105248_10358888 3300009177 Bacteria 1641
222 Ga0105248_10387537 3300009177 Bacteria 1573
223 Ga0105248_10566368 3300009177 Bacteria 1282
224 Ga0105248_10843184 3300009177 Bacteria 1034
225 Ga0105248_11118547 3300009177 Bacteria 890
226 Ga0105237_10024598 3300009545 Bacteria 6158
227 Ga0105237_10051166 3300009545 Bacteria 4150
228 Ga0105237_10230497 3300009545 Bacteria 1853
229 Ga0105237_11075733 3300009545 Bacteria 811
230 Ga0105238_10018281 3300009551 Bacteria 7132
231 Ga0105238_10051889 3300009551 Bacteria 4124
232 Ga0105238_10057164 3300009551 Bacteria 3912
233 Ga0105238_10336961 3300009551 Bacteria 1496
234 Ga0105238_10378418 3300009551 Bacteria 1407
235 Ga0105238_10400871 3300009551 Bacteria 1365
236 Ga0105238_10746684 3300009551 Bacteria 992
237 Ga0105238_11028892 3300009551 Bacteria 845
238 Ga0105249_12254947 3300009553 Bacteria 617
239 Ga0099796_10056257 3300010159 Bacteria 1380
240 Ga0105239_10054078 3300010375 Bacteria 4403
241 Ga0105239_10069352 3300010375 Bacteria 3874
242 Ga0105239_10250102 3300010375 Bacteria 1991
243 Ga0105239_10401355 3300010375 Bacteria 1551
244 Ga0105239_11847399 3300010375 Bacteria 700
245 Ga0105246_10531752 3300011119 Bacteria 1004
246 Ga0157373_10005134 3300013100 Bacteria 9841
247 Ga0157370_10009621 3300013104 Bacteria 10289
248 Ga0157370_10063516 3300013104 Bacteria 3497
249 Ga0157369_10024233 3300013105 Bacteria 6754
250 Ga0157369_10065623 3300013105 Bacteria 3906
251 Ga0157369_10091285 3300013105 Bacteria 3251
252 Ga0157369_10221222 3300013105 Bacteria 1982
253 Ga0157374_10021205 3300013296 Bacteria 5776
254 Ga0157374_10504969 3300013296 Bacteria 1214
255 Ga0157378_10000106 3300013297 Bacteria 79497
256 Ga0157378_10016188 3300013297 Bacteria 6531
257 Ga0157378_10039112 3300013297 Bacteria 4206
258 Ga0157378_10041031 3300013297 Bacteria 4106
259 Ga0157378_10079977 3300013297 Bacteria 2952
260 Ga0157378_10366466 3300013297 Bacteria 1411
261 Ga0157378_12116452 3300013297 Bacteria 613
262 Ga0163162_10003334 3300013306 Bacteria 15370
263 Ga0163162_10215692 3300013306 Bacteria 2049
264 Ga0163162_11074658 3300013306 Bacteria 911
265 Ga0157372_10004886 3300013307 Bacteria 14256
266 Ga0157372_10151160 3300013307 Bacteria 2680
267 Ga0157372_10498295 3300013307 Bacteria 1420
268 Ga0157372_11098295 3300013307 Bacteria 920
269 Ga0157372_11455590 3300013307 Bacteria 789
270 Ga0157375_10037177 3300013308 Bacteria 4663
271 Ga0157375_10048807 3300013308 Bacteria 4143
272 Ga0157375_10135427 3300013308 Bacteria 2586
273 Ga0157375_10386747 3300013308 Bacteria 1566
274 Ga0157375_11143316 3300013308 Bacteria 912
275 Ga0163163_10017999 3300014325 Bacteria 6600
276 Ga0163163_10067449 3300014325 Bacteria 3557
277 Ga0163163_10155963 3300014325 Bacteria 2328
278 Ga0163163_10181127 3300014325 Bacteria 2154
279 Ga0163163_10197993 3300014325 Bacteria 2057
280 Ga0163163_10220665 3300014325 Bacteria 1944
281 Ga0163163_10225104 3300014325 Bacteria 1925
282 Ga0163163_10255386 3300014325 Bacteria 1804
283 Ga0163163_10297064 3300014325 Bacteria 1667
284 Ga0182008_10143642 3300014497 Bacteria 1195
285 Ga0157379_10161448 3300014968 Bacteria 2023
286 Ga0157379_10666893 3300014968 Bacteria 974
287 Ga0157376_10000017 3300014969 Bacteria 268501
288 Ga0157376_10017653 3300014969 Bacteria 5450
289 Ga0157376_10020449 3300014969 Bacteria 5120
290 Ga0157376_10300107 3300014969 Bacteria 1520
291 Ga0157376_10749678 3300014969 Bacteria 985
292 Ga0157376_10988753 3300014969 Bacteria 863
293 Ga0182006_1035190 3300015261 Bacteria 1999
294 Ga0182007_10015855 3300015262 Bacteria 2796
295 Ga0206356_11149233 3300020070 Bacteria 722
296 Ga0206356_11416866 3300020070 Bacteria 528
297 Ga0206349_1736770 3300020075 Bacteria 1232
298 Ga0206352_10741406 3300020078 Bacteria 824
299 Ga0206352_11316544 3300020078 Bacteria 911
300 Ga0224712_10016302 3300022467 Bacteria 2438
301 Ga0207692_11125428 3300025898 Bacteria 520
302 Ga0207692_11160403 3300025898 Bacteria 512
303 Ga0207642_10381453 3300025899 Bacteria 839
304 Ga0207710_10199708 3300025900 Bacteria 987
305 Ga0207680_10019508 3300025903 Bacteria 3627
306 Ga0207680_10581297 3300025903 Bacteria 801
307 Ga0207680_10823341 3300025903 Bacteria 666
308 Ga0207647_10540008 3300025904 Bacteria 647
309 Ga0207685_10178053 3300025905 Bacteria 984
310 Ga0207685_10442577 3300025905 Bacteria 674
311 Ga0207699_10004675 3300025906 Bacteria 6541
312 Ga0207699_10037239 3300025906 Bacteria 2779
313 Ga0207699_10093271 3300025906 Bacteria 1895
314 Ga0207699_10135501 3300025906 Bacteria 1612
315 Ga0207699_10440546 3300025906 Bacteria 933
316 Ga0207699_11024130 3300025906 Bacteria 611
317 Ga0207645_10635178 3300025907 Bacteria 725
318 Ga0207645_10899609 3300025907 Bacteria 601
319 Ga0207705_10217569 3300025909 Bacteria 1450
320 Ga0207684_10046601 3300025910 Bacteria 3678
321 Ga0207684_10090106 3300025910 Bacteria 2613
322 Ga0207654_10119098 3300025911 Bacteria 1655
323 Ga0207654_10465990 3300025911 Bacteria 888
324 Ga0207654_10705000 3300025911 Bacteria 725
325 Ga0207654_10850880 3300025911 Bacteria 660
326 Ga0207707_10002726 3300025912 Bacteria 15779
327 Ga0207707_10278335 3300025912 Bacteria 1449
328 Ga0207707_11217844 3300025912 Bacteria 609
329 Ga0207695_10001686 3300025913 Bacteria 35482
330 Ga0207695_10003161 3300025913 Bacteria 23484
331 Ga0207695_10015229 3300025913 Bacteria 9067
332 Ga0207695_10040208 3300025913 Bacteria 5018
333 Ga0207695_10045066 3300025913 Bacteria 4685
334 Ga0207695_10126956 3300025913 Bacteria 2512
335 Ga0207695_10247421 3300025913 Bacteria 1683
336 Ga0207695_10778817 3300025913 Bacteria 837
337 Ga0207671_10094085 3300025914 Bacteria 2261
338 Ga0207671_10105077 3300025914 Bacteria 2142
339 Ga0207693_10085866 3300025915 Bacteria 2465
340 Ga0207693_10121856 3300025915 Bacteria 2048
341 Ga0207663_10188661 3300025916 Bacteria 1478
342 Ga0207663_10683956 3300025916 Bacteria 811
343 Ga0207663_10837317 3300025916 Bacteria 734
344 Ga0207657_10004520 3300025919 Bacteria 14695
345 Ga0207657_10146627 3300025919 Bacteria 1925
346 Ga0207652_10010387 3300025921 Bacteria 7496
347 Ga0207652_10084802 3300025921 Bacteria 2776
348 Ga0207652_10143229 3300025921 Bacteria 2138
349 Ga0207652_10358061 3300025921 Bacteria 1317
350 Ga0207646_10002336 3300025922 Bacteria 22446
351 Ga0207646_10010513 3300025922 Bacteria 9032
352 Ga0207646_10063234 3300025922 Bacteria 3304
353 Ga0207646_10704091 3300025922 Bacteria 903
354 Ga0207646_11116720 3300025922 Bacteria 693
355 Ga0207646_11277978 3300025922 Bacteria 641
356 Ga0207694_10011563 3300025924 Bacteria 6659
357 Ga0207694_10016358 3300025924 Bacteria 5601
358 Ga0207694_10102430 3300025924 Bacteria 2270
359 Ga0207694_10135682 3300025924 Bacteria 1976
360 Ga0207694_10233486 3300025924 Bacteria 1502
361 Ga0207694_10319105 3300025924 Bacteria 1282
362 Ga0207694_10355563 3300025924 Bacteria 1213
363 Ga0207694_10382237 3300025924 Bacteria 1169
364 Ga0207694_10844802 3300025924 Bacteria 774
365 Ga0207659_10747024 3300025926 Bacteria 839
366 Ga0207687_10001974 3300025927 Bacteria 14105
367 Ga0207687_10037244 3300025927 Bacteria 3317
368 Ga0207687_10163587 3300025927 Bacteria 1710
369 Ga0207687_10270122 3300025927 Bacteria 1359
370 Ga0207687_10304425 3300025927 Bacteria 1285
371 Ga0207687_10459703 3300025927 Bacteria 1057
372 Ga0207687_10657829 3300025927 Bacteria 887
373 Ga0207700_10035585 3300025928 Bacteria 3588
374 Ga0207700_10044108 3300025928 Bacteria 3281
375 Ga0207700_10111073 3300025928 Bacteria 2206
376 Ga0207700_10286484 3300025928 Unclassified 1419
377 Ga0207700_10471044 3300025928 Bacteria 1109
378 Ga0207664_10450240 3300025929 Bacteria 1149
379 Ga0207644_10054710 3300025931 Bacteria 2875
380 Ga0207644_10439315 3300025931 Bacteria 1071
381 Ga0207690_10051827 3300025932 Bacteria 2746
382 Ga0207686_10004143 3300025934 Bacteria 7779
383 Ga0207686_10007474 3300025934 Bacteria 5882
384 Ga0207686_10015309 3300025934 Bacteria 4286
385 Ga0207686_10100896 3300025934 Bacteria 1927
386 Ga0207686_10110177 3300025934 Bacteria 1855
387 Ga0207686_10146295 3300025934 Bacteria 1640
388 Ga0207686_10154637 3300025934 Bacteria 1601
389 Ga0207686_10268608 3300025934 Bacteria 1254
390 Ga0207686_10553850 3300025934 Bacteria 899
391 Ga0207686_10722628 3300025934 Bacteria 793
392 Ga0207709_10442340 3300025935 Bacteria 1003
393 Ga0207670_10586967 3300025936 Bacteria 914
394 Ga0207704_10237229 3300025938 Bacteria 1360
395 Ga0207704_10729422 3300025938 Bacteria 823
396 Ga0207665_10001708 3300025939 Bacteria 14760
397 Ga0207665_10016968 3300025939 Bacteria 4781
398 Ga0207665_10032846 3300025939 Bacteria 3436
399 Ga0207665_10131409 3300025939 Bacteria 1778
400 Ga0207665_10209288 3300025939 Bacteria 1424
401 Ga0207665_10299489 3300025939 Bacteria 1202
402 Ga0207665_10326163 3300025939 Bacteria 1153
403 Ga0207665_10814610 3300025939 Bacteria 738
404 Ga0207711_10004789 3300025941 Bacteria 11488
405 Ga0207711_10029550 3300025941 Bacteria 4624
406 Ga0207711_10030044 3300025941 Bacteria 4583
407 Ga0207711_10232749 3300025941 Bacteria 1688
408 Ga0207711_10713751 3300025941 Bacteria 935
409 Ga0207711_10880183 3300025941 Bacteria 833
410 Ga0207661_10000050 3300025944 Bacteria 93646
411 Ga0207661_10089729 3300025944 Bacteria 2558
412 Ga0207661_10261316 3300025944 Bacteria 1542
413 Ga0207661_10268532 3300025944 Bacteria 1522
414 Ga0207661_10467147 3300025944 Bacteria 1151
415 Ga0207667_10005190 3300025949 Bacteria 15905
416 Ga0207667_10044685 3300025949 Bacteria 4693
417 Ga0207667_10251101 3300025949 Bacteria 1809
418 Ga0207667_10412101 3300025949 Bacteria 1375
419 Ga0207667_10989389 3300025949 Bacteria 829
420 Ga0207651_10173737 3300025960 Bacteria 1702
421 Ga0207668_10558899 3300025972 Bacteria 992
422 Ga0207640_10275305 3300025981 Bacteria 1319
423 Ga0207640_10460472 3300025981 Bacteria 1050
424 Ga0207658_10706848 3300025986 Bacteria 911
425 Ga0207658_10792642 3300025986 Bacteria 860
426 Ga0207677_10031110 3300026023 Bacteria 3415
427 Ga0207677_10605050 3300026023 Bacteria 962
428 Ga0207677_10656615 3300026023 Bacteria 926
429 Ga0207677_11009220 3300026023 Bacteria 755
430 Ga0207703_10012160 3300026035 Bacteria 6709
431 Ga0207703_10021601 3300026035 Bacteria 5040
432 Ga0207703_10050343 3300026035 Bacteria 3371
433 Ga0207703_10064358 3300026035 Bacteria 3010
434 Ga0207639_10189839 3300026041 Bacteria 1754
435 Ga0207639_10464586 3300026041 Bacteria 1151
436 Ga0207639_10534660 3300026041 Bacteria 1075
437 Ga0207708_11132670 3300026075 Bacteria 683
438 Ga0207702_10007696 3300026078 Bacteria 9153
439 Ga0207702_10021620 3300026078 Bacteria 5328
440 Ga0207702_10058666 3300026078 Bacteria 3276
441 Ga0207702_10148266 3300026078 Bacteria 2131
442 Ga0207702_10223113 3300026078 Bacteria 1757
443 Ga0207702_10275896 3300026078 Bacteria 1587
444 Ga0207641_10019107 3300026088 Bacteria 5620
445 Ga0207641_10058288 3300026088 Bacteria 3286
446 Ga0207641_10232934 3300026088 Bacteria 1712
447 Ga0207648_10293843 3300026089 Bacteria 1455
448 Ga0207676_10082250 3300026095 Bacteria 2618
449 Ga0207676_10265135 3300026095 Bacteria 1553
450 Ga0207676_10278373 3300026095 Bacteria 1518
451 Ga0207676_11783655 3300026095 Bacteria 614
452 Ga0207674_10145395 3300026116 Bacteria 2329
453 Ga0207674_11429279 3300026116 Bacteria 661
454 Ga0207683_11252719 3300026121 Bacteria 687
455 Ga0207698_10089658 3300026142 Bacteria 2512
456 Ga0207698_10259350 3300026142 Bacteria 1596
457 Ga0207698_10292992 3300026142 Bacteria 1511
458 Ga0207698_10757465 3300026142 Bacteria 970
459 Ga0209179_1051985 3300027512 Bacteria 880
460 Ga0209588_1000943 3300027671 Bacteria 7418
461 Ga0209588_1004588 3300027671 Bacteria 3908
462 Ga0209588_1005841 3300027671 Bacteria 3545
463 Ga0209588_1015727 3300027671 Bacteria 2329
464 Ga0209588_1052757 3300027671 Bacteria 1315
465 Ga0209588_1120313 3300027671 Bacteria 841
466 Ga0268266_10000141 3300028379 Bacteria 138510
467 Ga0268266_10376341 3300028379 Bacteria 1338
468 Ga0268266_10390582 3300028379 Bacteria 1314
469 Ga0268266_10562243 3300028379 Bacteria 1093
470 Ga0268264_10009522 3300028381 Bacteria 8046
471 Ga0268264_10010659 3300028381 Bacteria 7596
472 Ga0268264_10122460 3300028381 Bacteria 2294
473 Ga0268264_10706418 3300028381 Bacteria 1002
474 Ga0265337_1007034 3300028556 Bacteria 4252
475 Ga0265319_1204357 3300028563 Bacteria 606
476 Ga0265338_10010534 3300028800 Bacteria 10814
477 Ga0265338_10832120 3300028800 Bacteria 631
478 Ga0265330_10196380 3300031235 Bacteria 853
479 Ga0265325_10131495 3300031241 Bacteria 1198
480 Ga0265325_10215110 3300031241 Bacteria 881
481 Ga0265339_10232395 3300031249 Bacteria 898
482 Ga0265339_10289532 3300031249 Bacteria 783
483 Ga0307408_100784742 3300031548 Bacteria 863
484 Ga0265313_10393067 3300031595 Bacteria 545
485 Ga0307410_10202563 3300031852 Bacteria 1516
486 Ga0307406_10166332 3300031901 Bacteria 1591
487 Ga0307407_10118995 3300031903 Bacteria 1671
488 Ga0307409_100946853 3300031995 Bacteria 877
489 Ga0307416_100068195 3300032002 Bacteria 2938
490 Ga0307411_10510222 3300032005 Bacteria 1018
491 Ga0307415_100027747 3300032126 Bacteria 3591
492 Ga0316212_1003957 3300033547 Bacteria 2151
493 Ga0373930_0107059 3300034816 Bacteria 670
494 Ga0373934_0015403 3300035086 Bacteria 2901
495 Ga0373936_0048639 3300035113 Bacteria 1712
496 Ga0373941_0079876 3300035115 Bacteria 1103
497 Ga0373954_0077799 3300035118 Bacteria 1582
498 Ga0373956_0160923 3300035119 Bacteria 1058
499 Ga0373943_0049624 3300035170 Bacteria 2060
500 Ga0373946_0235202 3300035171 Bacteria 889
501 Ga0373955_0026016 3300035172 Bacteria 3010
502 Ga0373962_0120663 3300035242 Bacteria 836
503 Ga0373931_0067872 3300035691 Bacteria 1939
504 Ga0373931_0841312 3300035691 Bacteria 614
505 Ga0373927_0104837 3300035695 Bacteria 1841
506 Ga0373927_0166407 3300035695 Bacteria 1445
507 Ga0373933_0000227 3300035724 Bacteria 37466
508 Ga0373933_0779232 3300035724 Bacteria 629
509 Ga0373947_0007767 3300035725 Bacteria 6197
510 Ga0373947_0318449 3300035725 Bacteria 1040
511 Ga0373937_0000240 3300036401 Bacteria 53719
512 Ga0373937_0121351 3300036401 Bacteria 2436
513 Ga0373937_0161215 3300036401 Bacteria 2103
514 Ga0373937_0269130 3300036401 Bacteria 1608
515 Ga0373937_0470112 3300036401 Bacteria 1194
516 Ga0373937_0603163 3300036401 Bacteria 1042
517 Ga0373937_0796229 3300036401 Bacteria 893
518 Ga0373937_1157139 3300036401 Bacteria 722
519 Ga0373925_0019086 3300037068 Bacteria 4985
520 Ga0373925_0437618 3300037068 Bacteria 1070
521 Ga0373925_0679962 3300037068 Bacteria 848
522 Ga0373925_0728613 3300037068 Bacteria 817
523 Ga0395900_0950654 3300037418 Bacteria 781
524 Ga0436364_0191100 3300037853 Bacteria 1504
525 Ga0439444_0025249 3300042437 Bacteria 1079
526 Ga0439464_0081131 3300042439 Bacteria 969
527 Ga0466963_0166901 3300044694 Bacteria 1534
528 Ga0495592_0153929 3300046454 Bacteria 1588
529 Ga0495603_0372101 3300046455 Bacteria 820
530 Ga0495629_0013982 3300046459 Bacteria 5787
531 Ga0495629_0278233 3300046459 Bacteria 1149
532 Ga0495651_0029623 3300046462 Bacteria 4268
533 Ga0495651_0044971 3300046462 Bacteria 3421
534 Ga0495653_0042333 3300046463 Bacteria 3548
535 Ga0495580_0003498 3300046472 Bacteria 13363
536 Ga0495580_0030687 3300046472 Bacteria 3890
537 Ga0495580_0113218 3300046472 Bacteria 1884
538 Ga0495582_0141941 3300046473 Bacteria 1361
539 Ga0495582_0402215 3300046473 Bacteria 790
540 Ga0495639_0407356 3300046475 Bacteria 687
541 Ga0495664_0059869 3300046477 Bacteria 2267
542 Ga0495584_0009815 3300046491 Bacteria 4924
543 Ga0495594_0252998 3300046499 Bacteria 1003
544 Ga0495608_0032480 3300046511 Bacteria 3528
545 Ga0495608_0039635 3300046511 Bacteria 3157
546 Ga0495618_0123204 3300046514 Bacteria 1660
547 Ga0495628_0073030 3300046516 Bacteria 2673
548 Ga0495628_0108577 3300046516 Bacteria 2136
549 Ga0495630_0174210 3300046517 Bacteria 1640
550 Ga0495630_0278777 3300046517 Bacteria 1277
551 Ga0495630_0384834 3300046517 Bacteria 1074
552 Ga0495666_0007053 3300046526 Bacteria 5647
553 Ga0495652_0565011 3300046529 Bacteria 780
554 Ga0495665_0024329 3300046531 Bacteria 3253
555 Ga0495665_0042601 3300046531 Bacteria 2416
556 Ga0495665_0186093 3300046531 Bacteria 1078
557 Ga0495665_0232586 3300046531 Bacteria 951
558 Ga0495640_0006567 3300046533 Bacteria 9189
559 Ga0495640_0074886 3300046533 Bacteria 2262
560 Ga0495587_0000047 3300046536 Bacteria 105516
561 Ga0495587_0033064 3300046536 Bacteria 3124
562 Ga0495587_0120934 3300046536 Bacteria 1500
563 Ga0495587_0277752 3300046536 Bacteria 939
564 Ga0495587_0404625 3300046536 Bacteria 758
565 Ga0495645_0060476 3300046543 Bacteria 2746
566 Ga0495667_0009199 3300046559 Bacteria 6707
567 Ga0495635_0426810 3300046663 Bacteria 878
568 Ga0495657_0024708 3300046675 Bacteria 4274
569 Ga0495657_0112426 3300046675 Bacteria 1724
570 Ga0495599_0250258 3300046678 Bacteria 1079
571 Ga0495623_0022593 3300046679 Bacteria 4062
572 Ga0495623_0245202 3300046679 Bacteria 1010
573 Ga0495646_0039354 3300046680 Bacteria 2916
574 Ga0495646_0535990 3300046680 Bacteria 599
575 Ga0495647_0003825 3300046681 Bacteria 4847
576 Ga0495658_0067708 3300046683 Bacteria 2065
577 Ga0495658_0156109 3300046683 Bacteria 1404
578 Ga0495658_0487957 3300046683 Bacteria 788
579 Ga0495669_0232937 3300046684 Bacteria 884
580 Ga0495613_0028516 3300046689 Bacteria 4153
581 Ga0495613_0471604 3300046689 Bacteria 848
582 Ga0495613_0616182 3300046689 Bacteria 721
583 Ga0495581_0010864 3300047315 Bacteria 5264
584 Ga0495581_0371186 3300047315 Bacteria 835
585 Ga0495604_0010957 3300047317 Bacteria 7197
586 Ga0495604_0064543 3300047317 Bacteria 2790
587 Ga0495604_0135049 3300047317 Bacteria 1769
588 Ga0495604_0148776 3300047317 Bacteria 1666
589 Ga0495604_0419292 3300047317 Bacteria 879
590 Ga0495674_0006030 3300047319 Bacteria 11645
591 Ga0495674_0012948 3300047319 Bacteria 7853
592 Ga0495674_0040244 3300047319 Bacteria 4182
593 Ga0495674_0084352 3300047319 Bacteria 2723
594 Ga0495674_0112885 3300047319 Bacteria 2302
595 Ga0495676_0001634 3300047321 Bacteria 19513
596 Ga0495680_0046167 3300047322 Bacteria 3436
597 Ga0495680_0101002 3300047322 Bacteria 2149
598 Ga0495680_0108655 3300047322 Bacteria 2058
599 Ga0495675_0000391 3300047444 Bacteria 30273
600 Ga0495675_0056089 3300047444 Bacteria 2498
601 Ga0495675_0174449 3300047444 Bacteria 1319
602 Ga0495684_0004752 3300047471 Bacteria 10611
603 Ga0495684_0012724 3300047471 Bacteria 6495
604 Ga0495684_0015526 3300047471 Bacteria 5862
605 Ga0495684_0074036 3300047471 Bacteria 2587
606 Ga0495684_0155668 3300047471 Bacteria 1707
607 Ga0495684_0271220 3300047471 Bacteria 1227
608 Ga0495602_0001895 3300048088 Bacteria 20969
609 Ga0495602_0022368 3300048088 Bacteria 6190
610 Ga0495602_0250216 3300048088 Bacteria 1321
611 Ga0496100_0829163 3300048903 Bacteria 725
612 Ga0496101_0057615 3300048904 Bacteria 2811
613 Ga0496101_0290988 3300048904 Bacteria 1278
614 Ga0496106_0041019 3300048909 Bacteria 3468
615 Ga0496107_0386772 3300048910 Bacteria 1041
616 Ga0496108_0722719 3300048911 Bacteria 863
617 Ga0496108_1172143 3300048911 Bacteria 651
618 Ga0496114_0071671 3300048917 Bacteria 2913
619 Ga0496114_0076036 3300048917 Bacteria 2829
620 Ga0496115_0010914 3300048918 Bacteria 6800
621 Ga0496115_0024434 3300048918 Bacteria 4697
622 Ga0496115_0031553 3300048918 Bacteria 4176
623 Ga0496115_0039953 3300048918 Bacteria 3728
624 Ga0496115_0167336 3300048918 Bacteria 1818
625 Ga0501032_0047062 3300049569 Bacteria 2914
626 Ga0501033_0273622 3300049570 Bacteria 1193
627 Ga0501034_0964149 3300049571 Bacteria 738
628 Ga0501038_0077902 3300049574 Bacteria 2798
629 Ga0501043_0052777 3300049579 Bacteria 3193
630 Ga0501046_0225241 3300049580 Bacteria 1387
631 Ga0501047_0017609 3300049581 Bacteria 6846
632 Ga0501075_0346958 3300049591 Bacteria 1131
633 Ga0501080_0754062 3300049742 Bacteria 856
634 Ga0501035_0001580 3300049822 Bacteria 23148
635 Ga0501044_0003256 3300049823 Bacteria 18261
636 nmdc:mga05p37_333830_c1 3300050507 Bacteria 1790
637 nmdc:mga06r32_320952_c1 3300050510 Bacteria 1534
638 nmdc:mga0n895_105985_c1 3300050512 Bacteria 2824
639 nmdc:mga0n895_167762_c1 3300050512 Bacteria 2227
640 nmdc:mga0n895_899153_c1 3300050512 Bacteria 871
641 nmdc:mga0rr50_25103_c1 3300050513 Bacteria 4139
642 nmdc:mga0rr50_852826_c1 3300050513 Bacteria 777
643 nmdc:mga08x19_14637_c1 3300050514 Bacteria 4762
644 nmdc:mga08x19_88_c1 3300050514 Bacteria 82198
645 nmdc:mga0a205_133550_c1 3300050515 Bacteria 2382
646 Ga0495601_0443061 3300053077 Bacteria 840
647 Ga0495612_0017109 3300053078 Bacteria 2904
648 Ga0587107_031071 3300059652 Bacteria 813
649 Ga0105248_10397906
650 Ga0065715_10261102
651 Ga0070658_10124585
652 Ga0070676_10434054
653 Ga0070683_100000049
654 Ga0070683_100796960
655 Ga0070683_100879282
656 Ga0070683_101296880
657 Ga0070683_101982322
658 Ga0070670_100139167
659 Ga0070670_100581120
660 Ga0068869_101662778
661 Ga0070666_10004972
662 Ga0070666_10188003
663 Ga0070680_100299658
664 Ga0070682_100800249
665 Ga0068868_100047108
666 Ga0068868_100054696
667 Ga0068868_100086900
668 Ga0068868_100170506
669 Ga0068868_100281435
670 Ga0068868_101029309
671 Ga0070660_100037406
672 Ga0070660_100091902
673 Ga0070660_100132930
674 Ga0070660_100731078
675 Ga0070689_100098961
676 Ga0070691_10049098
677 Ga0070691_10261864
678 Ga0070661_100134913
679 Ga0070661_100675917
680 Ga0070668_100295962
681 Ga0070671_100022163
682 Ga0070671_100061375
683 Ga0070671_100534827
684 Ga0070671_100612643
685 Ga0070673_100182112
686 Ga0070659_100004814
687 Ga0070659_100056262
688 Ga0070659_100587361
689 Ga0070667_100181526
690 Ga0070667_100820678
691 Ga0070709_10036969
692 Ga0070709_10164627
693 Ga0070709_11053631
694 Ga0070714_100214592
695 Ga0070714_100596050
696 Ga0070713_100040221
697 Ga0070713_100060040
698 Ga0070713_100179274
699 Ga0070713_100322473
700 Ga0070713_100569249
701 Ga0070710_10479288
702 Ga0070711_100268594
703 Ga0070711_100376522
704 Ga0070711_100510014
705 Ga0070711_100764171
706 Ga0070711_101076795
707 Ga0070705_100395175
708 Ga0070708_100141162
709 Ga0070708_100185097
710 Ga0070708_100903873
711 Ga0070663_100462077
712 Ga0070662_100507358
713 Ga0070681_10215413
714 Ga0070681_10969856
715 Ga0068867_101496267
716 Ga0070685_10642112
717 Ga0070685_10645942
718 Ga0070706_100066065
719 Ga0070706_100434358
720 Ga0070706_101055358
721 Ga0070706_101644436
722 Ga0070707_100003828
723 Ga0070707_100014125
724 Ga0070707_100140925
725 Ga0070707_100183183
726 Ga0070707_100246732
727 Ga0070707_100630092
728 Ga0070698_100025715
729 Ga0070698_100564158
730 Ga0070699_100680499
731 Ga0070679_100313704
732 Ga0070679_100338156
733 Ga0070679_100753632
734 Ga0070684_100000040
735 Ga0070684_100044093
736 Ga0070684_100111784
737 Ga0070684_100213005
738 Ga0070684_101098182
739 Ga0070697_100001104
740 Ga0070697_100333727
741 Ga0068853_100235016
742 Ga0068853_100385464
743 Ga0068853_100665786
744 Ga0070695_101635922
745 Ga0070696_100272702
746 Ga0070665_100001236
747 Ga0070665_100099539
748 Ga0070665_100279112
749 Ga0070665_100693014
750 Ga0068855_100075884
751 Ga0068855_100222186
752 Ga0070664_100111552
753 Ga0070664_100440518
754 Ga0070664_100494990
755 Ga0068857_100017791
756 Ga0068857_100511355
757 Ga0068854_100140801
758 Ga0068854_100447610
759 Ga0068854_100572827
760 Ga0068856_100001953
761 Ga0068856_100012595
762 Ga0068856_100013316
763 Ga0068856_100274708
764 Ga0068856_100457229
765 Ga0068856_101736874
766 Ga0068856_101750076
767 Ga0068852_100009023
768 Ga0068852_100027740
769 Ga0068852_100177458
770 Ga0068852_100240761
771 Ga0068852_100289179
772 Ga0068852_101257557
773 Ga0068859_100016026
774 Ga0068859_100274556
775 Ga0068859_100610302
776 Ga0068859_101204490
777 Ga0068864_100273113
778 Ga0068864_100321175
779 Ga0068864_100715944
780 Ga0068866_10129147
781 Ga0068851_10097743
782 Ga0068863_100029313
783 Ga0068863_100093918
784 Ga0068863_100134064
785 Ga0068863_100176157
786 Ga0068858_100001361
787 Ga0068858_100004222
788 Ga0068858_100025491
789 Ga0068858_100179242
790 Ga0068858_100706342
791 Ga0068858_101358967
792 Ga0068860_100013734
793 Ga0068860_100015074
794 Ga0068860_100495845
795 Ga0070717_10350457
796 Ga0070717_10995985
797 Ga0070715_10095556
798 Ga0070716_100000584
799 Ga0070716_100022435
800 Ga0070716_100031881
801 Ga0070716_100192762
802 Ga0070716_100313213
803 Ga0070716_100386373
804 Ga0070712_100034098
805 Ga0070712_100173649
806 Ga0070712_100505010
807 Ga0097621_100005103
808 Ga0097621_100006873
809 Ga0097621_100014110
810 Ga0097621_100042041
811 Ga0097621_100502225
812 Ga0097621_101159673
813 Ga0068871_100001730
814 Ga0068871_100011595
815 Ga0068871_100165465
816 Ga0068871_100345109
817 Ga0068871_100545007
818 Ga0068871_101269253
819 Ga0068871_101323515
820 Ga0075431_101086766
821 Ga0075433_10150999
822 Ga0075433_10284496
823 Ga0075434_100045976
824 Ga0075434_100050904
825 Ga0075434_100262853
826 Ga0075434_100652008
827 Ga0068865_100795639
828 Ga0075436_100000964
829 Ga0075436_100001002
830 Ga0097620_100016026
831 Ga0097620_100274555
832 Ga0097620_100610248
833 Ga0097620_101204824
834 Ga0075435_100069287
835 Ga0075435_100222806
836 Ga0099794_10012354
837 Ga0099794_10013851
838 Ga0099794_10023501
839 Ga0099794_10026499
840 Ga0099794_10465680
841 Ga0099795_10022719
842 Ga0099795_10096793
843 Ga0099795_10109474
844 Ga0105240_10003523
845 Ga0105240_10036560
846 Ga0105240_10395581
847 Ga0105240_10758038
848 Ga0105245_10001528
849 Ga0105245_10005750
850 Ga0105245_10097330
851 Ga0105245_11284035
852 Ga0105247_10895604
853 Ga0114129_10300310
854 Ga0105241_10019184
855 Ga0105241_10239813
856 Ga0105241_10862891
857 Ga0105241_11066203
858 Ga0105241_11575203
859 Ga0105242_10007652
860 Ga0105242_10170273
861 Ga0105242_10225299
862 Ga0105242_10265502
863 Ga0105242_10275759
864 Ga0105242_11124893
865 Ga0105248_10009467
866 Ga0105248_10021516
867 Ga0105248_10090072
868 Ga0105248_10099752
869 Ga0105248_10358888
870 Ga0105248_10387537
871 Ga0105248_10566368
872 Ga0105248_10843184
873 Ga0105248_11118547
874 Ga0105237_10024598
875 Ga0105237_10051166
876 Ga0105237_10230497
877 Ga0105237_11075733
878 Ga0105238_10018281
879 Ga0105238_10051889
880 Ga0105238_10057164
881 Ga0105238_10336961
882 Ga0105238_10378418
883 Ga0105238_10400871
884 Ga0105238_10746684
885 Ga0105238_11028892
886 Ga0105249_12254947
887 Ga0099796_10056257
888 Ga0105239_10054078
889 Ga0105239_10069352
890 Ga0105239_10250102
891 Ga0105239_10401355
892 Ga0105239_11847399
893 Ga0105246_10531752
894 Ga0157373_10005134
895 Ga0157370_10009621
896 Ga0157370_10063516
897 Ga0157369_10024233
898 Ga0157369_10065623
899 Ga0157369_10091285
900 Ga0157369_10221222
901 Ga0157374_10021205
902 Ga0157374_10504969
903 Ga0157378_10000106
904 Ga0157378_10016188
905 Ga0157378_10039112
906 Ga0157378_10041031
907 Ga0157378_10079977
908 Ga0157378_10366466
909 Ga0157378_12116452
910 Ga0163162_10003334
911 Ga0163162_10215692
912 Ga0163162_11074658
913 Ga0157372_10004886
914 Ga0157372_10151160
915 Ga0157372_10498295
916 Ga0157372_11098295
917 Ga0157372_11455590
918 Ga0157375_10037177
919 Ga0157375_10048807
920 Ga0157375_10135427
921 Ga0157375_10386747
922 Ga0157375_11143316
923 Ga0163163_10017999
924 Ga0163163_10067449
925 Ga0163163_10155963
926 Ga0163163_10181127
927 Ga0163163_10197993
928 Ga0163163_10220665
929 Ga0163163_10225104
930 Ga0163163_10255386
931 Ga0163163_10297064
932 Ga0182008_10143642
933 Ga0157379_10161448
934 Ga0157379_10666893
935 Ga0157376_10000017
936 Ga0157376_10017653
937 Ga0157376_10020449
938 Ga0157376_10300107
939 Ga0157376_10749678
940 Ga0157376_10988753
941 Ga0182006_1035190
942 Ga0182007_10015855
943 Ga0206356_11149233
944 Ga0206356_11416866
945 Ga0206349_1736770
946 Ga0206352_10741406
947 Ga0206352_11316544
948 Ga0224712_10016302
949 Ga0207692_11125428
950 Ga0207692_11160403
951 Ga0207642_10381453
952 Ga0207710_10199708
953 Ga0207680_10019508
954 Ga0207680_10581297
955 Ga0207680_10823341
956 Ga0207647_10540008
957 Ga0207685_10178053
958 Ga0207685_10442577
959 Ga0207699_10004675
960 Ga0207699_10037239
961 Ga0207699_10093271
962 Ga0207699_10135501
963 Ga0207699_10440546
964 Ga0207699_11024130
965 Ga0207645_10635178
966 Ga0207645_10899609
967 Ga0207705_10217569
968 Ga0207684_10046601
969 Ga0207684_10090106
970 Ga0207654_10119098
971 Ga0207654_10465990
972 Ga0207654_10705000
973 Ga0207654_10850880
974 Ga0207707_10002726
975 Ga0207707_10278335
976 Ga0207707_11217844
977 Ga0207695_10001686
978 Ga0207695_10003161
979 Ga0207695_10015229
980 Ga0207695_10040208
981 Ga0207695_10045066
982 Ga0207695_10126956
983 Ga0207695_10247421
984 Ga0207695_10778817
985 Ga0207671_10094085
986 Ga0207671_10105077
987 Ga0207693_10085866
988 Ga0207693_10121856
989 Ga0207663_10188661
990 Ga0207663_10683956
991 Ga0207663_10837317
992 Ga0207657_10004520
993 Ga0207657_10146627
994 Ga0207652_10010387
995 Ga0207652_10084802
996 Ga0207652_10143229
997 Ga0207652_10358061
998 Ga0207646_10002336
999 Ga0207646_10010513
1000 Ga0207646_10063234
1001 Ga0207646_10704091
1002 Ga0207646_11116720
1003 Ga0207646_11277978
1004 Ga0207694_10011563
1005 Ga0207694_10016358
1006 Ga0207694_10102430
1007 Ga0207694_10135682
1008 Ga0207694_10233486
1009 Ga0207694_10319105
1010 Ga0207694_10355563
1011 Ga0207694_10382237
1012 Ga0207694_10844802
1013 Ga0207659_10747024
1014 Ga0207687_10001974
1015 Ga0207687_10037244
1016 Ga0207687_10163587
1017 Ga0207687_10270122
1018 Ga0207687_10304425
1019 Ga0207687_10459703
1020 Ga0207687_10657829
1021 Ga0207700_10035585
1022 Ga0207700_10044108
1023 Ga0207700_10111073
1024 Ga0207700_10286484
1025 Ga0207700_10471044
1026 Ga0207664_10450240
1027 Ga0207644_10054710
1028 Ga0207644_10439315
1029 Ga0207690_10051827
1030 Ga0207686_10004143
1031 Ga0207686_10007474
1032 Ga0207686_10015309
1033 Ga0207686_10100896
1034 Ga0207686_10110177
1035 Ga0207686_10146295
1036 Ga0207686_10154637
1037 Ga0207686_10268608
1038 Ga0207686_10553850
1039 Ga0207686_10722628
1040 Ga0207709_10442340
1041 Ga0207670_10586967
1042 Ga0207704_10237229
1043 Ga0207704_10729422
1044 Ga0207665_10001708
1045 Ga0207665_10016968
1046 Ga0207665_10032846
1047 Ga0207665_10131409
1048 Ga0207665_10209288
1049 Ga0207665_10299489
1050 Ga0207665_10326163
1051 Ga0207665_10814610
1052 Ga0207711_10004789
1053 Ga0207711_10029550
1054 Ga0207711_10030044
1055 Ga0207711_10232749
1056 Ga0207711_10713751
1057 Ga0207711_10880183
1058 Ga0207661_10000050
1059 Ga0207661_10089729
1060 Ga0207661_10261316
1061 Ga0207661_10268532
1062 Ga0207661_10467147
1063 Ga0207667_10005190
1064 Ga0207667_10044685
1065 Ga0207667_10251101
1066 Ga0207667_10412101
1067 Ga0207667_10989389
1068 Ga0207651_10173737
1069 Ga0207668_10558899
1070 Ga0207640_10275305
1071 Ga0207640_10460472
1072 Ga0207658_10706848
1073 Ga0207658_10792642
1074 Ga0207677_10031110
1075 Ga0207677_10605050
1076 Ga0207677_10656615
1077 Ga0207677_11009220
1078 Ga0207703_10012160
1079 Ga0207703_10021601
1080 Ga0207703_10050343
1081 Ga0207703_10064358
1082 Ga0207639_10189839
1083 Ga0207639_10464586
1084 Ga0207639_10534660
1085 Ga0207708_11132670
1086 Ga0207702_10007696
1087 Ga0207702_10021620
1088 Ga0207702_10058666
1089 Ga0207702_10148266
1090 Ga0207702_10223113
1091 Ga0207702_10275896
1092 Ga0207641_10019107
1093 Ga0207641_10058288
1094 Ga0207641_10232934
1095 Ga0207648_10293843
1096 Ga0207676_10082250
1097 Ga0207676_10265135
1098 Ga0207676_10278373
1099 Ga0207676_11783655
1100 Ga0207674_10145395
1101 Ga0207674_11429279
1102 Ga0207683_11252719
1103 Ga0207698_10089658
1104 Ga0207698_10259350
1105 Ga0207698_10292992
1106 Ga0207698_10757465
1107 Ga0209179_1051985
1108 Ga0209588_1000943
1109 Ga0209588_1004588
1110 Ga0209588_1005841
1111 Ga0209588_1015727
1112 Ga0209588_1052757
1113 Ga0209588_1120313
1114 Ga0268266_10000141
1115 Ga0268266_10376341
1116 Ga0268266_10390582
1117 Ga0268266_10562243
1118 Ga0268264_10009522
1119 Ga0268264_10010659
1120 Ga0268264_10122460
1121 Ga0268264_10706418
1122 Ga0265337_1007034
1123 Ga0265319_1204357
1124 Ga0265338_10010534
1125 Ga0265338_10832120
1126 Ga0265330_10196380
1127 Ga0265325_10131495
1128 Ga0265325_10215110
1129 Ga0265339_10232395
1130 Ga0265339_10289532
1131 Ga0307408_100784742
1132 Ga0265313_10393067
1133 Ga0307410_10202563
1134 Ga0307406_10166332
1135 Ga0307407_10118995
1136 Ga0307409_100946853
1137 Ga0307416_100068195
1138 Ga0307411_10510222
1139 Ga0307415_100027747
1140 Ga0316212_1003957
1141 Ga0373930_0107059
1142 Ga0373934_0015403
1143 Ga0373936_0048639
1144 Ga0373941_0079876
1145 Ga0373954_0077799
1146 Ga0373956_0160923
1147 Ga0373943_0049624
1148 Ga0373946_0235202
1149 Ga0373955_0026016
1150 Ga0373962_0120663
1151 Ga0373931_0067872
1152 Ga0373931_0841312
1153 Ga0373927_0104837
1154 Ga0373927_0166407
1155 Ga0373933_0000227
1156 Ga0373933_0779232
1157 Ga0373947_0007767
1158 Ga0373947_0318449
1159 Ga0373937_0000240
1160 Ga0373937_0121351
1161 Ga0373937_0161215
1162 Ga0373937_0269130
1163 Ga0373937_0470112
1164 Ga0373937_0603163
1165 Ga0373937_0796229
1166 Ga0373937_1157139
1167 Ga0373925_0019086
1168 Ga0373925_0437618
1169 Ga0373925_0679962
1170 Ga0373925_0728613
1171 Ga0395900_0950654
1172 Ga0436364_0191100
1173 Ga0439444_0025249
1174 Ga0439464_0081131
1175 Ga0466963_0166901
1176 Ga0495592_0153929
1177 Ga0495603_0372101
1178 Ga0495629_0013982
1179 Ga0495629_0278233
1180 Ga0495651_0029623
1181 Ga0495651_0044971
1182 Ga0495653_0042333
1183 Ga0495580_0003498
1184 Ga0495580_0030687
1185 Ga0495580_0113218
1186 Ga0495582_0141941
1187 Ga0495582_0402215
1188 Ga0495639_0407356
1189 Ga0495664_0059869
1190 Ga0495584_0009815
1191 Ga0495594_0252998
1192 Ga0495608_0032480
1193 Ga0495608_0039635
1194 Ga0495618_0123204
1195 Ga0495628_0073030
1196 Ga0495628_0108577
1197 Ga0495630_0174210
1198 Ga0495630_0278777
1199 Ga0495630_0384834
1200 Ga0495666_0007053
1201 Ga0495652_0565011
1202 Ga0495665_0024329
1203 Ga0495665_0042601
1204 Ga0495665_0186093
1205 Ga0495665_0232586
1206 Ga0495640_0006567
1207 Ga0495640_0074886
1208 Ga0495587_0000047
1209 Ga0495587_0033064
1210 Ga0495587_0120934
1211 Ga0495587_0277752
1212 Ga0495587_0404625
1213 Ga0495645_0060476
1214 Ga0495667_0009199
1215 Ga0495635_0426810
1216 Ga0495657_0024708
1217 Ga0495657_0112426
1218 Ga0495599_0250258
1219 Ga0495623_0022593
1220 Ga0495623_0245202
1221 Ga0495646_0039354
1222 Ga0495646_0535990
1223 Ga0495647_0003825
1224 Ga0495658_0067708
1225 Ga0495658_0156109
1226 Ga0495658_0487957
1227 Ga0495669_0232937
1228 Ga0495613_0028516
1229 Ga0495613_0471604
1230 Ga0495613_0616182
1231 Ga0495581_0010864
1232 Ga0495581_0371186
1233 Ga0495604_0010957
1234 Ga0495604_0064543
1235 Ga0495604_0135049
1236 Ga0495604_0148776
1237 Ga0495604_0419292
1238 Ga0495674_0006030
1239 Ga0495674_0012948
1240 Ga0495674_0040244
1241 Ga0495674_0084352
1242 Ga0495674_0112885
1243 Ga0495676_0001634
1244 Ga0495680_0046167
1245 Ga0495680_0101002
1246 Ga0495680_0108655
1247 Ga0495675_0000391
1248 Ga0495675_0056089
1249 Ga0495675_0174449
1250 Ga0495684_0004752
1251 Ga0495684_0012724
1252 Ga0495684_0015526
1253 Ga0495684_0074036
1254 Ga0495684_0155668
1255 Ga0495684_0271220
1256 Ga0495602_0001895
1257 Ga0495602_0022368
1258 Ga0495602_0250216
1259 Ga0496100_0829163
1260 Ga0496101_0057615
1261 Ga0496101_0290988
1262 Ga0496106_0041019
1263 Ga0496107_0386772
1264 Ga0496108_0722719
1265 Ga0496108_1172143
1266 Ga0496114_0071671
1267 Ga0496114_0076036
1268 Ga0496115_0010914
1269 Ga0496115_0024434
1270 Ga0496115_0031553
1271 Ga0496115_0039953
1272 Ga0496115_0167336
1273 Ga0501032_0047062
1274 Ga0501033_0273622
1275 Ga0501034_0964149
1276 Ga0501038_0077902
1277 Ga0501043_0052777
1278 Ga0501046_0225241
1279 Ga0501047_0017609
1280 Ga0501075_0346958
1281 Ga0501080_0754062
1282 Ga0501035_0001580
1283 Ga0501044_0003256
1284 nmdc:mga05p37_333830_c1
1285 nmdc:mga06r32_320952_c1
1286 nmdc:mga0n895_105985_c1
1287 nmdc:mga0n895_167762_c1
1288 nmdc:mga0n895_899153_c1
1289 nmdc:mga0rr50_25103_c1
1290 nmdc:mga0rr50_852826_c1
1291 nmdc:mga08x19_14637_c1
1292 nmdc:mga08x19_88_c1
1293 nmdc:mga0a205_133550_c1
1294 Ga0495601_0443061
1295 Ga0495612_0017109
1296 Ga0587107_031071

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01799

Fer2_2

[2Fe-2S] binding domain

106

178

0.95

PF00111

Fer2

2Fe-2S iron-sulfur cluster binding domain

38

105

0.87

PF13085

Fer2_3

2Fe-2S iron-sulfur cluster binding domain

43

125

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
8gy3-assembly1.cif.gz_B cryo-em structure of membrane-bound aldehyde dehydrogenase from gluconobacter oxydans 0.9761 1 153
8gy3-assembly1.cif.gz_B cryo-em structure of membrane-bound aldehyde dehydrogenase from gluconobacter oxydans 0.9638 1 153
1rm6-assembly1.cif.gz_C structure of 4-hydroxybenzoyl-coa reductase from thauera aromatica 0.9616 1 151
1dgj-assembly1.cif.gz_A crystal structure of the aldehyde oxidoreductase from desulfovibrio desulfuricans atcc 27774 0.9575 2 153
1n5w-assembly1.cif.gz_D crystal structure of the cu,mo-co dehydrogenase (codh); oxidized form 0.9551 1 153
ID Description Score Start End Superfamily
af_Q46801_1_79_3.10.20.30 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9782 1 73 3.10.20.30
5y6qA01 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9755 1 75 3.10.20.30
1sb3F01 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9692 1 75 3.10.20.30
1n5wA01 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9587 1 75 3.10.20.30
1alo001 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9573 1 72 3.10.20.30
ID Description Score Start End GO Terms
AF-A0A2V9I141-F1-model_v4 (2Fe-2S)-binding protein 0.9932 3 113 GO:0016491
GO:0046872
GO:0051537
AF-A0A1X9X044-F1-model_v4 MmAcDH small subunit 0.9915 3 134 GO:0016491
GO:0046872
GO:0051537
AF-A0A7X0JUW7-F1-model_v4 Isoquinoline 1-oxidoreductase alpha subunit (EC 1.3.99.16) 0.9903 1 155 GO:0046872
GO:0047121
GO:0051537
AF-A0A3A1P8I5-F1-model_v4 (2Fe-2S)-binding protein 0.9901 3 146 GO:0016491
GO:0046872
GO:0051537
AF-A0A6J4XA38-F1-model_v4 Uncharacterized aldehyde oxidase, 2Fe-2S subunit 0.9898 3 150 GO:0016491
GO:0046872
GO:0051537

Map