F472266

General Info

Members Datasets Scaffolds Average Seq Length
647 297 1294 167

Family's Representative Sequence

Representative Sequence 3300006028|Ga0070717_10077426|Ga0070717_100774266
Length 202
Sequence MILQDADSSAHRVVRIVDVSRTTGTGWRPEIVGKMRRSITVNDRMQRDYRYELVRPVGRNFDPEFKPDLTPAEMLRLGVFGGKYMTDCTNEFPASWFKHAKLASGSRDASLNYFGVEASQPLSEWRRKGWIHPDDPRGWFQWYCRYYLGRRMPDEDSRQIKRWKAIRRHVRQLQLACQPGDLWCRRRQRQALLHWAYDSRRL

Samples

Sample ID Description Type Environment
1 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
28 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
29 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
30 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
31 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
32 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
33 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
34 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
39 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
40 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
41 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
44 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
47 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
52 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
53 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
54 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
55 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
56 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
57 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
58 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
59 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
60 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
61 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
62 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
63 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
64 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
66 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
67 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
68 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
69 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
70 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
71 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
72 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
75 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
77 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
78 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
79 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
80 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
81 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
82 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
83 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
84 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
85 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
86 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
87 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
88 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
89 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
90 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
91 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
92 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
93 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
140 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
144 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
145 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
146 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
147 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
148 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
149 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
150 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
151 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
152 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
153 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
154 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
155 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
156 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
157 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
158 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
159 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
160 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
161 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
162 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
163 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
164 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
165 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
166 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
167 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
168 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
169 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
170 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
171 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
172 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
173 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
174 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
175 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
176 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
177 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
178 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
179 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
180 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
181 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
182 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
183 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
184 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
185 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
186 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
187 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
188 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
189 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
190 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
191 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
192 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
193 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
194 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
195 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
196 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
197 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
198 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
199 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
200 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
201 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
202 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
203 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
204 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
205 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
206 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
207 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
208 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
209 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
210 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
211 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
212 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
213 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
214 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
215 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
216 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
217 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
218 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
219 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
220 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
221 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
222 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
223 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
224 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
225 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
226 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
227 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
228 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
229 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
230 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
231 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
232 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
233 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
234 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
235 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
236 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
237 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
238 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
239 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
240 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
241 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
242 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
243 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
244 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
245 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
246 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
247 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
248 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
249 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
250 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
251 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
252 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
253 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
254 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
255 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
256 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
257 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
258 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
259 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
260 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
261 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
262 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
263 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
264 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
265 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
266 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
267 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
268 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
269 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
270 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
271 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
272 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
273 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
274 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
275 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
276 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
277 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
278 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
279 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
280 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
281 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
282 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
283 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
284 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
285 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
286 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
287 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
288 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
289 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
290 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
291 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
292 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
293 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
294 3300053728 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 endosphere Metagenome Endosphere
295 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
296 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
297 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.85
Metatranscriptomes 0.15
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.08
Nodule 0
Rhizoplane 4.95
Rhizosphere 93.04
Stem 0
Stem Tuber 0
Unclassified 3.25

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070717_10077426 3300006028 Bacteria 2784
2 JGI24751J29686_10007997 3300002459 Bacteria 2161
3 JGI25406J46586_10033963 3300003203 Bacteria 1877
4 Ga0065712_10002593 3300005290 Bacteria 6295
5 Ga0065712_10044154 3300005290 Bacteria 1087
6 Ga0070676_10008232 3300005328 Bacteria 5613
7 Ga0070676_10239684 3300005328 Bacteria 1206
8 Ga0070683_100008962 3300005329 Bacteria 8528
9 Ga0070683_100027284 3300005329 Bacteria 5148
10 Ga0070690_100387566 3300005330 Bacteria 1023
11 Ga0070670_100001969 3300005331 Bacteria 16800
12 Ga0070670_100023045 3300005331 Bacteria 5357
13 Ga0070670_100155838 3300005331 Bacteria 1978
14 Ga0070670_100335140 3300005331 Bacteria 1327
15 Ga0070677_10171037 3300005333 Bacteria 1027
16 Ga0070677_10527749 3300005333 Bacteria 644
17 Ga0068869_100659496 3300005334 Bacteria 889
18 Ga0070666_10107287 3300005335 Bacteria 1929
19 Ga0070680_100162528 3300005336 Bacteria 1877
20 Ga0070660_100002931 3300005339 Bacteria 11745
21 Ga0070689_100005940 3300005340 Bacteria 8402
22 Ga0070689_100038001 3300005340 Bacteria 3682
23 Ga0070689_100704006 3300005340 Bacteria 882
24 Ga0070691_10005107 3300005341 Bacteria 5965
25 Ga0070691_10076179 3300005341 Bacteria 1635
26 Ga0070687_100027330 3300005343 Bacteria 2755
27 Ga0070687_100074128 3300005343 Bacteria 1837
28 Ga0070661_100006500 3300005344 Bacteria 8062
29 Ga0070661_100033932 3300005344 Bacteria 3700
30 Ga0070661_100080453 3300005344 Bacteria 2405
31 Ga0070692_10734063 3300005345 Bacteria 668
32 Ga0070692_10914037 3300005345 Bacteria 608
33 Ga0070668_101066106 3300005347 Bacteria 728
34 Ga0070669_100019918 3300005353 Bacteria 4792
35 Ga0070669_100026350 3300005353 Bacteria 4183
36 Ga0070669_100053871 3300005353 Bacteria 2945
37 Ga0070669_101357931 3300005353 Unclassified 616
38 Ga0070675_100069719 3300005354 Bacteria 2913
39 Ga0070675_100187040 3300005354 Bacteria 1793
40 Ga0070675_100209023 3300005354 Bacteria 1696
41 Ga0070675_101505308 3300005354 Unclassified 621
42 Ga0070671_101453646 3300005355 Bacteria 606
43 Ga0070674_100010612 3300005356 Bacteria 5578
44 Ga0070674_100024022 3300005356 Bacteria 3953
45 Ga0070674_100071571 3300005356 Bacteria 2453
46 Ga0070674_100186043 3300005356 Bacteria 1594
47 Ga0070674_100202445 3300005356 Bacteria 1534
48 Ga0070674_100510909 3300005356 Bacteria 1002
49 Ga0070674_101609301 3300005356 Bacteria 586
50 Ga0070673_100049494 3300005364 Bacteria 3282
51 Ga0070673_100604972 3300005364 Bacteria 1000
52 Ga0070673_101138936 3300005364 Unclassified 730
53 Ga0070688_100010137 3300005365 Bacteria 5184
54 Ga0070667_100049554 3300005367 Bacteria 3538
55 Ga0070709_10135289 3300005434 Bacteria 1687
56 Ga0070714_100651098 3300005435 Bacteria 1014
57 Ga0070710_10011787 3300005437 Bacteria 4328
58 Ga0070701_10148851 3300005438 Bacteria 1346
59 Ga0070701_10278865 3300005438 Bacteria 1020
60 Ga0070711_100039940 3300005439 Bacteria 3162
61 Ga0070711_100380000 3300005439 Bacteria 1142
62 Ga0070711_100575482 3300005439 Bacteria 937
63 Ga0070705_100793108 3300005440 Bacteria 753
64 Ga0070700_100014923 3300005441 Bacteria 4394
65 Ga0070700_100048034 3300005441 Bacteria 2644
66 Ga0070700_100239496 3300005441 Bacteria 1296
67 Ga0070700_100495293 3300005441 Bacteria 939
68 Ga0070694_100011132 3300005444 Bacteria 5570
69 Ga0070694_100270760 3300005444 Bacteria 1291
70 Ga0070694_100334723 3300005444 Bacteria 1169
71 Ga0070663_100457526 3300005455 Bacteria 1053
72 Ga0070678_100340642 3300005456 Bacteria 1286
73 Ga0070662_100005045 3300005457 Bacteria 8402
74 Ga0070681_10027004 3300005458 Bacteria 5772
75 Ga0068867_100052433 3300005459 Bacteria 3011
76 Ga0068867_100542804 3300005459 Bacteria 1006
77 Ga0070685_10167924 3300005466 Bacteria 1404
78 Ga0070684_100034523 3300005535 Bacteria 4325
79 Ga0070684_100148810 3300005535 Bacteria 2120
80 Ga0070672_100047327 3300005543 Bacteria 3337
81 Ga0070672_100094235 3300005543 Bacteria 2420
82 Ga0070672_100115234 3300005543 Bacteria 2194
83 Ga0070672_100235164 3300005543 Bacteria 1540
84 Ga0070672_100680544 3300005543 Bacteria 900
85 Ga0070686_100776191 3300005544 Bacteria 771
86 Ga0070696_100018175 3300005546 Bacteria 4749
87 Ga0070665_100072787 3300005548 Bacteria 3444
88 Ga0070665_100490491 3300005548 Bacteria 1239
89 Ga0070704_100220407 3300005549 Bacteria 1542
90 Ga0070704_100275910 3300005549 Bacteria 1391
91 Ga0070704_100941558 3300005549 Bacteria 779
92 Ga0070664_100000632 3300005564 Bacteria 27005
93 Ga0070664_100003261 3300005564 Bacteria 13104
94 Ga0070664_100099937 3300005564 Bacteria 2521
95 Ga0068857_100065761 3300005577 Bacteria 3225
96 Ga0068857_100077728 3300005577 Bacteria 2962
97 Ga0068857_100278785 3300005577 Bacteria 1537
98 Ga0068857_100366585 3300005577 Bacteria 1336
99 Ga0068854_100236503 3300005578 Bacteria 1452
100 Ga0068856_101791867 3300005614 Bacteria 626
101 Ga0070702_100002102 3300005615 Bacteria 8455
102 Ga0068852_101839154 3300005616 Bacteria 628
103 Ga0068859_100035806 3300005617 Bacteria 4981
104 Ga0068859_100072109 3300005617 Bacteria 3490
105 Ga0068859_100319780 3300005617 Bacteria 1646
106 Ga0068859_100715995 3300005617 Bacteria 1091
107 Ga0068859_102402221 3300005617 Unclassified 581
108 Ga0068864_100000689 3300005618 Bacteria 28247
109 Ga0068864_100757875 3300005618 Bacteria 952
110 Ga0068866_10994248 3300005718 Bacteria 595
111 Ga0068861_100003310 3300005719 Bacteria 10666
112 Ga0068861_100042843 3300005719 Bacteria 3394
113 Ga0068861_100043938 3300005719 Bacteria 3357
114 Ga0068861_100615676 3300005719 Bacteria 998
115 Ga0068870_10005196 3300005840 Bacteria 5670
116 Ga0068870_10056272 3300005840 Bacteria 2099
117 Ga0068863_100006599 3300005841 Bacteria 11387
118 Ga0068858_100546916 3300005842 Bacteria 1121
119 Ga0068858_100769381 3300005842 Bacteria 939
120 Ga0068860_100037409 3300005843 Bacteria 4646
121 Ga0068860_100173894 3300005843 Bacteria 2081
122 Ga0068860_100481025 3300005843 Bacteria 1238
123 Ga0068862_100025707 3300005844 Bacteria 4944
124 Ga0068862_100107540 3300005844 Bacteria 2445
125 Ga0068862_100495429 3300005844 Unclassified 1159
126 Ga0068862_100978341 3300005844 Bacteria 836
127 Ga0081540_1042927 3300005983 Bacteria 2326
128 Ga0081539_10001088 3300005985 Bacteria 49422
129 Ga0070717_10286859 3300006028 Bacteria 1461
130 Ga0097621_100035090 3300006237 Bacteria 4006
131 Ga0097621_101000585 3300006237 Unclassified 782
132 Ga0097621_101414155 3300006237 Bacteria 659
133 Ga0068871_100155955 3300006358 Bacteria 1950
134 Ga0068871_100221846 3300006358 Bacteria 1638
135 Ga0068871_100340780 3300006358 Bacteria 1324
136 Ga0068871_100536942 3300006358 Bacteria 1058
137 Ga0075428_100208198 3300006844 Bacteria 2114
138 Ga0075428_100312552 3300006844 Bacteria 1689
139 Ga0075428_101236589 3300006844 Unclassified 786
140 Ga0075430_100072587 3300006846 Bacteria 2886
141 Ga0075431_100387752 3300006847 Bacteria 1400
142 Ga0075431_100396880 3300006847 Bacteria 1381
143 Ga0075434_100250179 3300006871 Bacteria 1792
144 Ga0075429_100258784 3300006880 Bacteria 1523
145 Ga0068865_100425074 3300006881 Bacteria 1093
146 Ga0097620_100035805 3300006931 Bacteria 4981
147 Ga0097620_100072108 3300006931 Bacteria 3490
148 Ga0097620_100319781 3300006931 Bacteria 1646
149 Ga0097620_100716002 3300006931 Bacteria 1091
150 Ga0097620_102402274 3300006931 Unclassified 581
151 Ga0111539_10007669 3300009094 Bacteria 13789
152 Ga0111539_10322321 3300009094 Bacteria 1798
153 Ga0111539_10408005 3300009094 Bacteria 1582
154 Ga0111539_11235010 3300009094 Bacteria 868
155 Ga0105245_10492818 3300009098 Bacteria 1240
156 Ga0114129_10009019 3300009147 Bacteria 14220
157 Ga0114129_10073953 3300009147 Bacteria 4747
158 Ga0114129_10410604 3300009147 Bacteria 1783
159 Ga0114129_11034809 3300009147 Bacteria 1032
160 Ga0105243_10012766 3300009148 Bacteria 6344
161 Ga0105243_10034479 3300009148 Bacteria 3918
162 Ga0105243_11430119 3300009148 Bacteria 713
163 Ga0105242_10006557 3300009176 Bacteria 8962
164 Ga0105242_10616538 3300009176 Bacteria 1050
165 Ga0105242_12124258 3300009176 Bacteria 606
166 Ga0105248_10000015 3300009177 Bacteria 322959
167 Ga0105248_10009703 3300009177 Bacteria 10603
168 Ga0105248_10021341 3300009177 Bacteria 7177
169 Ga0105248_10362124 3300009177 Unclassified 1633
170 Ga0105248_11171413 3300009177 Bacteria 869
171 Ga0105237_10357532 3300009545 Bacteria 1465
172 Ga0105249_10125183 3300009553 Bacteria 2447
173 Ga0105246_10048474 3300011119 Bacteria 2904
174 Ga0105246_10137075 3300011119 Bacteria 1836
175 Ga0157371_10589243 3300013102 Bacteria 826
176 Ga0157378_10282251 3300013297 Bacteria 1601
177 Ga0163162_10243599 3300013306 Bacteria 1929
178 Ga0163162_10285518 3300013306 Bacteria 1782
179 Ga0163162_10867942 3300013306 Bacteria 1017
180 Ga0157375_10198489 3300013308 Bacteria 2162
181 Ga0157375_10213890 3300013308 Bacteria 2085
182 Ga0157375_11038544 3300013308 Bacteria 958
183 Ga0157375_12165602 3300013308 Bacteria 662
184 Ga0157375_12736250 3300013308 Bacteria 590
185 Ga0163163_10033962 3300014325 Bacteria 4937
186 Ga0163163_10154503 3300014325 Bacteria 2339
187 Ga0163163_11055643 3300014325 Bacteria 876
188 Ga0157380_10000369 3300014326 Bacteria 27154
189 Ga0157380_10021553 3300014326 Bacteria 4834
190 Ga0157380_10063837 3300014326 Bacteria 2954
191 Ga0157380_10095332 3300014326 Bacteria 2465
192 Ga0157380_10125578 3300014326 Bacteria 2180
193 Ga0157380_10210842 3300014326 Bacteria 1731
194 Ga0157380_11362423 3300014326 Bacteria 759
195 Ga0157380_12299162 3300014326 Bacteria 604
196 Ga0157377_10005987 3300014745 Bacteria 5761
197 Ga0157377_10037267 3300014745 Bacteria 2679
198 Ga0157377_10406482 3300014745 Bacteria 929
199 Ga0157377_10531313 3300014745 Bacteria 827
200 Ga0157379_10021818 3300014968 Bacteria 5673
201 Ga0157379_10673224 3300014968 Bacteria 970
202 Ga0157376_10161373 3300014969 Bacteria 2032
203 Ga0157376_10223487 3300014969 Bacteria 1745
204 Ga0157376_11157114 3300014969 Bacteria 801
205 Ga0163161_10564028 3300017792 Bacteria 935
206 Ga0163161_10744402 3300017792 Bacteria 819
207 Ga0163161_10749153 3300017792 Bacteria 817
208 Ga0163161_11553522 3300017792 Bacteria 582
209 Ga0213874_10248131 3300021377 Bacteria 655
210 Ga0207682_10007061 3300025893 Bacteria 4504
211 Ga0207642_10921670 3300025899 Bacteria 560
212 Ga0207680_10052922 3300025903 Bacteria 2435
213 Ga0207680_10150272 3300025903 Bacteria 1552
214 Ga0207680_10587302 3300025903 Bacteria 796
215 Ga0207645_10010513 3300025907 Bacteria 6355
216 Ga0207645_10178355 3300025907 Bacteria 1394
217 Ga0207645_10222952 3300025907 Bacteria 1243
218 Ga0207643_10004565 3300025908 Bacteria 7441
219 Ga0207643_10005998 3300025908 Bacteria 6493
220 Ga0207643_10107990 3300025908 Bacteria 1637
221 Ga0207654_10165090 3300025911 Bacteria 1433
222 Ga0207707_10188678 3300025912 Bacteria 1799
223 Ga0207671_10271060 3300025914 Bacteria 1337
224 Ga0207663_10448602 3300025916 Bacteria 995
225 Ga0207660_10152102 3300025917 Bacteria 1779
226 Ga0207662_10030170 3300025918 Bacteria 3145
227 Ga0207657_10104396 3300025919 Bacteria 2347
228 Ga0207649_10008540 3300025920 Bacteria 5587
229 Ga0207649_10029510 3300025920 Bacteria 3239
230 Ga0207652_10185985 3300025921 Bacteria 1868
231 Ga0207681_10029697 3300025923 Bacteria 3555
232 Ga0207681_10106601 3300025923 Bacteria 2031
233 Ga0207681_10193089 3300025923 Bacteria 1559
234 Ga0207681_10522106 3300025923 Bacteria 974
235 Ga0207650_10066754 3300025925 Bacteria 2698
236 Ga0207650_10100897 3300025925 Bacteria 2221
237 Ga0207650_10104317 3300025925 Bacteria 2187
238 Ga0207650_10346177 3300025925 Bacteria 1222
239 Ga0207659_10006122 3300025926 Bacteria 7350
240 Ga0207659_10014494 3300025926 Bacteria 5087
241 Ga0207659_10103288 3300025926 Bacteria 2153
242 Ga0207659_10169025 3300025926 Bacteria 1723
243 Ga0207659_10206063 3300025926 Bacteria 1573
244 Ga0207659_11006620 3300025926 Bacteria 717
245 Ga0207664_10267233 3300025929 Bacteria 1497
246 Ga0207644_10003653 3300025931 Bacteria 9980
247 Ga0207644_10116941 3300025931 Bacteria 2024
248 Ga0207706_10010421 3300025933 Bacteria 8491
249 Ga0207706_10157878 3300025933 Bacteria 1994
250 Ga0207706_10390532 3300025933 Bacteria 1207
251 Ga0207706_10876407 3300025933 Bacteria 759
252 Ga0207686_10012256 3300025934 Bacteria 4711
253 Ga0207709_10097668 3300025935 Bacteria 1935
254 Ga0207670_10081565 3300025936 Bacteria 2264
255 Ga0207670_10275100 3300025936 Bacteria 1310
256 Ga0207670_10368586 3300025936 Bacteria 1141
257 Ga0207669_10029238 3300025937 Bacteria 3044
258 Ga0207669_10090790 3300025937 Bacteria 1988
259 Ga0207704_10379361 3300025938 Bacteria 1109
260 Ga0207704_10692913 3300025938 Bacteria 843
261 Ga0207704_10913601 3300025938 Bacteria 739
262 Ga0207704_11073745 3300025938 Bacteria 683
263 Ga0207691_10010646 3300025940 Bacteria 8826
264 Ga0207691_10010902 3300025940 Bacteria 8723
265 Ga0207691_10028762 3300025940 Bacteria 5202
266 Ga0207691_10176258 3300025940 Bacteria 1870
267 Ga0207691_10265580 3300025940 Bacteria 1479
268 Ga0207691_10271454 3300025940 Bacteria 1460
269 Ga0207711_10140931 3300025941 Bacteria 2169
270 Ga0207711_10443427 3300025941 Bacteria 1208
271 Ga0207689_10687599 3300025942 Bacteria 862
272 Ga0207661_10323989 3300025944 Bacteria 1386
273 Ga0207661_10615803 3300025944 Bacteria 997
274 Ga0207679_10009665 3300025945 Bacteria 6183
275 Ga0207679_10063415 3300025945 Bacteria 2758
276 Ga0207679_10366134 3300025945 Unclassified 1260
277 Ga0207651_10004308 3300025960 Bacteria 7144
278 Ga0207651_10053786 3300025960 Bacteria 2754
279 Ga0207651_11303648 3300025960 Bacteria 653
280 Ga0207712_10260336 3300025961 Bacteria 1407
281 Ga0207712_10389028 3300025961 Bacteria 1169
282 Ga0207712_10532945 3300025961 Bacteria 1008
283 Ga0207668_10523983 3300025972 Bacteria 1023
284 Ga0207668_11027193 3300025972 Bacteria 737
285 Ga0207640_10267934 3300025981 Bacteria 1335
286 Ga0207658_10028444 3300025986 Bacteria 3936
287 Ga0207677_10004333 3300026023 Bacteria 7602
288 Ga0207703_10124336 3300026035 Bacteria 2218
289 Ga0207703_10275040 3300026035 Bacteria 1527
290 Ga0207703_11018125 3300026035 Bacteria 795
291 Ga0207703_11160835 3300026035 Bacteria 742
292 Ga0207678_11237513 3300026067 Bacteria 661
293 Ga0207708_10007706 3300026075 Bacteria 7971
294 Ga0207708_10059146 3300026075 Bacteria 2925
295 Ga0207708_10289013 3300026075 Bacteria 1330
296 Ga0207641_10011469 3300026088 Bacteria 7274
297 Ga0207648_10029590 3300026089 Bacteria 4857
298 Ga0207648_10066758 3300026089 Bacteria 3137
299 Ga0207648_10295789 3300026089 Bacteria 1451
300 Ga0207648_10663663 3300026089 Bacteria 964
301 Ga0207648_10951446 3300026089 Bacteria 803
302 Ga0207676_10001379 3300026095 Bacteria 18072
303 Ga0207676_10060946 3300026095 Bacteria 2986
304 Ga0207676_10226927 3300026095 Bacteria 1667
305 Ga0207674_10038180 3300026116 Bacteria 4989
306 Ga0207674_10077596 3300026116 Bacteria 3327
307 Ga0207674_10307143 3300026116 Bacteria 1535
308 Ga0207674_10442649 3300026116 Bacteria 1256
309 Ga0207675_100002602 3300026118 Bacteria 17866
310 Ga0207675_100015829 3300026118 Bacteria 7033
311 Ga0207675_100633234 3300026118 Bacteria 1074
312 Ga0207675_100805887 3300026118 Bacteria 953
313 Ga0207683_10052232 3300026121 Bacteria 3581
314 Ga0207683_10058301 3300026121 Bacteria 3390
315 Ga0207683_10068638 3300026121 Bacteria 3130
316 Ga0207698_10236488 3300026142 Bacteria 1662
317 Ga0207428_10040549 3300027907 Bacteria 3775
318 Ga0207428_10431033 3300027907 Bacteria 963
319 Ga0207428_10507621 3300027907 Unclassified 875
320 Ga0268266_10039560 3300028379 Bacteria 4017
321 Ga0268266_10997434 3300028379 Bacteria 810
322 Ga0268265_10368341 3300028380 Bacteria 1318
323 Ga0268265_10456285 3300028380 Bacteria 1195
324 Ga0268265_11566427 3300028380 Unclassified 663
325 Ga0268264_10518262 3300028381 Bacteria 1165
326 Ga0268264_10667239 3300028381 Bacteria 1030
327 Ga0265338_10040101 3300028800 Bacteria 4403
328 Ga0265770_1059962 3300030878 Bacteria 706
329 Ga0265340_10077868 3300031247 Bacteria 1564
330 Ga0265339_10000758 3300031249 Bacteria 24960
331 Ga0265313_10000091 3300031595 Bacteria 90050
332 Ga0265314_10035590 3300031711 Bacteria 3628
333 Ga0265314_10217217 3300031711 Bacteria 1118
334 Ga0265342_10262993 3300031712 Bacteria 918
335 Ga0307516_10089819 3300031730 Bacteria 2902
336 Ga0307413_10359688 3300031824 Bacteria 1126
337 Ga0307409_100006914 3300031995 Bacteria 6729
338 Ga0373934_0003165 3300035086 Bacteria 6009
339 Ga0373934_0110637 3300035086 Bacteria 1114
340 Ga0373944_0011011 3300035089 Bacteria 2473
341 Ga0373923_0140631 3300035111 Bacteria 1091
342 Ga0373932_0416941 3300035112 Bacteria 522
343 Ga0373936_0085389 3300035113 Bacteria 1318
344 Ga0373939_0078265 3300035114 Bacteria 1093
345 Ga0373945_0039070 3300035116 Bacteria 1710
346 Ga0373953_0065931 3300035117 Bacteria 1487
347 Ga0373953_0157290 3300035117 Bacteria 976
348 Ga0373954_0037067 3300035118 Bacteria 2265
349 Ga0373956_0070935 3300035119 Bacteria 1590
350 Ga0373957_0012958 3300035120 Bacteria 2819
351 Ga0373957_0111002 3300035120 Bacteria 1104
352 Ga0373943_0012338 3300035170 Bacteria 3845
353 Ga0373943_0029299 3300035170 Bacteria 2601
354 Ga0373943_0132599 3300035170 Bacteria 1334
355 Ga0373946_0009983 3300035171 Bacteria 3511
356 Ga0373946_0015529 3300035171 Bacteria 2889
357 Ga0373955_0002151 3300035172 Bacteria 8514
358 Ga0373924_0029870 3300035410 Bacteria 2182
359 Ga0373924_0069942 3300035410 Bacteria 1479
360 Ga0373924_0183593 3300035410 Bacteria 921
361 Ga0373931_0200978 3300035691 Bacteria 1191
362 Ga0373935_0024518 3300035692 Bacteria 3714
363 Ga0373935_0051246 3300035692 Bacteria 2621
364 Ga0373935_0077122 3300035692 Bacteria 2159
365 Ga0373935_0240730 3300035692 Bacteria 1263
366 Ga0373927_0016260 3300035695 Bacteria 4909
367 Ga0373927_0089654 3300035695 Bacteria 1997
368 Ga0373933_0014975 3300035724 Bacteria 4319
369 Ga0373933_0148052 3300035724 Bacteria 1485
370 Ga0373947_0003051 3300035725 Bacteria 9962
371 Ga0373947_0034929 3300035725 Bacteria 2975
372 Ga0373947_0611818 3300035725 Bacteria 742
373 Ga0373937_0001043 3300036401 Bacteria 23402
374 Ga0373937_0024722 3300036401 Bacteria 5420
375 Ga0373937_0052127 3300036401 Bacteria 3751
376 Ga0373937_0076915 3300036401 Bacteria 3083
377 Ga0373937_0104233 3300036401 Bacteria 2635
378 Ga0373937_0195569 3300036401 Bacteria 1901
379 Ga0373937_0200649 3300036401 Bacteria 1875
380 Ga0373937_0572400 3300036401 Bacteria 1073
381 Ga0373925_0037648 3300037068 Bacteria 3572
382 Ga0373925_0092834 3300037068 Bacteria 2309
383 Ga0373925_0548778 3300037068 Bacteria 950
384 Ga0436364_0776746 3300037853 Bacteria 1143
385 Ga0436363_0083803 3300039450 Bacteria 5762
386 Ga0436362_0847016 3300039453 Bacteria 626
387 Ga0439453_0019554 3300041408 Bacteria 1207
388 Ga0451802_0431740 3300041460 Bacteria 821
389 Ga0451843_1638423 3300041509 Bacteria 589
390 Ga0451853_3530919 3300041512 Bacteria 1030
391 Ga0450923_070507 3300042125 Unclassified 774
392 Ga0439434_0107728 3300042435 Bacteria 901
393 Ga0450916_060698 3300042530 Bacteria 614
394 Ga0451577_0870238 3300042876 Bacteria 812
395 Ga0451576_0116687 3300045051 Bacteria 2779
396 Ga0466967_0204145 3300045976 Bacteria 1873
397 Ga0495617_195396 3300046452 Bacteria 634
398 Ga0495592_0002605 3300046454 Bacteria 12748
399 Ga0495592_0041208 3300046454 Bacteria 3461
400 Ga0495592_0046746 3300046454 Bacteria 3226
401 Ga0495603_0002174 3300046455 Bacteria 11541
402 Ga0495603_0020036 3300046455 Bacteria 4053
403 Ga0495603_0185764 3300046455 Bacteria 1202
404 Ga0495629_0017900 3300046459 Bacteria 5078
405 Ga0495629_0018078 3300046459 Bacteria 5052
406 Ga0495629_0127357 3300046459 Bacteria 1774
407 Ga0495629_0268249 3300046459 Bacteria 1173
408 Ga0495641_0014872 3300046461 Bacteria 4191
409 Ga0495651_0001716 3300046462 Bacteria 16939
410 Ga0495651_0017986 3300046462 Bacteria 5473
411 Ga0495651_0077617 3300046462 Bacteria 2514
412 Ga0495651_0201201 3300046462 Bacteria 1394
413 Ga0495653_0019665 3300046463 Bacteria 5477
414 Ga0495653_0021995 3300046463 Bacteria 5160
415 Ga0495580_0029100 3300046472 Bacteria 4011
416 Ga0495580_0184942 3300046472 Bacteria 1438
417 Ga0495580_0185233 3300046472 Bacteria 1437
418 Ga0495582_0038012 3300046473 Bacteria 2648
419 Ga0495582_0080865 3300046473 Bacteria 1804
420 Ga0495582_0171219 3300046473 Bacteria 1236
421 Ga0495639_0036314 3300046475 Bacteria 2206
422 Ga0495639_0054214 3300046475 Bacteria 1827
423 Ga0495639_0158350 3300046475 Bacteria 1095
424 Ga0495662_0015468 3300046476 Bacteria 3703
425 Ga0495664_0068590 3300046477 Bacteria 2116
426 Ga0495664_0114553 3300046477 Bacteria 1629
427 Ga0495664_0409103 3300046477 Bacteria 814
428 Ga0495585_0082965 3300046492 Bacteria 1735
429 Ga0495594_0189809 3300046499 Bacteria 1170
430 Ga0495594_0386047 3300046499 Bacteria 797
431 Ga0495608_0006306 3300046511 Bacteria 8412
432 Ga0495608_0015032 3300046511 Bacteria 5369
433 Ga0495608_0067986 3300046511 Bacteria 2330
434 Ga0495618_0028099 3300046514 Bacteria 3505
435 Ga0495628_0021054 3300046516 Bacteria 5370
436 Ga0495628_0069869 3300046516 Bacteria 2738
437 Ga0495628_0485695 3300046516 Bacteria 893
438 Ga0495630_0002330 3300046517 Bacteria 13211
439 Ga0495630_0027264 3300046517 Bacteria 4236
440 Ga0495630_0060526 3300046517 Bacteria 2842
441 Ga0495630_0060894 3300046517 Bacteria 2834
442 Ga0495630_0734051 3300046517 Bacteria 755
443 Ga0495630_0779369 3300046517 Bacteria 730
444 Ga0495631_0331253 3300046518 Bacteria 648
445 Ga0495644_0091877 3300046523 Bacteria 1146
446 Ga0495663_0232343 3300046525 Bacteria 651
447 Ga0495666_0025680 3300046526 Bacteria 2909
448 Ga0495666_0169694 3300046526 Bacteria 1009
449 Ga0495652_0059493 3300046529 Bacteria 3232
450 Ga0495652_0079686 3300046529 Bacteria 2707
451 Ga0495652_0132831 3300046529 Bacteria 1968
452 Ga0495665_0025203 3300046531 Bacteria 3195
453 Ga0495640_0004923 3300046533 Bacteria 10612
454 Ga0495640_0041177 3300046533 Bacteria 3229
455 Ga0495640_0144447 3300046533 Bacteria 1531
456 Ga0495640_0217302 3300046533 Bacteria 1206
457 Ga0495586_0099271 3300046535 Bacteria 1615
458 Ga0495587_0012172 3300046536 Bacteria 5431
459 Ga0495587_0028338 3300046536 Bacteria 3406
460 Ga0495645_0030730 3300046543 Bacteria 3914
461 Ga0495645_0031305 3300046543 Bacteria 3876
462 Ga0495645_0169732 3300046543 Bacteria 1502
463 Ga0495667_0000399 3300046559 Bacteria 27814
464 Ga0495667_0109321 3300046559 Bacteria 1786
465 Ga0495667_0285421 3300046559 Bacteria 1047
466 Ga0495634_0007618 3300046642 Bacteria 8113
467 Ga0495634_0021184 3300046642 Bacteria 4599
468 Ga0495634_0031925 3300046642 Bacteria 3625
469 Ga0495634_0034101 3300046642 Bacteria 3494
470 Ga0495634_0300396 3300046642 Bacteria 971
471 Ga0495635_0014599 3300046663 Bacteria 5494
472 Ga0495635_0024398 3300046663 Bacteria 4214
473 Ga0495635_0064587 3300046663 Bacteria 2512
474 Ga0495661_0103334 3300046665 Bacteria 1600
475 Ga0495588_0103178 3300046674 Bacteria 1499
476 Ga0495657_0161044 3300046675 Bacteria 1388
477 Ga0495657_0297892 3300046675 Bacteria 962
478 Ga0495657_0393650 3300046675 Unclassified 816
479 Ga0495599_0009809 3300046678 Bacteria 5861
480 Ga0495623_0003221 3300046679 Bacteria 10774
481 Ga0495646_0047549 3300046680 Bacteria 2611
482 Ga0495646_0417891 3300046680 Bacteria 695
483 Ga0495647_0014011 3300046681 Bacteria 2788
484 Ga0495647_0085304 3300046681 Bacteria 1286
485 Ga0495658_0039887 3300046683 Bacteria 2608
486 Ga0495658_0167064 3300046683 Bacteria 1360
487 Ga0495658_0365018 3300046683 Bacteria 918
488 Ga0495658_0531403 3300046683 Bacteria 753
489 Ga0495613_0001497 3300046689 Bacteria 17775
490 Ga0495613_0027615 3300046689 Bacteria 4224
491 Ga0495613_0380152 3300046689 Bacteria 966
492 Ga0495624_0083952 3300046690 Bacteria 1969
493 Ga0495624_0100420 3300046690 Bacteria 1782
494 Ga0495600_0004886 3300046809 Bacteria 8051
495 Ga0495600_0027747 3300046809 Bacteria 3659
496 Ga0495600_0033448 3300046809 Bacteria 3338
497 Ga0495581_0021184 3300047315 Bacteria 3770
498 Ga0495581_0034271 3300047315 Bacteria 2937
499 Ga0495581_0160909 3300047315 Bacteria 1312
500 Ga0495581_0252420 3300047315 Bacteria 1031
501 Ga0495604_0000355 3300047317 Bacteria 41013
502 Ga0495604_0015951 3300047317 Bacteria 5999
503 Ga0495604_0339238 3300047317 Bacteria 1001
504 Ga0495604_0647402 3300047317 Bacteria 674
505 Ga0495604_0876529 3300047317 Bacteria 562
506 Ga0495674_0019271 3300047319 Bacteria 6336
507 Ga0495674_0029586 3300047319 Bacteria 4986
508 Ga0495674_0048879 3300047319 Bacteria 3740
509 Ga0495674_0065015 3300047319 Bacteria 3169
510 Ga0495676_0071663 3300047321 Bacteria 2663
511 Ga0495676_0072050 3300047321 Bacteria 2654
512 Ga0495676_0162970 3300047321 Bacteria 1576
513 Ga0495680_0017258 3300047322 Bacteria 6170
514 Ga0495680_0021913 3300047322 Bacteria 5339
515 Ga0495680_0042356 3300047322 Bacteria 3613
516 Ga0495675_0001163 3300047444 Bacteria 15971
517 Ga0495675_0161652 3300047444 Bacteria 1379
518 Ga0495684_0001350 3300047471 Bacteria 19724
519 Ga0495684_0012346 3300047471 Bacteria 6590
520 Ga0495684_0015918 3300047471 Bacteria 5790
521 Ga0495684_0037007 3300047471 Bacteria 3741
522 Ga0495686_0185940 3300047472 Bacteria 1201
523 Ga0495593_0035431 3300047673 Bacteria 2710
524 Ga0495602_0013959 3300048088 Bacteria 8180
525 Ga0495602_0830406 3300048088 Bacteria 619
526 Ga0495614_0067055 3300048089 Bacteria 1544
527 Ga0495614_0243745 3300048089 Bacteria 821
528 Ga0495614_0490861 3300048089 Bacteria 584
529 Ga0496100_0205192 3300048903 Bacteria 1439
530 Ga0496100_0508849 3300048903 Bacteria 928
531 Ga0496100_0797295 3300048903 Bacteria 740
532 Ga0496101_0216941 3300048904 Bacteria 1484
533 Ga0496101_1293480 3300048904 Bacteria 570
534 Ga0496102_0438733 3300048905 Bacteria 1225
535 Ga0496104_0002187 3300048907 Bacteria 16934
536 Ga0496104_0046253 3300048907 Bacteria 4097
537 Ga0496105_0030541 3300048908 Bacteria 4415
538 Ga0496106_0166992 3300048909 Bacteria 1743
539 Ga0496106_0606865 3300048909 Bacteria 876
540 Ga0496108_0011804 3300048911 Bacteria 7106
541 Ga0496108_0068785 3300048911 Bacteria 2987
542 Ga0496109_0018995 3300048912 Bacteria 6053
543 Ga0496109_0122453 3300048912 Bacteria 2423
544 Ga0496109_0123244 3300048912 Bacteria 2416
545 Ga0496109_0467275 3300048912 Bacteria 1191
546 Ga0496110_0001206 3300048913 Bacteria 18406
547 Ga0496110_0100023 3300048913 Unclassified 2599
548 Ga0496110_0145252 3300048913 Bacteria 2145
549 Ga0496110_0274414 3300048913 Bacteria 1535
550 Ga0496110_0380082 3300048913 Bacteria 1287
551 Ga0496111_0039509 3300048914 Bacteria 3383
552 Ga0496111_0185967 3300048914 Bacteria 1544
553 Ga0496112_0009268 3300048915 Bacteria 8850
554 Ga0496112_0015419 3300048915 Bacteria 7132
555 Ga0496112_0305620 3300048915 Bacteria 1536
556 Ga0496112_0326452 3300048915 Bacteria 1478
557 Ga0496113_0125514 3300048916 Bacteria 2009
558 Ga0496115_0213328 3300048918 Bacteria 1594
559 Ga0496115_0352013 3300048918 Bacteria 1201
560 Ga0501033_0161640 3300049570 Bacteria 1612
561 Ga0501033_0713599 3300049570 Bacteria 682
562 Ga0501036_0018172 3300049572 Bacteria 5888
563 Ga0501037_1112794 3300049573 Bacteria 511
564 Ga0501039_0052698 3300049575 Bacteria 3147
565 Ga0501039_0537221 3300049575 Unclassified 918
566 Ga0501040_0632317 3300049576 Bacteria 773
567 Ga0501041_0003602 3300049577 Bacteria 8908
568 Ga0501042_0013735 3300049578 Bacteria 5515
569 Ga0501042_0226749 3300049578 Bacteria 1348
570 Ga0501046_0218620 3300049580 Bacteria 1412
571 Ga0501047_0194654 3300049581 Bacteria 1890
572 Ga0501067_0090504 3300049583 Bacteria 1698
573 Ga0501069_0114481 3300049585 Bacteria 1538
574 Ga0501069_0583907 3300049585 Bacteria 670
575 Ga0501071_0481251 3300049587 Bacteria 951
576 Ga0501072_0010703 3300049588 Bacteria 6986
577 Ga0501075_0003948 3300049591 Bacteria 9991
578 Ga0501075_0787398 3300049591 Bacteria 724
579 Ga0501076_0004505 3300049592 Bacteria 9924
580 Ga0501076_0181505 3300049592 Bacteria 1716
581 Ga0501076_0666899 3300049592 Bacteria 858
582 Ga0501076_1023646 3300049592 Bacteria 680
583 Ga0501077_0346340 3300049593 Bacteria 948
584 Ga0501079_0008031 3300049741 Bacteria 7997
585 Ga0501079_1379734 3300049741 Bacteria 555
586 Ga0501080_0025567 3300049742 Bacteria 5482
587 Ga0501080_0026815 3300049742 Bacteria 5356
588 Ga0501081_0007043 3300049743 Bacteria 7311
589 Ga0501081_0054642 3300049743 Bacteria 2759
590 Ga0501081_0466472 3300049743 Unclassified 939
591 Ga0501083_0003244 3300049744 Bacteria 11351
592 Ga0501035_0052335 3300049822 Bacteria 3654
593 Ga0501035_0085064 3300049822 Bacteria 2789
594 Ga0501035_0956924 3300049822 Bacteria 675
595 Ga0501045_0014763 3300049824 Bacteria 5539
596 Ga0501045_0237480 3300049824 Bacteria 1357
597 Ga0501045_0636154 3300049824 Bacteria 789
598 nmdc:mga0yw44_124339_c1 3300050492 Bacteria 1664
599 nmdc:mga0k408_10_c1 3300050493 Bacteria 64050
600 nmdc:mga05p37_16_c1 3300050507 Bacteria 130728
601 nmdc:mga05p37_728073_c1 3300050507 Unclassified 1097
602 nmdc:mga09592_183660_c1 3300050508 Bacteria 1809
603 nmdc:mga09592_473514_c1 3300050508 Bacteria 1079
604 nmdc:mga0qj67_166026_c1 3300050509 Bacteria 1792
605 nmdc:mga06r32_449097_c1 3300050510 Bacteria 1269
606 nmdc:mga06r32_852902_c1 3300050510 Unclassified 869
607 nmdc:mga08y16_1941068_c1 3300050511 Bacteria 539
608 nmdc:mga08y16_33417_c1 3300050511 Bacteria 5402
609 nmdc:mga08y16_375570_c1 3300050511 Bacteria 1458
610 nmdc:mga08y16_501675_c1 3300050511 Bacteria 1233
611 nmdc:mga08y16_528317_c1 3300050511 Bacteria 1196
612 nmdc:mga08y16_762822_c1 3300050511 Bacteria 963
613 nmdc:mga0n895_196589_c1 3300050512 Bacteria 2048
614 nmdc:mga08x19_1093191_c1 3300050514 Bacteria 566
615 nmdc:mga0a205_263995_c1 3300050515 Bacteria 1599
616 nmdc:mga0a205_288602_c1 3300050515 Bacteria 1515
617 Ga0495601_0002560 3300053077 Bacteria 10337
618 Ga0495601_0017165 3300053077 Bacteria 4393
619 Ga0495601_0025499 3300053077 Bacteria 3646
620 Ga0495601_0032876 3300053077 Bacteria 3230
621 Ga0495601_0058327 3300053077 Bacteria 2446
622 Ga0495601_0630493 3300053077 Bacteria 686
623 Ga0495612_0001797 3300053078 Bacteria 8784
624 Ga0495612_0064895 3300053078 Bacteria 1516
625 Ga0495612_0073061 3300053078 Bacteria 1432
626 Ga0495595_0002047 3300053084 Bacteria 7843
627 Ga0495595_0006243 3300053084 Bacteria 4852
628 Ga0495595_0016062 3300053084 Bacteria 3197
629 Ga0495595_0025513 3300053084 Bacteria 2620
630 Ga0495595_0622969 3300053084 Bacteria 552
631 Ga0495619_0000753 3300053085 Bacteria 21116
632 Ga0495619_0000973 3300053085 Bacteria 18754
633 Ga0495619_0105224 3300053085 Bacteria 1924
634 Ga0495619_0264493 3300053085 Unclassified 1192
635 Ga0495619_0352519 3300053085 Bacteria 1018
636 Ga0500646_0069674 3300053090 Bacteria 1052
637 Ga0500593_066014 3300053117 Bacteria 1581
638 Ga0500577_0441435 3300053142 Bacteria 569
639 Ga0500627_0140607 3300053158 Bacteria 1090
640 Ga0500657_217185 3300053728 Bacteria 612
641 Ga0501084_0207204 3300054114 Bacteria 1654
642 Ga0501084_0578962 3300054114 Bacteria 949
643 Ga0501084_0709420 3300054114 Bacteria 848
644 Ga0501082_0085719 3300060353 Bacteria 2716
645 Ga0501082_0606917 3300060353 Bacteria 958
646 Ga0530510_0007727 3300061734 Bacteria 7488
647 Ga0530510_0657191 3300061734 Unclassified 798
648 Ga0070717_10077426
649 JGI24751J29686_10007997
650 JGI25406J46586_10033963
651 Ga0065712_10002593
652 Ga0065712_10044154
653 Ga0070676_10008232
654 Ga0070676_10239684
655 Ga0070683_100008962
656 Ga0070683_100027284
657 Ga0070690_100387566
658 Ga0070670_100001969
659 Ga0070670_100023045
660 Ga0070670_100155838
661 Ga0070670_100335140
662 Ga0070677_10171037
663 Ga0070677_10527749
664 Ga0068869_100659496
665 Ga0070666_10107287
666 Ga0070680_100162528
667 Ga0070660_100002931
668 Ga0070689_100005940
669 Ga0070689_100038001
670 Ga0070689_100704006
671 Ga0070691_10005107
672 Ga0070691_10076179
673 Ga0070687_100027330
674 Ga0070687_100074128
675 Ga0070661_100006500
676 Ga0070661_100033932
677 Ga0070661_100080453
678 Ga0070692_10734063
679 Ga0070692_10914037
680 Ga0070668_101066106
681 Ga0070669_100019918
682 Ga0070669_100026350
683 Ga0070669_100053871
684 Ga0070669_101357931
685 Ga0070675_100069719
686 Ga0070675_100187040
687 Ga0070675_100209023
688 Ga0070675_101505308
689 Ga0070671_101453646
690 Ga0070674_100010612
691 Ga0070674_100024022
692 Ga0070674_100071571
693 Ga0070674_100186043
694 Ga0070674_100202445
695 Ga0070674_100510909
696 Ga0070674_101609301
697 Ga0070673_100049494
698 Ga0070673_100604972
699 Ga0070673_101138936
700 Ga0070688_100010137
701 Ga0070667_100049554
702 Ga0070709_10135289
703 Ga0070714_100651098
704 Ga0070710_10011787
705 Ga0070701_10148851
706 Ga0070701_10278865
707 Ga0070711_100039940
708 Ga0070711_100380000
709 Ga0070711_100575482
710 Ga0070705_100793108
711 Ga0070700_100014923
712 Ga0070700_100048034
713 Ga0070700_100239496
714 Ga0070700_100495293
715 Ga0070694_100011132
716 Ga0070694_100270760
717 Ga0070694_100334723
718 Ga0070663_100457526
719 Ga0070678_100340642
720 Ga0070662_100005045
721 Ga0070681_10027004
722 Ga0068867_100052433
723 Ga0068867_100542804
724 Ga0070685_10167924
725 Ga0070684_100034523
726 Ga0070684_100148810
727 Ga0070672_100047327
728 Ga0070672_100094235
729 Ga0070672_100115234
730 Ga0070672_100235164
731 Ga0070672_100680544
732 Ga0070686_100776191
733 Ga0070696_100018175
734 Ga0070665_100072787
735 Ga0070665_100490491
736 Ga0070704_100220407
737 Ga0070704_100275910
738 Ga0070704_100941558
739 Ga0070664_100000632
740 Ga0070664_100003261
741 Ga0070664_100099937
742 Ga0068857_100065761
743 Ga0068857_100077728
744 Ga0068857_100278785
745 Ga0068857_100366585
746 Ga0068854_100236503
747 Ga0068856_101791867
748 Ga0070702_100002102
749 Ga0068852_101839154
750 Ga0068859_100035806
751 Ga0068859_100072109
752 Ga0068859_100319780
753 Ga0068859_100715995
754 Ga0068859_102402221
755 Ga0068864_100000689
756 Ga0068864_100757875
757 Ga0068866_10994248
758 Ga0068861_100003310
759 Ga0068861_100042843
760 Ga0068861_100043938
761 Ga0068861_100615676
762 Ga0068870_10005196
763 Ga0068870_10056272
764 Ga0068863_100006599
765 Ga0068858_100546916
766 Ga0068858_100769381
767 Ga0068860_100037409
768 Ga0068860_100173894
769 Ga0068860_100481025
770 Ga0068862_100025707
771 Ga0068862_100107540
772 Ga0068862_100495429
773 Ga0068862_100978341
774 Ga0081540_1042927
775 Ga0081539_10001088
776 Ga0070717_10286859
777 Ga0097621_100035090
778 Ga0097621_101000585
779 Ga0097621_101414155
780 Ga0068871_100155955
781 Ga0068871_100221846
782 Ga0068871_100340780
783 Ga0068871_100536942
784 Ga0075428_100208198
785 Ga0075428_100312552
786 Ga0075428_101236589
787 Ga0075430_100072587
788 Ga0075431_100387752
789 Ga0075431_100396880
790 Ga0075434_100250179
791 Ga0075429_100258784
792 Ga0068865_100425074
793 Ga0097620_100035805
794 Ga0097620_100072108
795 Ga0097620_100319781
796 Ga0097620_100716002
797 Ga0097620_102402274
798 Ga0111539_10007669
799 Ga0111539_10322321
800 Ga0111539_10408005
801 Ga0111539_11235010
802 Ga0105245_10492818
803 Ga0114129_10009019
804 Ga0114129_10073953
805 Ga0114129_10410604
806 Ga0114129_11034809
807 Ga0105243_10012766
808 Ga0105243_10034479
809 Ga0105243_11430119
810 Ga0105242_10006557
811 Ga0105242_10616538
812 Ga0105242_12124258
813 Ga0105248_10000015
814 Ga0105248_10009703
815 Ga0105248_10021341
816 Ga0105248_10362124
817 Ga0105248_11171413
818 Ga0105237_10357532
819 Ga0105249_10125183
820 Ga0105246_10048474
821 Ga0105246_10137075
822 Ga0157371_10589243
823 Ga0157378_10282251
824 Ga0163162_10243599
825 Ga0163162_10285518
826 Ga0163162_10867942
827 Ga0157375_10198489
828 Ga0157375_10213890
829 Ga0157375_11038544
830 Ga0157375_12165602
831 Ga0157375_12736250
832 Ga0163163_10033962
833 Ga0163163_10154503
834 Ga0163163_11055643
835 Ga0157380_10000369
836 Ga0157380_10021553
837 Ga0157380_10063837
838 Ga0157380_10095332
839 Ga0157380_10125578
840 Ga0157380_10210842
841 Ga0157380_11362423
842 Ga0157380_12299162
843 Ga0157377_10005987
844 Ga0157377_10037267
845 Ga0157377_10406482
846 Ga0157377_10531313
847 Ga0157379_10021818
848 Ga0157379_10673224
849 Ga0157376_10161373
850 Ga0157376_10223487
851 Ga0157376_11157114
852 Ga0163161_10564028
853 Ga0163161_10744402
854 Ga0163161_10749153
855 Ga0163161_11553522
856 Ga0213874_10248131
857 Ga0207682_10007061
858 Ga0207642_10921670
859 Ga0207680_10052922
860 Ga0207680_10150272
861 Ga0207680_10587302
862 Ga0207645_10010513
863 Ga0207645_10178355
864 Ga0207645_10222952
865 Ga0207643_10004565
866 Ga0207643_10005998
867 Ga0207643_10107990
868 Ga0207654_10165090
869 Ga0207707_10188678
870 Ga0207671_10271060
871 Ga0207663_10448602
872 Ga0207660_10152102
873 Ga0207662_10030170
874 Ga0207657_10104396
875 Ga0207649_10008540
876 Ga0207649_10029510
877 Ga0207652_10185985
878 Ga0207681_10029697
879 Ga0207681_10106601
880 Ga0207681_10193089
881 Ga0207681_10522106
882 Ga0207650_10066754
883 Ga0207650_10100897
884 Ga0207650_10104317
885 Ga0207650_10346177
886 Ga0207659_10006122
887 Ga0207659_10014494
888 Ga0207659_10103288
889 Ga0207659_10169025
890 Ga0207659_10206063
891 Ga0207659_11006620
892 Ga0207664_10267233
893 Ga0207644_10003653
894 Ga0207644_10116941
895 Ga0207706_10010421
896 Ga0207706_10157878
897 Ga0207706_10390532
898 Ga0207706_10876407
899 Ga0207686_10012256
900 Ga0207709_10097668
901 Ga0207670_10081565
902 Ga0207670_10275100
903 Ga0207670_10368586
904 Ga0207669_10029238
905 Ga0207669_10090790
906 Ga0207704_10379361
907 Ga0207704_10692913
908 Ga0207704_10913601
909 Ga0207704_11073745
910 Ga0207691_10010646
911 Ga0207691_10010902
912 Ga0207691_10028762
913 Ga0207691_10176258
914 Ga0207691_10265580
915 Ga0207691_10271454
916 Ga0207711_10140931
917 Ga0207711_10443427
918 Ga0207689_10687599
919 Ga0207661_10323989
920 Ga0207661_10615803
921 Ga0207679_10009665
922 Ga0207679_10063415
923 Ga0207679_10366134
924 Ga0207651_10004308
925 Ga0207651_10053786
926 Ga0207651_11303648
927 Ga0207712_10260336
928 Ga0207712_10389028
929 Ga0207712_10532945
930 Ga0207668_10523983
931 Ga0207668_11027193
932 Ga0207640_10267934
933 Ga0207658_10028444
934 Ga0207677_10004333
935 Ga0207703_10124336
936 Ga0207703_10275040
937 Ga0207703_11018125
938 Ga0207703_11160835
939 Ga0207678_11237513
940 Ga0207708_10007706
941 Ga0207708_10059146
942 Ga0207708_10289013
943 Ga0207641_10011469
944 Ga0207648_10029590
945 Ga0207648_10066758
946 Ga0207648_10295789
947 Ga0207648_10663663
948 Ga0207648_10951446
949 Ga0207676_10001379
950 Ga0207676_10060946
951 Ga0207676_10226927
952 Ga0207674_10038180
953 Ga0207674_10077596
954 Ga0207674_10307143
955 Ga0207674_10442649
956 Ga0207675_100002602
957 Ga0207675_100015829
958 Ga0207675_100633234
959 Ga0207675_100805887
960 Ga0207683_10052232
961 Ga0207683_10058301
962 Ga0207683_10068638
963 Ga0207698_10236488
964 Ga0207428_10040549
965 Ga0207428_10431033
966 Ga0207428_10507621
967 Ga0268266_10039560
968 Ga0268266_10997434
969 Ga0268265_10368341
970 Ga0268265_10456285
971 Ga0268265_11566427
972 Ga0268264_10518262
973 Ga0268264_10667239
974 Ga0265338_10040101
975 Ga0265770_1059962
976 Ga0265340_10077868
977 Ga0265339_10000758
978 Ga0265313_10000091
979 Ga0265314_10035590
980 Ga0265314_10217217
981 Ga0265342_10262993
982 Ga0307516_10089819
983 Ga0307413_10359688
984 Ga0307409_100006914
985 Ga0373934_0003165
986 Ga0373934_0110637
987 Ga0373944_0011011
988 Ga0373923_0140631
989 Ga0373932_0416941
990 Ga0373936_0085389
991 Ga0373939_0078265
992 Ga0373945_0039070
993 Ga0373953_0065931
994 Ga0373953_0157290
995 Ga0373954_0037067
996 Ga0373956_0070935
997 Ga0373957_0012958
998 Ga0373957_0111002
999 Ga0373943_0012338
1000 Ga0373943_0029299
1001 Ga0373943_0132599
1002 Ga0373946_0009983
1003 Ga0373946_0015529
1004 Ga0373955_0002151
1005 Ga0373924_0029870
1006 Ga0373924_0069942
1007 Ga0373924_0183593
1008 Ga0373931_0200978
1009 Ga0373935_0024518
1010 Ga0373935_0051246
1011 Ga0373935_0077122
1012 Ga0373935_0240730
1013 Ga0373927_0016260
1014 Ga0373927_0089654
1015 Ga0373933_0014975
1016 Ga0373933_0148052
1017 Ga0373947_0003051
1018 Ga0373947_0034929
1019 Ga0373947_0611818
1020 Ga0373937_0001043
1021 Ga0373937_0024722
1022 Ga0373937_0052127
1023 Ga0373937_0076915
1024 Ga0373937_0104233
1025 Ga0373937_0195569
1026 Ga0373937_0200649
1027 Ga0373937_0572400
1028 Ga0373925_0037648
1029 Ga0373925_0092834
1030 Ga0373925_0548778
1031 Ga0436364_0776746
1032 Ga0436363_0083803
1033 Ga0436362_0847016
1034 Ga0439453_0019554
1035 Ga0451802_0431740
1036 Ga0451843_1638423
1037 Ga0451853_3530919
1038 Ga0450923_070507
1039 Ga0439434_0107728
1040 Ga0450916_060698
1041 Ga0451577_0870238
1042 Ga0451576_0116687
1043 Ga0466967_0204145
1044 Ga0495617_195396
1045 Ga0495592_0002605
1046 Ga0495592_0041208
1047 Ga0495592_0046746
1048 Ga0495603_0002174
1049 Ga0495603_0020036
1050 Ga0495603_0185764
1051 Ga0495629_0017900
1052 Ga0495629_0018078
1053 Ga0495629_0127357
1054 Ga0495629_0268249
1055 Ga0495641_0014872
1056 Ga0495651_0001716
1057 Ga0495651_0017986
1058 Ga0495651_0077617
1059 Ga0495651_0201201
1060 Ga0495653_0019665
1061 Ga0495653_0021995
1062 Ga0495580_0029100
1063 Ga0495580_0184942
1064 Ga0495580_0185233
1065 Ga0495582_0038012
1066 Ga0495582_0080865
1067 Ga0495582_0171219
1068 Ga0495639_0036314
1069 Ga0495639_0054214
1070 Ga0495639_0158350
1071 Ga0495662_0015468
1072 Ga0495664_0068590
1073 Ga0495664_0114553
1074 Ga0495664_0409103
1075 Ga0495585_0082965
1076 Ga0495594_0189809
1077 Ga0495594_0386047
1078 Ga0495608_0006306
1079 Ga0495608_0015032
1080 Ga0495608_0067986
1081 Ga0495618_0028099
1082 Ga0495628_0021054
1083 Ga0495628_0069869
1084 Ga0495628_0485695
1085 Ga0495630_0002330
1086 Ga0495630_0027264
1087 Ga0495630_0060526
1088 Ga0495630_0060894
1089 Ga0495630_0734051
1090 Ga0495630_0779369
1091 Ga0495631_0331253
1092 Ga0495644_0091877
1093 Ga0495663_0232343
1094 Ga0495666_0025680
1095 Ga0495666_0169694
1096 Ga0495652_0059493
1097 Ga0495652_0079686
1098 Ga0495652_0132831
1099 Ga0495665_0025203
1100 Ga0495640_0004923
1101 Ga0495640_0041177
1102 Ga0495640_0144447
1103 Ga0495640_0217302
1104 Ga0495586_0099271
1105 Ga0495587_0012172
1106 Ga0495587_0028338
1107 Ga0495645_0030730
1108 Ga0495645_0031305
1109 Ga0495645_0169732
1110 Ga0495667_0000399
1111 Ga0495667_0109321
1112 Ga0495667_0285421
1113 Ga0495634_0007618
1114 Ga0495634_0021184
1115 Ga0495634_0031925
1116 Ga0495634_0034101
1117 Ga0495634_0300396
1118 Ga0495635_0014599
1119 Ga0495635_0024398
1120 Ga0495635_0064587
1121 Ga0495661_0103334
1122 Ga0495588_0103178
1123 Ga0495657_0161044
1124 Ga0495657_0297892
1125 Ga0495657_0393650
1126 Ga0495599_0009809
1127 Ga0495623_0003221
1128 Ga0495646_0047549
1129 Ga0495646_0417891
1130 Ga0495647_0014011
1131 Ga0495647_0085304
1132 Ga0495658_0039887
1133 Ga0495658_0167064
1134 Ga0495658_0365018
1135 Ga0495658_0531403
1136 Ga0495613_0001497
1137 Ga0495613_0027615
1138 Ga0495613_0380152
1139 Ga0495624_0083952
1140 Ga0495624_0100420
1141 Ga0495600_0004886
1142 Ga0495600_0027747
1143 Ga0495600_0033448
1144 Ga0495581_0021184
1145 Ga0495581_0034271
1146 Ga0495581_0160909
1147 Ga0495581_0252420
1148 Ga0495604_0000355
1149 Ga0495604_0015951
1150 Ga0495604_0339238
1151 Ga0495604_0647402
1152 Ga0495604_0876529
1153 Ga0495674_0019271
1154 Ga0495674_0029586
1155 Ga0495674_0048879
1156 Ga0495674_0065015
1157 Ga0495676_0071663
1158 Ga0495676_0072050
1159 Ga0495676_0162970
1160 Ga0495680_0017258
1161 Ga0495680_0021913
1162 Ga0495680_0042356
1163 Ga0495675_0001163
1164 Ga0495675_0161652
1165 Ga0495684_0001350
1166 Ga0495684_0012346
1167 Ga0495684_0015918
1168 Ga0495684_0037007
1169 Ga0495686_0185940
1170 Ga0495593_0035431
1171 Ga0495602_0013959
1172 Ga0495602_0830406
1173 Ga0495614_0067055
1174 Ga0495614_0243745
1175 Ga0495614_0490861
1176 Ga0496100_0205192
1177 Ga0496100_0508849
1178 Ga0496100_0797295
1179 Ga0496101_0216941
1180 Ga0496101_1293480
1181 Ga0496102_0438733
1182 Ga0496104_0002187
1183 Ga0496104_0046253
1184 Ga0496105_0030541
1185 Ga0496106_0166992
1186 Ga0496106_0606865
1187 Ga0496108_0011804
1188 Ga0496108_0068785
1189 Ga0496109_0018995
1190 Ga0496109_0122453
1191 Ga0496109_0123244
1192 Ga0496109_0467275
1193 Ga0496110_0001206
1194 Ga0496110_0100023
1195 Ga0496110_0145252
1196 Ga0496110_0274414
1197 Ga0496110_0380082
1198 Ga0496111_0039509
1199 Ga0496111_0185967
1200 Ga0496112_0009268
1201 Ga0496112_0015419
1202 Ga0496112_0305620
1203 Ga0496112_0326452
1204 Ga0496113_0125514
1205 Ga0496115_0213328
1206 Ga0496115_0352013
1207 Ga0501033_0161640
1208 Ga0501033_0713599
1209 Ga0501036_0018172
1210 Ga0501037_1112794
1211 Ga0501039_0052698
1212 Ga0501039_0537221
1213 Ga0501040_0632317
1214 Ga0501041_0003602
1215 Ga0501042_0013735
1216 Ga0501042_0226749
1217 Ga0501046_0218620
1218 Ga0501047_0194654
1219 Ga0501067_0090504
1220 Ga0501069_0114481
1221 Ga0501069_0583907
1222 Ga0501071_0481251
1223 Ga0501072_0010703
1224 Ga0501075_0003948
1225 Ga0501075_0787398
1226 Ga0501076_0004505
1227 Ga0501076_0181505
1228 Ga0501076_0666899
1229 Ga0501076_1023646
1230 Ga0501077_0346340
1231 Ga0501079_0008031
1232 Ga0501079_1379734
1233 Ga0501080_0025567
1234 Ga0501080_0026815
1235 Ga0501081_0007043
1236 Ga0501081_0054642
1237 Ga0501081_0466472
1238 Ga0501083_0003244
1239 Ga0501035_0052335
1240 Ga0501035_0085064
1241 Ga0501035_0956924
1242 Ga0501045_0014763
1243 Ga0501045_0237480
1244 Ga0501045_0636154
1245 nmdc:mga0yw44_124339_c1
1246 nmdc:mga0k408_10_c1
1247 nmdc:mga05p37_16_c1
1248 nmdc:mga05p37_728073_c1
1249 nmdc:mga09592_183660_c1
1250 nmdc:mga09592_473514_c1
1251 nmdc:mga0qj67_166026_c1
1252 nmdc:mga06r32_449097_c1
1253 nmdc:mga06r32_852902_c1
1254 nmdc:mga08y16_1941068_c1
1255 nmdc:mga08y16_33417_c1
1256 nmdc:mga08y16_375570_c1
1257 nmdc:mga08y16_501675_c1
1258 nmdc:mga08y16_528317_c1
1259 nmdc:mga08y16_762822_c1
1260 nmdc:mga0n895_196589_c1
1261 nmdc:mga08x19_1093191_c1
1262 nmdc:mga0a205_263995_c1
1263 nmdc:mga0a205_288602_c1
1264 Ga0495601_0002560
1265 Ga0495601_0017165
1266 Ga0495601_0025499
1267 Ga0495601_0032876
1268 Ga0495601_0058327
1269 Ga0495601_0630493
1270 Ga0495612_0001797
1271 Ga0495612_0064895
1272 Ga0495612_0073061
1273 Ga0495595_0002047
1274 Ga0495595_0006243
1275 Ga0495595_0016062
1276 Ga0495595_0025513
1277 Ga0495595_0622969
1278 Ga0495619_0000753
1279 Ga0495619_0000973
1280 Ga0495619_0105224
1281 Ga0495619_0264493
1282 Ga0495619_0352519
1283 Ga0500646_0069674
1284 Ga0500593_066014
1285 Ga0500577_0441435
1286 Ga0500627_0140607
1287 Ga0500657_217185
1288 Ga0501084_0207204
1289 Ga0501084_0578962
1290 Ga0501084_0709420
1291 Ga0501082_0085719
1292 Ga0501082_0606917
1293 Ga0530510_0007727
1294 Ga0530510_0657191

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
7brd-assembly1.cif.gz_A crystal structure of peptidyl-trna hydrolase from klebsiella pneumoniae 0.5099 88 133
1s4k-assembly1.cif.gz_B putative cytoplasmic protein from salmonella typhimurium 0.2845 74 156
1s4k-assembly1.cif.gz_B putative cytoplasmic protein from salmonella typhimurium 0.2354 74 156
7brd-assembly1.cif.gz_A crystal structure of peptidyl-trna hydrolase from klebsiella pneumoniae 0.1802 88 133
3bgw-assembly2.cif.gz_D the structure of a dnab-like replicative helicase and its interactions with primase 0.1734 30 131
ID Description Score Start End Superfamily
af_A4HU04_498_683_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.3685 78 152 3.40.50.300
4inwA00 Mainly Alpha;Orthogonal Bundle;Recoverin; domain 1;Pheromone/general odorant binding protein domain 0.2232 22 149 1.10.238.20
4inwA00 Mainly Alpha;Orthogonal Bundle;Recoverin; domain 1;Pheromone/general odorant binding protein domain 0.2027 22 149 1.10.238.20
af_A4HU04_498_683_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.1804 78 152 3.40.50.300
3bgwD01 Mainly Alpha;Orthogonal Bundle;DNAb Helicase; Chain A;DNAb Helicase; Chain A 0.1734 30 131 1.10.860.10
ID Description Score Start End GO Terms
AF-A0A0G0L2G6-F1-model_v4 Uncharacterized protein 0.941 13 157
AF-Q89SC6-F1-model_v4 Blr2476 protein 0.9405 1 157
AF-A0A0G0I225-F1-model_v4 Uncharacterized protein 0.94 1 157
AF-A0A2H0PGP7-F1-model_v4 GIY-YIG domain-containing protein 0.938 1 157
AF-A0A354ECI3-F1-model_v4 GP-PDE domain-containing protein 0.9367 1 157 GO:0006629
GO:0008081

Map