F471731

General Info

Members Datasets Scaffolds Average Seq Length
640 225 577 266

Family's Representative Sequence

Representative Sequence 3300049569|Ga0501032_0031665|Ga0501032_0031665_1505_2335
Length 276
Sequence VNSALYFGWVRHRRFSPRAHDFRYPIGLLYLDLAEQQRLFDLSPLAGRGRLAPFAFRETDFLPGFTRRGIPLADAVRQRVGEALGQAPLGPIRLLAQPRSWGLAFNPASFFYCFDTSERLVAILCEVTNTPWRQRYHYVMPVSGDGHQHHRVDKAFHVSPFLPRELEYRMSFSPVGQDLGIHMEDWRGDDKLFDATLRLTRAPLDRASLHRYLWRFPWTTAGTLAAIHCQALRLLLKRTPLFDHQDADDEFRLATLSSQEHDDEKHQPQRQARRPS

Samples

Sample ID Description Type Environment
1 2511231010 Pseudomonas sp. GM25 Isolate Nodule
2 2511231011 Pseudomonas sp. GM30 Isolate Nodule
3 2511231021 Pseudomonas sp. GM78 Isolate Nodule
4 2511231023 Pseudomonas sp. GM80 Isolate Nodule
5 2511231031 Pseudomonas sp. GM16 Isolate Nodule
6 2599185307 Pseudomonas sp. NFACC02 Isolate Rhizoplane
7 2600254954 Pseudomonas sp. NFACC19-2 Isolate Rhizoplane
8 2600255318 Pseudomonas putida NFIX47 Isolate Rhizoplane
9 2600255389 Pseudomonas sp. NFPP33 Isolate Rhizoplane
10 2603880185 Pseudomonas sp. NFIX46 Isolate Rhizoplane
11 2603880199 Pseudomonas sp. NFIX49 Isolate Rhizoplane
12 2623620443 Pseudomonas sp. DR 5-09 Isolate Unclassified
13 2713897148 Pseudomonas fluorescens SF39a Isolate Rhizosphere
14 2713897149 Pseudomonas fluorescens SF4c Isolate Rhizosphere
15 2718217725 Pseudomonas fluorescens CREA-C16 Isolate Rhizosphere
16 2728369097 Stutzerimonas balearica st101 Isolate Unclassified
17 2738543020 Pseudomonas sp. GV054 Isolate Unclassified
18 2738543021 Pseudomonas sp. GV071 Isolate Unclassified
19 2738543025 Pseudomonas sp. GV091 Isolate Unclassified
20 2773857673 Pseudomonas sp. 443 Isolate Unclassified
21 2784132063 Pseudomonas sp. 424 Isolate Unclassified
22 2808606373 Pseudomonas sp. SLBN-2 Isolate Unclassified
23 2808606377 Pseudomonas sp. SJZ083 Isolate Rhizosphere
24 2808606379 Pseudomonas sp. SJZ079 Isolate Rhizosphere
25 2808606381 Pseudomonas sp. SJZ077 Isolate Rhizosphere
26 2808606445 Pseudomonas sp. SJZ131 Isolate Rhizosphere
27 2811994881 Pseudomonas sp. SLBN-26 Isolate Unclassified
28 2818991456 Pseudomonas koreensis 3286 Isolate Rhizosphere
29 2823421272 Pseudomonas mendocina S5.2 Isolate Rhizoplane
30 2842805378 Pseudomonas sp. R-72599 Isolate Unclassified
31 2842832357 Pseudomonas sp. R-72164 Isolate Unclassified
32 2842843487 Pseudomonas sp. R-72074 Isolate Unclassified
33 2852657418 Pseudomonas sp. JAI115 Isolate Rhizosphere
34 2860339153 Pseudomonas sp. JAI111 Isolate Rhizosphere
35 2878029506 Pseudomonas fluorescens DR397 Isolate Rhizosphere
36 2880230671 Pseudomonas fluorescens LBUM677 Isolate Unclassified
37 2904518522 Pseudomonas fluorescens 4488 Isolate Rhizosphere
38 2919063839 Pseudomonas pharyngis 1098 Isolate Rhizosphere
39 2919385768 Pseudomonas sp. 2957 Isolate Unclassified
40 2919456309 Pseudomonas sp. 3296 Isolate Rhizosphere
41 2919487758 Pseudomonas koreensis 3441 Isolate Unclassified
42 2919501602 Pseudomonas alcaliphila 3512 Isolate Unclassified
43 2923519811 Pseudomonas otitidis SLBN-103 Isolate Rhizosphere
44 2926063275 Pseudomonas sp. 3400 Isolate Unclassified
45 2931396565 Pseudomonas sp. DR48 Isolate Rhizosphere
46 2969304461 Pseudomonas sp. R84 Isolate Rhizosphere
47 2974289157 Pseudomonas fluorescens SORGH_AS 191 Isolate Unclassified
48 2990196909 Pseudomonas mangrovi TC-11 Isolate Unclassified
49 2998139840 Pseudomonas iranensis SWRI54 Isolate Rhizosphere
50 3007614139 Pseudomonas sp. PB106 Isolate Unclassified
51 3007619802 Pseudomonas sp. PB120 Isolate Unclassified
52 3007718800 Pseudomonas fluorescens BW11P2 Isolate Rhizosphere
53 3007855910 Pseudomonas khorasanensis SWRI153 Isolate Rhizosphere
54 3007861166 Pseudomonas hamedanensis SWRI65 Isolate Rhizosphere
55 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
56 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
57 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
58 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
59 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
60 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
61 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
62 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
63 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
64 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
65 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
66 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
67 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
68 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
69 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
70 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
71 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
72 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
73 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
74 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
75 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
76 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
77 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
78 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
79 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
80 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
81 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
82 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
91 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
93 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
94 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
95 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
96 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
97 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
98 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
99 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
100 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
101 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
102 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
103 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
104 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
105 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
106 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
107 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
108 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
109 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
110 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
111 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
112 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
113 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
114 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
115 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
116 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
117 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
118 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
119 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
120 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
121 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
122 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
123 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
124 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
125 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
126 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
127 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
128 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
129 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
130 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
131 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
132 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
133 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
134 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
135 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
136 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
137 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
138 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
139 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
140 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
141 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
142 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
143 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
144 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
145 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
146 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
147 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
148 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
149 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
150 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
151 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
152 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
153 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
154 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
155 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
156 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
157 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
158 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
159 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
160 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
161 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
162 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
163 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
164 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
165 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
166 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
167 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
168 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
169 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
170 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
171 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
172 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
173 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
174 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
175 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
176 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
177 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
178 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
179 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
180 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
181 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
182 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
183 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
184 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
185 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
186 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
187 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
188 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
189 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
190 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
191 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
192 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
193 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
194 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
195 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
196 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
197 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
198 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
199 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
200 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
201 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
202 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
203 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
204 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
205 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
206 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
207 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
208 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
209 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
210 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
211 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
212 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
213 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
214 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
215 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
216 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
217 640427133 Stutzerimonas stutzeri A1501 Isolate Rhizosphere
218 651053060 Stutzerimonas stutzeri CMT.A.9 Isolate Rhizosphere
219 8029995093 Pseudomonas atacamensis SM1 Isolate Rhizosphere
220 8034962539 Pseudomonas sediminis PI11 Isolate Rhizosphere
221 8055878733 Pseudomonas palmensis BBB001 Isolate Rhizosphere
222 8056166840 Pseudomonas triticicola SWRI88 Isolate Rhizosphere
223 8056172158 Pseudomonas ekonensis COR58 Isolate Rhizosphere
224 8056177738 Pseudomonas azerbaijanoccidentalis SWRI74 Isolate Rhizosphere
225 8056569372 Pseudomonas serboccidentalis IT-P374 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 90.16
Metatranscriptomes 0
Isolates 9.84

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.5
Nodule 1.09
Rhizoplane 2.03
Rhizosphere 85.47
Stem 0
Stem Tuber 0
Unclassified 8.91

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0055536_1000822 3300003781 Bacteria 20490
2 Ga0055536_1000831 3300003781 Bacteria 20372
3 Ga0055530_10001294 3300003791 Bacteria 18901
4 Ga0055540_1000277 3300003792 Bacteria 46097
5 Ga0055531_10000123 3300003794 Bacteria 86722
6 Ga0065714_10073462 3300005288 Bacteria 3182
7 Ga0070669_100005412 3300005353 Bacteria 9209
8 Ga0070665_100064792 3300005548 Bacteria 3665
9 Ga0079104_1007406 3300006946 Bacteria 3986
10 Ga0105251_10000012 3300009011 Bacteria 167614
11 Ga0105251_10000023 3300009011 Bacteria 133648
12 Ga0105251_10005731 3300009011 Bacteria 8056
13 Ga0105251_10017679 3300009011 Bacteria 3813
14 Ga0105251_10042422 3300009011 Bacteria 2208
15 Ga0105244_10002038 3300009036 Bacteria 15563
16 Ga0105244_10003111 3300009036 Bacteria 12122
17 Ga0105244_10003864 3300009036 Bacteria 10554
18 Ga0105244_10078845 3300009036 Bacteria 1633
19 Ga0105244_10116265 3300009036 Bacteria 1298
20 Ga0105250_10000637 3300009092 Bacteria 22489
21 Ga0105250_10001848 3300009092 Bacteria 11042
22 Ga0105250_10002708 3300009092 Bacteria 8763
23 Ga0105243_10000335 3300009148 Bacteria 51380
24 Ga0105243_10003629 3300009148 Bacteria 12427
25 Ga0105246_10000484 3300011119 Bacteria 21488
26 Ga0157345_1000093 3300012498 Bacteria 18946
27 Ga0157373_10001705 3300013100 Bacteria 16738
28 Ga0157373_10002281 3300013100 Bacteria 14532
29 Ga0157373_10002875 3300013100 Bacteria 13027
30 Ga0157371_10001483 3300013102 Bacteria 24268
31 Ga0157371_10004812 3300013102 Bacteria 11615
32 Ga0157370_10000477 3300013104 Bacteria 50079
33 Ga0157370_10076652 3300013104 Bacteria 3149
34 Ga0157370_10290433 3300013104 Bacteria 1510
35 Ga0157369_10033590 3300013105 Bacteria 5637
36 Ga0163162_10001483 3300013306 Bacteria 21854
37 Ga0157372_10005543 3300013307 Bacteria 13421
38 Ga0182008_10001390 3300014497 Bacteria 16366
39 Ga0182008_10036852 3300014497 Bacteria 2447
40 Ga0182006_1002219 3300015261 Bacteria 10766
41 Ga0182006_1002578 3300015261 Bacteria 9812
42 Ga0182006_1027719 3300015261 Bacteria 2309
43 Ga0182005_1001339 3300015265 Bacteria 10059
44 Ga0163161_10002271 3300017792 Bacteria 13787
45 Ga0163161_10007361 3300017792 Bacteria 7601
46 Ga0163161_10008166 3300017792 Bacteria 7241
47 Ga0163161_10055081 3300017792 Bacteria 2887
48 Ga0163161_10079000 3300017792 Bacteria 2418
49 Ga0209675_1007413 3300025291 Bacteria 4211
50 Ga0209676_1000010 3300025292 Bacteria 954025
51 Ga0209676_1000350 3300025292 Bacteria 87204
52 Ga0209676_1061504 3300025292 Bacteria 932
53 Ga0209050_1000019 3300025298 Bacteria 608757
54 Ga0209051_1000383 3300025303 Bacteria 62847
55 Ga0209257_1000357 3300025304 Bacteria 93431
56 Ga0207696_1000138 3300025711 Bacteria 127572
57 Ga0207696_1000213 3300025711 Bacteria 87128
58 Ga0207696_1001517 3300025711 Bacteria 12461
59 Ga0207696_1005143 3300025711 Bacteria 5490
60 Ga0207696_1006229 3300025711 Bacteria 4835
61 Ga0207655_1000021 3300025728 Bacteria 518596
62 Ga0207655_1000954 3300025728 Bacteria 29930
63 Ga0207655_1003342 3300025728 Bacteria 12014
64 Ga0207655_1004455 3300025728 Bacteria 9930
65 Ga0207655_1046686 3300025728 Bacteria 1796
66 Ga0207713_1000078 3300025735 Bacteria 175087
67 Ga0207713_1000080 3300025735 Bacteria 168403
68 Ga0207713_1001355 3300025735 Bacteria 19964
69 Ga0207713_1002469 3300025735 Bacteria 13448
70 Ga0207713_1004556 3300025735 Bacteria 8973
71 Ga0207713_1007719 3300025735 Bacteria 6287
72 Ga0207681_10002703 3300025923 Bacteria 11237
73 Ga0207706_10033281 3300025933 Bacteria 4589
74 Ga0207709_10000189 3300025935 Bacteria 82404
75 Ga0207709_10004233 3300025935 Bacteria 8319
76 Ga0209281_1003456 3300027111 Bacteria 5209
77 Ga0268266_10052790 3300028379 Bacteria 3491
78 Ga0316179_1104012 3300030734 Bacteria 4315
79 Ga0316178_1164502 3300030735 Bacteria 19764
80 Ga0307408_100000020 3300031548 Bacteria 340408
81 Ga0307408_100001505 3300031548 Bacteria 17302
82 Ga0307412_10070951 3300031911 Bacteria 2376
83 Ga0307412_10071700 3300031911 Bacteria 2365
84 Ga0307412_10107123 3300031911 Bacteria 1988
85 Ga0307412_10262821 3300031911 Bacteria 1346
86 Ga0307409_100009952 3300031995 Bacteria 5873
87 Ga0307414_10081917 3300032004 Bacteria 2364
88 Ga0307510_10003501 3300033180 Bacteria 18292
89 Ga0307510_10086403 3300033180 Bacteria 3009
90 Ga0237819_01398 3300038705 Bacteria 6300
91 Ga0436363_0664568 3300039450 Bacteria 1866
92 Ga0439438_001132 3300041405 Bacteria 11869
93 Ga0439438_002514 3300041405 Bacteria 7780
94 Ga0439438_032788 3300041405 Bacteria 1375
95 Ga0439447_000778 3300041407 Bacteria 11699
96 Ga0439447_016738 3300041407 Bacteria 2007
97 Ga0439453_0014350 3300041408 Bacteria 1357
98 Ga0439466_0014098 3300041411 Bacteria 2916
99 Ga0439466_0034560 3300041411 Bacteria 1713
100 Ga0439466_0074578 3300041411 Bacteria 1076
101 Ga0439431_0001345 3300041997 Bacteria 5419
102 Ga0439437_000718 3300042000 Bacteria 3343
103 Ga0439442_022533 3300042002 Bacteria 1307
104 Ga0439443_000923 3300042003 Bacteria 2988
105 Ga0439445_0028788 3300042004 Bacteria 1433
106 Ga0439432_005607 3300042006 Bacteria 4511
107 Ga0439452_000620 3300042010 Bacteria 17943
108 Ga0439455_0006668 3300042012 Bacteria 2408
109 Ga0439456_014610 3300042013 Bacteria 1638
110 Ga0439463_006746 3300042016 Bacteria 2839
111 Ga0439463_007097 3300042016 Bacteria 2764
112 Ga0439463_018294 3300042016 Bacteria 1743
113 Ga0450911_000028 3300042115 Bacteria 77694
114 Ga0450911_000325 3300042115 Bacteria 17090
115 Ga0450911_000350 3300042115 Bacteria 15711
116 Ga0450902_001989 3300042137 Bacteria 2859
117 Ga0450904_000061 3300042139 Bacteria 24317
118 Ga0450904_000312 3300042139 Bacteria 10265
119 Ga0450904_002025 3300042139 Bacteria 2559
120 Ga0450906_000403 3300042145 Bacteria 8904
121 Ga0450907_008192 3300042146 Bacteria 1739
122 Ga0450907_008902 3300042146 Bacteria 1665
123 Ga0450908_013401 3300042184 Bacteria 1479
124 Ga0439459_0000062 3300042438 Bacteria 8924
125 Ga0439464_0006160 3300042439 Bacteria 3118
126 Ga0450916_000030 3300042530 Bacteria 7074
127 Ga0450918_004907 3300042531 Bacteria 2416
128 Ga0450893_0001594 3300042532 Bacteria 3475
129 Ga0450893_0015017 3300042532 Bacteria 1303
130 Ga0495617_004489 3300046452 Bacteria 5077
131 Ga0495617_005526 3300046452 Bacteria 4475
132 Ga0495617_008081 3300046452 Bacteria 3635
133 Ga0495617_008484 3300046452 Bacteria 3541
134 Ga0495617_021744 3300046452 Bacteria 2166
135 Ga0495617_034985 3300046452 Bacteria 1687
136 Ga0495617_091182 3300046452 Bacteria 994
137 Ga0495617_098780 3300046452 Bacteria 949
138 Ga0495627_000246 3300046453 Bacteria 57085
139 Ga0495627_000953 3300046453 Bacteria 19856
140 Ga0495627_001633 3300046453 Bacteria 12509
141 Ga0495627_001765 3300046453 Bacteria 11626
142 Ga0495627_051402 3300046453 Bacteria 1238
143 Ga0495592_0164223 3300046454 Bacteria 1525
144 Ga0495603_0031023 3300046455 Bacteria 3218
145 Ga0495590_0003047 3300046457 Bacteria 6869
146 Ga0495590_0008358 3300046457 Bacteria 3955
147 Ga0495590_0026094 3300046457 Bacteria 2052
148 Ga0495590_0047869 3300046457 Bacteria 1491
149 Ga0495591_000019 3300046458 Bacteria 223010
150 Ga0495591_000205 3300046458 Bacteria 60191
151 Ga0495591_001042 3300046458 Bacteria 18709
152 Ga0495591_001566 3300046458 Bacteria 13931
153 Ga0495591_001624 3300046458 Bacteria 13596
154 Ga0495591_001930 3300046458 Bacteria 12142
155 Ga0495591_002832 3300046458 Bacteria 9336
156 Ga0495591_003011 3300046458 Bacteria 8968
157 Ga0495591_003045 3300046458 Bacteria 8905
158 Ga0495591_005380 3300046458 Bacteria 5942
159 Ga0495591_007092 3300046458 Bacteria 4826
160 Ga0495591_010956 3300046458 Bacteria 3465
161 Ga0495591_018667 3300046458 Bacteria 2346
162 Ga0495591_025152 3300046458 Bacteria 1872
163 Ga0495591_063080 3300046458 Bacteria 979
164 Ga0495629_0203851 3300046459 Bacteria 1367
165 Ga0495638_0000129 3300046460 Bacteria 123549
166 Ga0495638_0002867 3300046460 Bacteria 13805
167 Ga0495638_0004852 3300046460 Bacteria 10124
168 Ga0495638_0033421 3300046460 Bacteria 3290
169 Ga0495638_0058519 3300046460 Bacteria 2387
170 Ga0495638_0078968 3300046460 Bacteria 2002
171 Ga0495638_0099796 3300046460 Bacteria 1737
172 Ga0495653_0002354 3300046463 Bacteria 15012
173 Ga0495653_0115921 3300046463 Bacteria 1916
174 Ga0495650_0000392 3300046471 Bacteria 74545
175 Ga0495650_0001565 3300046471 Bacteria 21555
176 Ga0495650_0002459 3300046471 Bacteria 14936
177 Ga0495650_0002495 3300046471 Bacteria 14777
178 Ga0495650_0006047 3300046471 Bacteria 7644
179 Ga0495650_0014382 3300046471 Bacteria 4121
180 Ga0495650_0017582 3300046471 Bacteria 3581
181 Ga0495650_0026026 3300046471 Bacteria 2729
182 Ga0495650_0026743 3300046471 Bacteria 2676
183 Ga0495605_0000014 3300046474 Bacteria 305393
184 Ga0495605_0000030 3300046474 Bacteria 213339
185 Ga0495605_0000763 3300046474 Bacteria 23515
186 Ga0495605_0000909 3300046474 Bacteria 20347
187 Ga0495605_0002004 3300046474 Bacteria 12877
188 Ga0495605_0003819 3300046474 Bacteria 8935
189 Ga0495605_0008550 3300046474 Bacteria 5786
190 Ga0495605_0008629 3300046474 Bacteria 5758
191 Ga0495605_0034517 3300046474 Bacteria 2561
192 Ga0495605_0045658 3300046474 Bacteria 2158
193 Ga0495605_0099892 3300046474 Bacteria 1335
194 Ga0495639_0149550 3300046475 Bacteria 1126
195 Ga0495584_0003815 3300046491 Bacteria 8190
196 Ga0495584_0004805 3300046491 Bacteria 7224
197 Ga0495584_0007706 3300046491 Bacteria 5606
198 Ga0495584_0013835 3300046491 Bacteria 4113
199 Ga0495584_0017822 3300046491 Bacteria 3612
200 Ga0495584_0022528 3300046491 Bacteria 3195
201 Ga0495584_0145157 3300046491 Bacteria 1205
202 Ga0495585_0001101 3300046492 Bacteria 22238
203 Ga0495585_0001554 3300046492 Bacteria 17806
204 Ga0495585_0002369 3300046492 Bacteria 13524
205 Ga0495585_0002609 3300046492 Bacteria 12727
206 Ga0495585_0008451 3300046492 Bacteria 6239
207 Ga0495585_0009593 3300046492 Bacteria 5794
208 Ga0495585_0019075 3300046492 Bacteria 3957
209 Ga0495585_0032322 3300046492 Bacteria 2964
210 Ga0495585_0039371 3300046492 Bacteria 2657
211 Ga0495594_0001414 3300046499 Bacteria 12453
212 Ga0495596_0007899 3300046500 Bacteria 4765
213 Ga0495596_0008674 3300046500 Bacteria 4507
214 Ga0495596_0040155 3300046500 Bacteria 1847
215 Ga0495607_0000288 3300046501 Bacteria 53438
216 Ga0495607_0000786 3300046501 Bacteria 30106
217 Ga0495607_0001843 3300046501 Bacteria 18048
218 Ga0495607_0003135 3300046501 Bacteria 12838
219 Ga0495607_0003728 3300046501 Bacteria 11530
220 Ga0495607_0003902 3300046501 Bacteria 11232
221 Ga0495607_0005045 3300046501 Bacteria 9577
222 Ga0495607_0014389 3300046501 Bacteria 5151
223 Ga0495607_0016905 3300046501 Bacteria 4696
224 Ga0495607_0022877 3300046501 Bacteria 3920
225 Ga0495607_0026020 3300046501 Bacteria 3633
226 Ga0495607_0036968 3300046501 Bacteria 2936
227 Ga0495607_0059164 3300046501 Bacteria 2186
228 Ga0495607_0062262 3300046501 Bacteria 2116
229 Ga0495607_0198349 3300046501 Bacteria 995
230 Ga0495607_0244873 3300046501 Bacteria 865
231 Ga0495583_0000238 3300046506 Bacteria 91142
232 Ga0495583_0001503 3300046506 Bacteria 23204
233 Ga0495583_0002423 3300046506 Bacteria 15994
234 Ga0495583_0003204 3300046506 Bacteria 12808
235 Ga0495583_0003293 3300046506 Bacteria 12530
236 Ga0495583_0004004 3300046506 Bacteria 10856
237 Ga0495583_0007217 3300046506 Bacteria 7046
238 Ga0495606_0000086 3300046507 Bacteria 156764
239 Ga0495606_0000151 3300046507 Bacteria 119548
240 Ga0495606_0000314 3300046507 Bacteria 83573
241 Ga0495606_0003494 3300046507 Bacteria 16641
242 Ga0495606_0003509 3300046507 Bacteria 16588
243 Ga0495606_0016662 3300046507 Bacteria 5592
244 Ga0495606_0030789 3300046507 Bacteria 3741
245 Ga0495606_0061063 3300046507 Bacteria 2412
246 Ga0495606_0163348 3300046507 Bacteria 1297
247 Ga0495606_0218514 3300046507 Bacteria 1075
248 Ga0495610_0002277 3300046512 Bacteria 16214
249 Ga0495610_0002473 3300046512 Bacteria 15494
250 Ga0495610_0004307 3300046512 Bacteria 10568
251 Ga0495610_0005121 3300046512 Bacteria 9424
252 Ga0495610_0006747 3300046512 Bacteria 7797
253 Ga0495610_0012014 3300046512 Bacteria 5245
254 Ga0495610_0038143 3300046512 Bacteria 2440
255 Ga0495610_0067561 3300046512 Bacteria 1679
256 Ga0495616_0001700 3300046513 Bacteria 15013
257 Ga0495616_0001714 3300046513 Bacteria 14956
258 Ga0495616_0002067 3300046513 Bacteria 13489
259 Ga0495616_0017724 3300046513 Bacteria 3923
260 Ga0495616_0020556 3300046513 Bacteria 3588
261 Ga0495616_0038333 3300046513 Bacteria 2461
262 Ga0495616_0041256 3300046513 Bacteria 2354
263 Ga0495616_0062333 3300046513 Bacteria 1826
264 Ga0495616_0066099 3300046513 Bacteria 1760
265 Ga0495616_0133161 3300046513 Bacteria 1137
266 Ga0495620_0000094 3300046515 Bacteria 70534
267 Ga0495620_0000454 3300046515 Bacteria 27182
268 Ga0495620_0000851 3300046515 Bacteria 18847
269 Ga0495620_0001961 3300046515 Bacteria 12055
270 Ga0495620_0004762 3300046515 Bacteria 7632
271 Ga0495620_0009416 3300046515 Bacteria 5197
272 Ga0495620_0010109 3300046515 Bacteria 4988
273 Ga0495620_0012152 3300046515 Bacteria 4462
274 Ga0495620_0021132 3300046515 Bacteria 3165
275 Ga0495620_0036761 3300046515 Bacteria 2187
276 Ga0495630_0002286 3300046517 Bacteria 13336
277 Ga0495630_0073628 3300046517 Bacteria 2572
278 Ga0495631_0000488 3300046518 Bacteria 26555
279 Ga0495631_0001163 3300046518 Bacteria 16265
280 Ga0495631_0001609 3300046518 Bacteria 13496
281 Ga0495631_0014797 3300046518 Bacteria 3756
282 Ga0495631_0022087 3300046518 Bacteria 2959
283 Ga0495631_0035932 3300046518 Bacteria 2214
284 Ga0495632_0001292 3300046519 Bacteria 21166
285 Ga0495632_0001914 3300046519 Bacteria 16652
286 Ga0495632_0002117 3300046519 Bacteria 15493
287 Ga0495632_0003612 3300046519 Bacteria 10879
288 Ga0495632_0004418 3300046519 Bacteria 9558
289 Ga0495632_0005155 3300046519 Bacteria 8717
290 Ga0495632_0013521 3300046519 Bacteria 4655
291 Ga0495632_0019488 3300046519 Bacteria 3693
292 Ga0495632_0045471 3300046519 Bacteria 2186
293 Ga0495637_0000032 3300046520 Bacteria 128687
294 Ga0495637_0000090 3300046520 Bacteria 70678
295 Ga0495637_0001393 3300046520 Bacteria 14422
296 Ga0495637_0001989 3300046520 Bacteria 11563
297 Ga0495637_0002393 3300046520 Bacteria 10384
298 Ga0495637_0005108 3300046520 Bacteria 6730
299 Ga0495637_0005715 3300046520 Bacteria 6304
300 Ga0495637_0007678 3300046520 Bacteria 5334
301 Ga0495637_0009117 3300046520 Bacteria 4845
302 Ga0495637_0035414 3300046520 Bacteria 2180
303 Ga0495643_0000665 3300046522 Bacteria 40500
304 Ga0495643_0005003 3300046522 Bacteria 9086
305 Ga0495643_0024501 3300046522 Bacteria 3423
306 Ga0495643_0029402 3300046522 Bacteria 3074
307 Ga0495643_0048511 3300046522 Bacteria 2294
308 Ga0495643_0067591 3300046522 Bacteria 1882
309 Ga0495643_0077149 3300046522 Bacteria 1741
310 Ga0495643_0103208 3300046522 Bacteria 1459
311 Ga0495643_0132580 3300046522 Bacteria 1249
312 Ga0495644_0000277 3300046523 Bacteria 23543
313 Ga0495644_0001826 3300046523 Bacteria 8579
314 Ga0495644_0051915 3300046523 Bacteria 1539
315 Ga0495648_0001390 3300046524 Bacteria 23808
316 Ga0495648_0001552 3300046524 Bacteria 22438
317 Ga0495648_0003731 3300046524 Bacteria 13287
318 Ga0495648_0003891 3300046524 Bacteria 12947
319 Ga0495648_0006276 3300046524 Bacteria 9725
320 Ga0495648_0006947 3300046524 Bacteria 9128
321 Ga0495648_0017674 3300046524 Bacteria 5087
322 Ga0495648_0020771 3300046524 Bacteria 4567
323 Ga0495648_0060303 3300046524 Bacteria 2258
324 Ga0495648_0148403 3300046524 Bacteria 1225
325 Ga0495648_0158205 3300046524 Bacteria 1174
326 Ga0495666_0001124 3300046526 Bacteria 12812
327 Ga0495666_0126585 3300046526 Bacteria 1194
328 Ga0495654_0001918 3300046530 Bacteria 13798
329 Ga0495654_0002652 3300046530 Bacteria 11375
330 Ga0495654_0003715 3300046530 Bacteria 9262
331 Ga0495654_0005593 3300046530 Bacteria 7273
332 Ga0495654_0006803 3300046530 Bacteria 6456
333 Ga0495654_0021538 3300046530 Bacteria 3352
334 Ga0495654_0029644 3300046530 Bacteria 2789
335 Ga0495654_0041287 3300046530 Bacteria 2295
336 Ga0495654_0074700 3300046530 Bacteria 1600
337 Ga0495654_0154854 3300046530 Bacteria 1010
338 Ga0495654_0154858 3300046530 Bacteria 1010
339 Ga0495587_0002952 3300046536 Bacteria 11367
340 Ga0495587_0123399 3300046536 Bacteria 1483
341 Ga0495609_0000006 3300046538 Bacteria 431833
342 Ga0495609_0000024 3300046538 Bacteria 264100
343 Ga0495609_0000040 3300046538 Bacteria 177058
344 Ga0495609_0001176 3300046538 Bacteria 18064
345 Ga0495609_0002123 3300046538 Bacteria 12461
346 Ga0495609_0005019 3300046538 Bacteria 7080
347 Ga0495609_0010441 3300046538 Bacteria 4450
348 Ga0495597_0000010 3300046542 Bacteria 222418
349 Ga0495597_0002368 3300046542 Bacteria 12098
350 Ga0495597_0003333 3300046542 Bacteria 9467
351 Ga0495597_0005275 3300046542 Bacteria 6864
352 Ga0495597_0029473 3300046542 Bacteria 2505
353 Ga0495597_0043221 3300046542 Bacteria 2007
354 Ga0495597_0048689 3300046542 Bacteria 1874
355 Ga0495622_0001169 3300046557 Bacteria 13597
356 Ga0495622_0055409 3300046557 Bacteria 1839
357 Ga0495633_0000118 3300046558 Bacteria 107914
358 Ga0495633_0004331 3300046558 Bacteria 9060
359 Ga0495633_0106384 3300046558 Bacteria 1301
360 Ga0495656_0108201 3300046615 Bacteria 1296
361 Ga0495668_0005345 3300046616 Bacteria 8758
362 Ga0495668_0016347 3300046616 Bacteria 4312
363 Ga0495668_0018064 3300046616 Bacteria 4081
364 Ga0495668_0040796 3300046616 Bacteria 2588
365 Ga0495668_0081244 3300046616 Bacteria 1778
366 Ga0495668_0105878 3300046616 Bacteria 1538
367 Ga0495634_0002180 3300046642 Bacteria 16448
368 Ga0495611_0000580 3300046648 Bacteria 21129
369 Ga0495611_0000824 3300046648 Bacteria 17105
370 Ga0495611_0003161 3300046648 Bacteria 7303
371 Ga0495611_0003691 3300046648 Bacteria 6701
372 Ga0495611_0004272 3300046648 Bacteria 6210
373 Ga0495611_0034951 3300046648 Bacteria 2224
374 Ga0495611_0120115 3300046648 Bacteria 1225
375 Ga0495625_0001279 3300046660 Bacteria 31563
376 Ga0495625_0005248 3300046660 Bacteria 11916
377 Ga0495625_0006726 3300046660 Bacteria 10184
378 Ga0495625_0056939 3300046660 Bacteria 2781
379 Ga0495625_0164562 3300046660 Bacteria 1484
380 Ga0495635_0000990 3300046663 Bacteria 18718
381 Ga0495661_0000019 3300046665 Bacteria 200606
382 Ga0495661_0000300 3300046665 Bacteria 56183
383 Ga0495661_0001172 3300046665 Bacteria 22850
384 Ga0495661_0005146 3300046665 Bacteria 9316
385 Ga0495661_0005533 3300046665 Bacteria 8965
386 Ga0495661_0014039 3300046665 Bacteria 5369
387 Ga0495661_0022810 3300046665 Bacteria 4069
388 Ga0495661_0040565 3300046665 Bacteria 2886
389 Ga0495657_0067708 3300046675 Bacteria 2342
390 Ga0495623_0001930 3300046679 Bacteria 13925
391 Ga0495623_0005963 3300046679 Bacteria 7939
392 Ga0495646_0006821 3300046680 Bacteria 7246
393 Ga0495646_0019031 3300046680 Bacteria 4349
394 Ga0495613_0007975 3300046689 Bacteria 7881
395 Ga0495613_0017806 3300046689 Bacteria 5294
396 Ga0495613_0262665 3300046689 Bacteria 1202
397 Ga0495624_0001662 3300046690 Bacteria 17053
398 Ga0495670_0000636 3300046691 Bacteria 16756
399 Ga0495670_0013738 3300046691 Bacteria 3981
400 Ga0495670_0020634 3300046691 Bacteria 3250
401 Ga0495671_0002736 3300046692 Bacteria 11049
402 Ga0495671_0003114 3300046692 Bacteria 10306
403 Ga0495671_0004142 3300046692 Bacteria 8739
404 Ga0495671_0006265 3300046692 Bacteria 6892
405 Ga0495671_0013449 3300046692 Bacteria 4433
406 Ga0495671_0017496 3300046692 Bacteria 3815
407 Ga0495671_0100758 3300046692 Bacteria 1412
408 Ga0495649_0000152 3300046694 Bacteria 60670
409 Ga0495649_0003038 3300046694 Bacteria 11507
410 Ga0495649_0004757 3300046694 Bacteria 8805
411 Ga0495649_0004810 3300046694 Bacteria 8744
412 Ga0495649_0005139 3300046694 Bacteria 8394
413 Ga0495649_0009238 3300046694 Bacteria 5873
414 Ga0495649_0012927 3300046694 Bacteria 4833
415 Ga0495649_0014774 3300046694 Bacteria 4462
416 Ga0495649_0019982 3300046694 Bacteria 3758
417 Ga0495649_0024542 3300046694 Bacteria 3361
418 Ga0495649_0029277 3300046694 Bacteria 3047
419 Ga0495649_0076121 3300046694 Bacteria 1796
420 Ga0495649_0083311 3300046694 Bacteria 1708
421 Ga0495589_0001025 3300046794 Bacteria 16878
422 Ga0495589_0001592 3300046794 Bacteria 13016
423 Ga0495589_0004335 3300046794 Bacteria 7567
424 Ga0495589_0004632 3300046794 Bacteria 7309
425 Ga0495589_0019198 3300046794 Bacteria 3507
426 Ga0495589_0052528 3300046794 Bacteria 2013
427 Ga0495660_0001004 3300046810 Bacteria 20529
428 Ga0495660_0002003 3300046810 Bacteria 13242
429 Ga0495660_0002035 3300046810 Bacteria 13141
430 Ga0495660_0002728 3300046810 Bacteria 11144
431 Ga0495660_0003528 3300046810 Bacteria 9642
432 Ga0495660_0003972 3300046810 Bacteria 9028
433 Ga0495660_0004059 3300046810 Bacteria 8941
434 Ga0495660_0004293 3300046810 Bacteria 8639
435 Ga0495660_0004727 3300046810 Bacteria 8219
436 Ga0495660_0013222 3300046810 Bacteria 4781
437 Ga0495660_0030890 3300046810 Bacteria 3015
438 Ga0495660_0090393 3300046810 Bacteria 1592
439 Ga0495660_0210489 3300046810 Bacteria 922
440 Ga0495604_0021656 3300047317 Bacteria 5132
441 Ga0495674_0003856 3300047319 Bacteria 14564
442 Ga0495672_0002363 3300047320 Bacteria 17431
443 Ga0495672_0006516 3300047320 Bacteria 9011
444 Ga0495672_0009677 3300047320 Bacteria 6953
445 Ga0495672_0018050 3300047320 Bacteria 4698
446 Ga0495672_0024066 3300047320 Bacteria 3931
447 Ga0495672_0024909 3300047320 Bacteria 3843
448 Ga0495672_0027886 3300047320 Bacteria 3581
449 Ga0495672_0036599 3300047320 Bacteria 3012
450 Ga0495672_0092804 3300047320 Bacteria 1654
451 Ga0495672_0106452 3300047320 Bacteria 1512
452 Ga0495676_0000010 3300047321 Bacteria 242637
453 Ga0495676_0003312 3300047321 Bacteria 14561
454 Ga0495676_0016858 3300047321 Bacteria 6468
455 Ga0495680_0008109 3300047322 Bacteria 9573
456 Ga0495680_0049125 3300047322 Bacteria 3306
457 Ga0495680_0054495 3300047322 Bacteria 3105
458 Ga0495680_0059450 3300047322 Bacteria 2950
459 Ga0495680_0371231 3300047322 Bacteria 992
460 Ga0495680_0422681 3300047322 Bacteria 916
461 Ga0495683_0000014 3300047323 Bacteria 199398
462 Ga0495683_0000066 3300047323 Bacteria 112097
463 Ga0495683_0000806 3300047323 Bacteria 22310
464 Ga0495683_0003986 3300047323 Bacteria 8490
465 Ga0495683_0007398 3300047323 Bacteria 5945
466 Ga0495683_0022534 3300047323 Bacteria 3238
467 Ga0495683_0032373 3300047323 Bacteria 2663
468 Ga0495683_0072786 3300047323 Bacteria 1686
469 Ga0495683_0192414 3300047323 Bacteria 924
470 Ga0495675_0039103 3300047444 Bacteria 3021
471 Ga0495679_000141 3300047446 Bacteria 64974
472 Ga0495679_002188 3300047446 Bacteria 10231
473 Ga0495679_002199 3300047446 Bacteria 10185
474 Ga0495679_010729 3300047446 Bacteria 3578
475 Ga0495679_027065 3300047446 Bacteria 1896
476 Ga0495673_0000848 3300047469 Bacteria 28427
477 Ga0495673_0001164 3300047469 Bacteria 22266
478 Ga0495673_0001450 3300047469 Bacteria 18865
479 Ga0495673_0001688 3300047469 Bacteria 16955
480 Ga0495673_0002534 3300047469 Bacteria 12753
481 Ga0495673_0003362 3300047469 Bacteria 10583
482 Ga0495673_0004551 3300047469 Bacteria 8653
483 Ga0495673_0004808 3300047469 Bacteria 8360
484 Ga0495673_0011535 3300047469 Bacteria 4747
485 Ga0495673_0024355 3300047469 Bacteria 2926
486 Ga0495673_0029244 3300047469 Bacteria 2602
487 Ga0495673_0034047 3300047469 Bacteria 2357
488 Ga0495673_0034198 3300047469 Bacteria 2351
489 Ga0495673_0040280 3300047469 Bacteria 2112
490 Ga0495673_0068626 3300047469 Bacteria 1497
491 Ga0495681_0001778 3300047470 Bacteria 15885
492 Ga0495681_0003991 3300047470 Bacteria 10155
493 Ga0495681_0005183 3300047470 Bacteria 8766
494 Ga0495681_0005395 3300047470 Bacteria 8569
495 Ga0495681_0007335 3300047470 Bacteria 7060
496 Ga0495681_0011407 3300047470 Bacteria 5292
497 Ga0495681_0015490 3300047470 Bacteria 4310
498 Ga0495681_0029928 3300047470 Bacteria 2780
499 Ga0495681_0056153 3300047470 Bacteria 1833
500 Ga0495681_0074420 3300047470 Bacteria 1531
501 Ga0495681_0111965 3300047470 Bacteria 1181
502 Ga0495681_0245912 3300047470 Bacteria 708
503 Ga0495684_0025230 3300047471 Bacteria 4570
504 Ga0495686_0005736 3300047472 Bacteria 9706
505 Ga0495686_0025137 3300047472 Bacteria 3904
506 Ga0495686_0027461 3300047472 Bacteria 3716
507 Ga0495593_0003875 3300047673 Bacteria 8939
508 Ga0495602_0007090 3300048088 Bacteria 11764
509 Ga0495626_0000013 3300048091 Bacteria 248164
510 Ga0495626_0002705 3300048091 Bacteria 11975
511 Ga0495626_0005843 3300048091 Bacteria 7099
512 Ga0495626_0006552 3300048091 Bacteria 6609
513 Ga0495626_0008729 3300048091 Bacteria 5518
514 Ga0495626_0026105 3300048091 Bacteria 2850
515 Ga0495626_0067670 3300048091 Bacteria 1612
516 Ga0495626_0153608 3300048091 Bacteria 969
517 Ga0496102_0000897 3300048905 Bacteria 28235
518 Ga0496102_0092318 3300048905 Bacteria 2803
519 Ga0496102_0642434 3300048905 Bacteria 984
520 Ga0496103_0001672 3300048906 Bacteria 14511
521 Ga0496106_0069999 3300048909 Bacteria 2679
522 Ga0496111_0455433 3300048914 Bacteria 944
523 Ga0496116_0004738 3300048919 Bacteria 12845
524 Ga0496116_0006230 3300048919 Bacteria 10884
525 Ga0496116_0008850 3300048919 Bacteria 8666
526 Ga0496116_0037820 3300048919 Bacteria 3360
527 Ga0496117_0004144 3300048920 Bacteria 16212
528 Ga0496117_0005741 3300048920 Bacteria 12893
529 Ga0496117_0022230 3300048920 Bacteria 5091
530 Ga0496117_0069016 3300048920 Bacteria 2383
531 Ga0496117_0151020 3300048920 Bacteria 1375
532 Ga0496118_0009822 3300048921 Bacteria 9579
533 Ga0496118_0010381 3300048921 Bacteria 9231
534 Ga0496118_0011218 3300048921 Bacteria 8773
535 Ga0496118_0051280 3300048921 Bacteria 3158
536 Ga0496118_0179873 3300048921 Bacteria 1279
537 Ga0496121_0001706 3300048924 Bacteria 36029
538 Ga0496121_0008345 3300048924 Bacteria 12230
539 Ga0496122_0004349 3300048925 Bacteria 17704
540 Ga0496122_0017459 3300048925 Bacteria 6708
541 Ga0496122_0056598 3300048925 Bacteria 2922
542 Ga0496122_0086653 3300048925 Bacteria 2154
543 Ga0496122_0131385 3300048925 Bacteria 1589
544 Ga0496123_0000165 3300048926 Bacteria 132234
545 Ga0496123_0007295 3300048926 Bacteria 10487
546 Ga0496124_0002322 3300048927 Bacteria 25089
547 Ga0496124_0009091 3300048927 Bacteria 10275
548 Ga0496124_0047031 3300048927 Bacteria 3692
549 Ga0496124_0147699 3300048927 Bacteria 1848
550 Ga0496124_0176765 3300048927 Bacteria 1647
551 Ga0496124_0309142 3300048927 Bacteria 1137
552 Ga0496125_0009805 3300048928 Bacteria 9761
553 Ga0496125_0010144 3300048928 Bacteria 9549
554 Ga0496126_0043517 3300048929 Bacteria 4142
555 Ga0495678_000199 3300049459 Bacteria 70570
556 Ga0495678_000691 3300049459 Bacteria 30808
557 Ga0495678_001621 3300049459 Bacteria 17159
558 Ga0495678_002793 3300049459 Bacteria 11371
559 Ga0495678_003112 3300049459 Bacteria 10516
560 Ga0495678_008592 3300049459 Bacteria 5134
561 Ga0495678_015083 3300049459 Bacteria 3569
562 Ga0495678_016490 3300049459 Bacteria 3376
563 Ga0495678_021574 3300049459 Bacteria 2833
564 Ga0495678_026379 3300049459 Bacteria 2481
565 Ga0495678_060719 3300049459 Bacteria 1421
566 Ga0495682_0001132 3300049460 Bacteria 15473
567 Ga0495682_0001846 3300049460 Bacteria 10628
568 Ga0495682_0003067 3300049460 Bacteria 7592
569 Ga0495682_0011210 3300049460 Bacteria 3454
570 Ga0501032_0031665 3300049569 Bacteria 3626
571 Ga0501039_0221303 3300049575 Bacteria 1488
572 Ga0501241_000147 3300049758 Bacteria 15696
573 Ga0501226_000032 3300049853 Bacteria 73400
574 Ga0500572_000925 3300053111 Bacteria 9055
575 Ga0500618_005928 3300053125 Bacteria 3648
576 Ga0500573_0105241 3300053140 Bacteria 1584
577 Ga0500586_021640 3300053145 Bacteria 2031

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300047470 Ga0495681_0245912 Ga0495681_0245912_22_696 224
2 3300046522 Ga0495643_0132580 Ga0495643_0132580_551_1234 227
3 3300042532 Ga0450893_0001594 Ga0450893_0001594_2703_3419 238
4 3300046458 Ga0495591_007092 Ga0495591_007092_1648_2364 238
5 3300046519 Ga0495632_0013521 Ga0495632_0013521_2277_2993 238
6 3300046542 Ga0495597_0005275 Ga0495597_0005275_3360_4076 238
7 3300046542 Ga0495597_0048689 Ga0495597_0048689_101_817 238
8 3300046648 Ga0495611_0004272 Ga0495611_0004272_3658_4374 238
9 3300046692 Ga0495671_0017496 Ga0495671_0017496_2051_2767 238
10 3300046694 Ga0495649_0000152 Ga0495649_0000152_49857_50573 238
11 3300046810 Ga0495660_0004727 Ga0495660_0004727_658_1374 238
12 3300047469 Ga0495673_0000848 Ga0495673_0000848_16793_17509 238
13 3300048914 Ga0496111_0455433 Ga0496111_0455433_30_746 238
14 3300033180 Ga0307510_10086403 Ga0307510_100864034 239
15 3300046458 Ga0495591_002832 Ga0495591_002832_1624_2343 239
16 3300046471 Ga0495650_0000392 Ga0495650_0000392_64634_65353 239
17 3300046492 Ga0495585_0008451 Ga0495585_0008451_2654_3373 239
18 3300046500 Ga0495596_0008674 Ga0495596_0008674_857_1576 239
19 3300046501 Ga0495607_0036968 Ga0495607_0036968_1584_2303 239
20 3300046501 Ga0495607_0059164 Ga0495607_0059164_1448_2167 239
21 3300046506 Ga0495583_0004004 Ga0495583_0004004_7194_7913 239
22 3300046506 Ga0495583_0007217 Ga0495583_0007217_328_1047 239
23 3300046507 Ga0495606_0000086 Ga0495606_0000086_9193_9912 239
24 3300046512 Ga0495610_0006747 Ga0495610_0006747_1627_2346 239
25 3300046513 Ga0495616_0041256 Ga0495616_0041256_157_876 239
26 3300046515 Ga0495620_0009416 Ga0495620_0009416_1941_2660 239
27 3300046518 Ga0495631_0014797 Ga0495631_0014797_3012_3731 239
28 3300046518 Ga0495631_0035932 Ga0495631_0035932_700_1419 239
29 3300046519 Ga0495632_0001914 Ga0495632_0001914_8619_9338 239
30 3300046519 Ga0495632_0003612 Ga0495632_0003612_9239_9958 239
31 3300046520 Ga0495637_0000032 Ga0495637_0000032_117112_117831 239
32 3300046520 Ga0495637_0000090 Ga0495637_0000090_11258_11977 239
33 3300046523 Ga0495644_0051915 Ga0495644_0051915_479_1198 239
34 3300046524 Ga0495648_0001390 Ga0495648_0001390_12232_12951 239
35 3300046524 Ga0495648_0148403 Ga0495648_0148403_344_1063 239
36 3300046530 Ga0495654_0005593 Ga0495654_0005593_1012_1731 239
37 3300046538 Ga0495609_0000040 Ga0495609_0000040_11225_11944 239
38 3300046616 Ga0495668_0081244 Ga0495668_0081244_87_806 239
39 3300046648 Ga0495611_0000580 Ga0495611_0000580_5401_6120 239
40 3300046660 Ga0495625_0001279 Ga0495625_0001279_10877_11596 239
41 3300046692 Ga0495671_0002736 Ga0495671_0002736_587_1306 239
42 3300046810 Ga0495660_0002003 Ga0495660_0002003_6444_7163 239
43 3300046810 Ga0495660_0004293 Ga0495660_0004293_3752_4471 239
44 3300047320 Ga0495672_0006516 Ga0495672_0006516_7454_8173 239
45 3300047321 Ga0495676_0000010 Ga0495676_0000010_231040_231759 239
46 3300047323 Ga0495683_0022534 Ga0495683_0022534_503_1222 239
47 3300047446 Ga0495679_000141 Ga0495679_000141_26761_27480 239
48 3300047469 Ga0495673_0002534 Ga0495673_0002534_946_1665 239
49 3300047469 Ga0495673_0034047 Ga0495673_0034047_825_1544 239
50 3300047472 Ga0495686_0027461 Ga0495686_0027461_1803_2522 239
51 3300048091 Ga0495626_0000013 Ga0495626_0000013_236564_237283 239
52 3300049459 Ga0495678_000691 Ga0495678_000691_18821_19540 239
53 3300049459 Ga0495678_008592 Ga0495678_008592_431_1150 239
54 3300046513 Ga0495616_0038333 Ga0495616_0038333_1534_2268 240
55 iso_pu_bacteria 2623620443 2624482709 240
56 3300005353 Ga0070669_100005412 Ga0070669_1000054126 244
57 3300025291 Ga0209675_1007413 Ga0209675_10074132 244
58 3300025298 Ga0209050_1000019 Ga0209050_100001910 244
59 3300025303 Ga0209051_1000383 Ga0209051_100038357 244
60 3300025304 Ga0209257_1000357 Ga0209257_100035745 244
61 3300025711 Ga0207696_1006229 Ga0207696_10062296 244
62 3300025735 Ga0207713_1001355 Ga0207713_100135517 244
63 3300025735 Ga0207713_1004556 Ga0207713_10045562 244
64 3300025923 Ga0207681_10002703 Ga0207681_1000270312 244
65 3300041405 Ga0439438_032788 Ga0439438_032788_483_1262 259
66 iso_pu_bacteria 2511231021 2511353943 259
67 iso_pu_bacteria 2808606373 2808905070 259
68 3300047323 Ga0495683_0000014 Ga0495683_0000014_1990_2796 260
69 3300053125 Ga0500618_005928 Ga0500618_005928_888_1694 260
70 iso_pu_bacteria 2599185307 2599971830 261
71 iso_pu_bacteria 2738543020 2739289461 261
72 iso_pu_bacteria 2738543021 2739294773 261
73 iso_pu_bacteria 2842805378 2842808080 261
74 3300046458 Ga0495591_018667 Ga0495591_018667_621_1409 262
75 3300047320 Ga0495672_0027886 Ga0495672_0027886_1923_2711 262
76 iso_pu_bacteria 2600254954 2600443365 262
77 iso_pu_bacteria 2600255389 2602009171 262
78 iso_pu_bacteria 2808606379 2808943432 262
79 iso_pu_bacteria 2811994881 2812370649 262
80 iso_pu_bacteria 2823421272 2823424971 262
81 iso_pu_bacteria 2919501602 2919501710 262
82 iso_pu_bacteria 2923519811 2923524749 262
83 iso_pu_bacteria 2926063275 2926063383 262
84 iso_pu_bacteria 8034962539 8034962957 262
85 iso_pu_bacteria 8055878733 8055882885 262
86 3300009011 Ga0105251_10017679 Ga0105251_100176793 263
87 3300017792 Ga0163161_10008166 Ga0163161_100081665 263
88 3300041408 Ga0439453_0014350 Ga0439453_0014350_132_923 263
89 3300041997 Ga0439431_0001345 Ga0439431_0001345_1139_1930 263
90 3300042000 Ga0439437_000718 Ga0439437_000718_1304_2095 263
91 3300042003 Ga0439443_000923 Ga0439443_000923_509_1300 263
92 3300042012 Ga0439455_0006668 Ga0439455_0006668_728_1519 263
93 3300042115 Ga0450911_000028 Ga0450911_000028_27039_27830 263
94 3300042139 Ga0450904_000061 Ga0450904_000061_9108_9899 263
95 3300042438 Ga0439459_0000062 Ga0439459_0000062_2989_3780 263
96 3300042530 Ga0450916_000030 Ga0450916_000030_1798_2589 263
97 3300046452 Ga0495617_004489 Ga0495617_004489_1403_2194 263
98 3300046460 Ga0495638_0000129 Ga0495638_0000129_120720_121511 263
99 3300046460 Ga0495638_0033421 Ga0495638_0033421_646_1437 263
100 3300046491 Ga0495584_0145157 Ga0495584_0145157_381_1172 263
101 3300046501 Ga0495607_0003728 Ga0495607_0003728_5017_5808 263
102 3300046501 Ga0495607_0062262 Ga0495607_0062262_642_1433 263
103 3300046507 Ga0495606_0061063 Ga0495606_0061063_1543_2334 263
104 3300046520 Ga0495637_0001393 Ga0495637_0001393_4589_5380 263
105 3300046522 Ga0495643_0024501 Ga0495643_0024501_94_885 263
106 3300046522 Ga0495643_0029402 Ga0495643_0029402_2255_3046 263
107 3300046523 Ga0495644_0000277 Ga0495644_0000277_11116_11907 263
108 3300046524 Ga0495648_0001552 Ga0495648_0001552_14240_15031 263
109 3300046530 Ga0495654_0021538 Ga0495654_0021538_2043_2834 263
110 3300046530 Ga0495654_0029644 Ga0495654_0029644_1088_1879 263
111 3300046694 Ga0495649_0024542 Ga0495649_0024542_50_841 263
112 3300046794 Ga0495589_0004335 Ga0495589_0004335_2850_3641 263
113 3300047320 Ga0495672_0036599 Ga0495672_0036599_2084_2875 263
114 3300048091 Ga0495626_0153608 Ga0495626_0153608_83_874 263
115 3300048927 Ga0496124_0009091 Ga0496124_0009091_8860_9651 263
116 3300049459 Ga0495678_026379 Ga0495678_026379_821_1612 263
117 3300049853 Ga0501226_000032 Ga0501226_000032_49239_50030 263
118 3300009011 Ga0105251_10000012 Ga0105251_10000012129 264
119 3300009092 Ga0105250_10000637 Ga0105250_1000063711 264
120 3300025711 Ga0207696_1000138 Ga0207696_100013895 264
121 3300025735 Ga0207713_1000080 Ga0207713_1000080130 264
122 3300046513 Ga0495616_0066099 Ga0495616_0066099_747_1565 264
123 iso_pu_bacteria 2728369097 2729145447 264
124 3300009011 Ga0105251_10000023 Ga0105251_10000023123 265
125 3300009011 Ga0105251_10042422 Ga0105251_100424222 265
126 3300009036 Ga0105244_10116265 Ga0105244_101162652 265
127 3300013100 Ga0157373_10002875 Ga0157373_1000287513 265
128 3300013104 Ga0157370_10000477 Ga0157370_1000047729 265
129 3300013104 Ga0157370_10076652 Ga0157370_100766522 265
130 3300017792 Ga0163161_10079000 Ga0163161_100790002 265
131 3300025728 Ga0207655_1046686 Ga0207655_10466862 265
132 3300025735 Ga0207713_1000078 Ga0207713_100007859 265
133 3300042016 Ga0439463_006746 Ga0439463_006746_710_1507 265
134 3300046453 Ga0495627_051402 Ga0495627_051402_172_969 265
135 3300046458 Ga0495591_000205 Ga0495591_000205_52258_53055 265
136 3300046458 Ga0495591_001042 Ga0495591_001042_6267_7064 265
137 3300046474 Ga0495605_0000909 Ga0495605_0000909_7148_7945 265
138 3300046474 Ga0495605_0008629 Ga0495605_0008629_3026_3823 265
139 3300046501 Ga0495607_0000288 Ga0495607_0000288_46831_47628 265
140 3300046506 Ga0495583_0003293 Ga0495583_0003293_5612_6409 265
141 3300046507 Ga0495606_0000151 Ga0495606_0000151_110481_111278 265
142 3300046507 Ga0495606_0000314 Ga0495606_0000314_37358_38155 265
143 3300046515 Ga0495620_0000454 Ga0495620_0000454_10908_11705 265
144 3300046515 Ga0495620_0021132 Ga0495620_0021132_2110_2907 265
145 3300046522 Ga0495643_0000665 Ga0495643_0000665_12961_13758 265
146 3300046522 Ga0495643_0048511 Ga0495643_0048511_539_1336 265
147 3300046522 Ga0495643_0103208 Ga0495643_0103208_24_821 265
148 3300046616 Ga0495668_0018064 Ga0495668_0018064_1597_2394 265
149 3300046616 Ga0495668_0040796 Ga0495668_0040796_1645_2442 265
150 3300046665 Ga0495661_0014039 Ga0495661_0014039_1030_1827 265
151 3300046691 Ga0495670_0013738 Ga0495670_0013738_426_1223 265
152 3300046692 Ga0495671_0004142 Ga0495671_0004142_4839_5636 265
153 3300046694 Ga0495649_0004757 Ga0495649_0004757_3148_3945 265
154 3300046694 Ga0495649_0005139 Ga0495649_0005139_1128_1925 265
155 3300046694 Ga0495649_0012927 Ga0495649_0012927_889_1686 265
156 3300046810 Ga0495660_0001004 Ga0495660_0001004_9763_10560 265
157 3300047469 Ga0495673_0003362 Ga0495673_0003362_7159_7956 265
158 3300047470 Ga0495681_0029928 Ga0495681_0029928_944_1741 265
159 3300048905 Ga0496102_0092318 Ga0496102_0092318_1712_2509 265
160 3300048905 Ga0496102_0642434 Ga0496102_0642434_104_901 265
161 3300048919 Ga0496116_0037820 Ga0496116_0037820_2435_3232 265
162 3300048920 Ga0496117_0069016 Ga0496117_0069016_481_1278 265
163 3300048920 Ga0496117_0151020 Ga0496117_0151020_80_877 265
164 3300048921 Ga0496118_0051280 Ga0496118_0051280_1404_2201 265
165 3300048924 Ga0496121_0001706 Ga0496121_0001706_10928_11725 265
166 3300048925 Ga0496122_0004349 Ga0496122_0004349_5996_6793 265
167 3300048925 Ga0496122_0056598 Ga0496122_0056598_1211_2008 265
168 3300048926 Ga0496123_0000165 Ga0496123_0000165_120531_121328 265
169 3300048927 Ga0496124_0002322 Ga0496124_0002322_16521_17318 265
170 3300049460 Ga0495682_0001132 Ga0495682_0001132_12460_13257 265
171 3300009036 Ga0105244_10003111 Ga0105244_1000311111 266
172 3300009148 Ga0105243_10003629 Ga0105243_100036295 266
173 3300025292 Ga0209676_1061504 Ga0209676_10615042 266
174 3300025728 Ga0207655_1000021 Ga0207655_100002181 266
175 3300025935 Ga0207709_10004233 Ga0207709_100042335 266
176 3300031548 Ga0307408_100000020 Ga0307408_10000002021 266
177 3300039450 Ga0436363_0664568 Ga0436363_0664568_425_1225 266
178 3300042439 Ga0439464_0006160 Ga0439464_0006160_745_1545 266
179 3300046453 Ga0495627_000246 Ga0495627_000246_10799_11599 266
180 3300046458 Ga0495591_000019 Ga0495591_000019_10892_11692 266
181 3300046471 Ga0495650_0001565 Ga0495650_0001565_9415_10215 266
182 3300046471 Ga0495650_0014382 Ga0495650_0014382_2861_3661 266
183 3300046474 Ga0495605_0000014 Ga0495605_0000014_293722_294522 266
184 3300046474 Ga0495605_0000030 Ga0495605_0000030_50633_51433 266
185 3300046474 Ga0495605_0000763 Ga0495605_0000763_11814_12614 266
186 3300046474 Ga0495605_0034517 Ga0495605_0034517_898_1698 266
187 3300046491 Ga0495584_0004805 Ga0495584_0004805_586_1386 266
188 3300046499 Ga0495594_0001414 Ga0495594_0001414_6536_7336 266
189 3300046501 Ga0495607_0000786 Ga0495607_0000786_7756_8556 266
190 3300046501 Ga0495607_0003135 Ga0495607_0003135_1184_1984 266
191 3300046501 Ga0495607_0244873 Ga0495607_0244873_39_839 266
192 3300046506 Ga0495583_0000238 Ga0495583_0000238_79466_80266 266
193 3300046506 Ga0495583_0001503 Ga0495583_0001503_11123_11923 266
194 3300046506 Ga0495583_0003204 Ga0495583_0003204_11783_12583 266
195 3300046512 Ga0495610_0004307 Ga0495610_0004307_265_1065 266
196 3300046512 Ga0495610_0005121 Ga0495610_0005121_7029_7829 266
197 3300046512 Ga0495610_0067561 Ga0495610_0067561_756_1556 266
198 3300046515 Ga0495620_0000094 Ga0495620_0000094_58874_59674 266
199 3300046515 Ga0495620_0012152 Ga0495620_0012152_2518_3318 266
200 3300046518 Ga0495631_0001609 Ga0495631_0001609_2115_2915 266
201 3300046519 Ga0495632_0001292 Ga0495632_0001292_8835_9635 266
202 3300046520 Ga0495637_0001989 Ga0495637_0001989_471_1271 266
203 3300046520 Ga0495637_0005715 Ga0495637_0005715_4882_5682 266
204 3300046522 Ga0495643_0077149 Ga0495643_0077149_253_1053 266
205 3300046524 Ga0495648_0020771 Ga0495648_0020771_1328_2128 266
206 3300046538 Ga0495609_0000006 Ga0495609_0000006_37567_38367 266
207 3300046538 Ga0495609_0000024 Ga0495609_0000024_10863_11663 266
208 3300046542 Ga0495597_0000010 Ga0495597_0000010_10899_11699 266
209 3300046542 Ga0495597_0002368 Ga0495597_0002368_4246_5046 266
210 3300046558 Ga0495633_0000118 Ga0495633_0000118_96204_97004 266
211 3300046648 Ga0495611_0003161 Ga0495611_0003161_5990_6790 266
212 3300046648 Ga0495611_0003691 Ga0495611_0003691_1954_2754 266
213 3300046665 Ga0495661_0000019 Ga0495661_0000019_10884_11684 266
214 3300046665 Ga0495661_0000300 Ga0495661_0000300_10885_11685 266
215 3300046665 Ga0495661_0001172 Ga0495661_0001172_9883_10683 266
216 3300046691 Ga0495670_0020634 Ga0495670_0020634_1944_2744 266
217 3300046694 Ga0495649_0014774 Ga0495649_0014774_2492_3292 266
218 3300046794 Ga0495589_0001592 Ga0495589_0001592_5639_6439 266
219 3300046810 Ga0495660_0013222 Ga0495660_0013222_1029_1829 266
220 3300046810 Ga0495660_0030890 Ga0495660_0030890_836_1636 266
221 3300047320 Ga0495672_0009677 Ga0495672_0009677_290_1090 266
222 3300047320 Ga0495672_0024066 Ga0495672_0024066_321_1121 266
223 3300047320 Ga0495672_0092804 Ga0495672_0092804_835_1635 266
224 3300047323 Ga0495683_0000066 Ga0495683_0000066_100427_101227 266
225 3300047446 Ga0495679_002199 Ga0495679_002199_7091_7891 266
226 3300047469 Ga0495673_0001164 Ga0495673_0001164_10791_11597 266
227 3300047469 Ga0495673_0001450 Ga0495673_0001450_10836_11636 266
228 3300047469 Ga0495673_0034198 Ga0495673_0034198_942_1742 266
229 3300047470 Ga0495681_0005395 Ga0495681_0005395_528_1328 266
230 3300047470 Ga0495681_0011407 Ga0495681_0011407_1790_2590 266
231 3300048925 Ga0496122_0086653 Ga0496122_0086653_756_1556 266
232 3300049459 Ga0495678_000199 Ga0495678_000199_10871_11671 266
233 3300049459 Ga0495678_002793 Ga0495678_002793_6155_6955 266
234 3300049569 Ga0501032_0031665 Ga0501032_0031665_1505_2335 266
235 3300049575 Ga0501039_0221303 Ga0501039_0221303_246_1076 266
236 3300053140 Ga0500573_0105241 Ga0500573_0105241_405_1205 266
237 iso_pu_bacteria 2990196909 2990200189 266
238 iso_pu_bacteria 640427133 640487912 266
239 iso_pu_bacteria 651053060 651175858 266
240 iso_pu_bacteria 8056172158 8056172540 266
241 3300046474 Ga0495605_0008550 Ga0495605_0008550_2784_3587 267
242 3300046501 Ga0495607_0003902 Ga0495607_0003902_9459_10277 267
243 iso_pu_bacteria 2511231010 2511288419 267
244 iso_pu_bacteria 2511231011 2511297580 267
245 iso_pu_bacteria 2511231023 2511371414 267
246 iso_pu_bacteria 2511231031 2511412958 267
247 iso_pu_bacteria 2600255318 2601799653 267
248 iso_pu_bacteria 2603880185 2606074162 267
249 iso_pu_bacteria 2603880199 2606126193 267
250 iso_pu_bacteria 2713897148 2715751964 267
251 iso_pu_bacteria 2713897149 2715755405 267
252 iso_pu_bacteria 2718217725 2718635922 267
253 iso_pu_bacteria 2738543025 2739314422 267
254 iso_pu_bacteria 2773857673 2774133591 267
255 iso_pu_bacteria 2784132063 2784262519 267
256 iso_pu_bacteria 2808606377 2808932459 267
257 iso_pu_bacteria 2808606381 2808954586 267
258 iso_pu_bacteria 2808606445 2809218618 267
259 iso_pu_bacteria 2818991456 2819654188 267
260 iso_pu_bacteria 2842832357 2842837684 267
261 iso_pu_bacteria 2842843487 2842845348 267
262 iso_pu_bacteria 2852657418 2852662961 267
263 iso_pu_bacteria 2860339153 2860344578 267
264 iso_pu_bacteria 2878029506 2878034638 267
265 iso_pu_bacteria 2880230671 2880235288 267
266 iso_pu_bacteria 2904518522 2904521661 267
267 iso_pu_bacteria 2919063839 2919069443 267
268 iso_pu_bacteria 2919385768 2919388711 267
269 iso_pu_bacteria 2919456309 2919459692 267
270 iso_pu_bacteria 2919487758 2919489972 267
271 iso_pu_bacteria 2931396565 2931397348 267
272 iso_pu_bacteria 2969304461 2969309438 267
273 iso_pu_bacteria 2974289157 2974289206 267
274 iso_pu_bacteria 2998139840 2998144704 267
275 iso_pu_bacteria 3007614139 3007617957 267
276 iso_pu_bacteria 3007619802 3007621921 267
277 iso_pu_bacteria 3007718800 3007723488 267
278 iso_pu_bacteria 3007855910 3007858321 267
279 iso_pu_bacteria 3007861166 3007866163 267
280 iso_pu_bacteria 8029995093 8029996183 267
281 iso_pu_bacteria 8056166840 8056171856 267
282 iso_pu_bacteria 8056177738 8056179843 267
283 iso_pu_bacteria 8056569372 8056574684 267
284 3300003781 Ga0055536_1000822 Ga0055536_100082214 271
285 3300003781 Ga0055536_1000831 Ga0055536_100083110 271
286 3300003791 Ga0055530_10001294 Ga0055530_1000129412 271
287 3300003792 Ga0055540_1000277 Ga0055540_100027710 271
288 3300003794 Ga0055531_10000123 Ga0055531_1000012340 271
289 3300005288 Ga0065714_10073462 Ga0065714_100734622 271
290 3300005548 Ga0070665_100064792 Ga0070665_1000647922 271
291 3300006946 Ga0079104_1007406 Ga0079104_10074065 271
292 3300009011 Ga0105251_10005731 Ga0105251_100057317 271
293 3300009036 Ga0105244_10002038 Ga0105244_100020389 271
294 3300009036 Ga0105244_10003864 Ga0105244_100038649 271
295 3300009036 Ga0105244_10078845 Ga0105244_100788452 271
296 3300009092 Ga0105250_10001848 Ga0105250_100018487 271
297 3300009092 Ga0105250_10002708 Ga0105250_100027082 271
298 3300009148 Ga0105243_10000335 Ga0105243_1000033539 271
299 3300011119 Ga0105246_10000484 Ga0105246_1000048414 271
300 3300012498 Ga0157345_1000093 Ga0157345_100009314 271
301 3300013100 Ga0157373_10001705 Ga0157373_100017059 271
302 3300013100 Ga0157373_10002281 Ga0157373_100022819 271
303 3300013102 Ga0157371_10001483 Ga0157371_1000148319 271
304 3300013102 Ga0157371_10004812 Ga0157371_100048129 271
305 3300013104 Ga0157370_10290433 Ga0157370_102904332 271
306 3300013105 Ga0157369_10033590 Ga0157369_100335905 271
307 3300013306 Ga0163162_10001483 Ga0163162_1000148318 271
308 3300013307 Ga0157372_10005543 Ga0157372_100055439 271
309 3300014497 Ga0182008_10001390 Ga0182008_1000139012 271
310 3300014497 Ga0182008_10036852 Ga0182008_100368522 271
311 3300015261 Ga0182006_1002219 Ga0182006_10022194 271
312 3300015261 Ga0182006_1002578 Ga0182006_10025783 271
313 3300015261 Ga0182006_1027719 Ga0182006_10277192 271
314 3300015265 Ga0182005_1001339 Ga0182005_10013394 271
315 3300017792 Ga0163161_10002271 Ga0163161_100022719 271
316 3300017792 Ga0163161_10007361 Ga0163161_100073615 271
317 3300017792 Ga0163161_10055081 Ga0163161_100550812 271
318 3300025292 Ga0209676_1000010 Ga0209676_1000010853 271
319 3300025292 Ga0209676_1000350 Ga0209676_100035050 271
320 3300025711 Ga0207696_1000213 Ga0207696_100021310 271
321 3300025711 Ga0207696_1001517 Ga0207696_10015179 271
322 3300025711 Ga0207696_1005143 Ga0207696_10051438 271
323 3300025728 Ga0207655_1000954 Ga0207655_100095413 271
324 3300025728 Ga0207655_1003342 Ga0207655_10033427 271
325 3300025728 Ga0207655_1004455 Ga0207655_100445510 271
326 3300025735 Ga0207713_1002469 Ga0207713_100246914 271
327 3300025735 Ga0207713_1007719 Ga0207713_10077196 271
328 3300025933 Ga0207706_10033281 Ga0207706_100332815 271
329 3300025935 Ga0207709_10000189 Ga0207709_1000018941 271
330 3300027111 Ga0209281_1003456 Ga0209281_10034566 271
331 3300028379 Ga0268266_10052790 Ga0268266_100527902 271
332 3300030734 Ga0316179_1104012 Ga0316179_11040122 271
333 3300030735 Ga0316178_1164502 Ga0316178_116450216 271
334 3300031548 Ga0307408_100001505 Ga0307408_10000150513 271
335 3300031911 Ga0307412_10070951 Ga0307412_100709512 271
336 3300031911 Ga0307412_10071700 Ga0307412_100717002 271
337 3300031911 Ga0307412_10107123 Ga0307412_101071232 271
338 3300031911 Ga0307412_10262821 Ga0307412_102628212 271
339 3300031995 Ga0307409_100009952 Ga0307409_1000099526 271
340 3300032004 Ga0307414_10081917 Ga0307414_100819173 271
341 3300033180 Ga0307510_10003501 Ga0307510_1000350114 271
342 3300038705 Ga0237819_01398 Ga0237819_01398_3107_3922 271
343 3300041405 Ga0439438_001132 Ga0439438_001132_5797_6612 271
344 3300041405 Ga0439438_002514 Ga0439438_002514_1169_1984 271
345 3300041407 Ga0439447_000778 Ga0439447_000778_957_1772 271
346 3300041407 Ga0439447_016738 Ga0439447_016738_1053_1868 271
347 3300041411 Ga0439466_0014098 Ga0439466_0014098_1490_2305 271
348 3300041411 Ga0439466_0034560 Ga0439466_0034560_118_933 271
349 3300041411 Ga0439466_0074578 Ga0439466_0074578_55_870 271
350 3300042002 Ga0439442_022533 Ga0439442_022533_370_1185 271
351 3300042004 Ga0439445_0028788 Ga0439445_0028788_331_1146 271
352 3300042006 Ga0439432_005607 Ga0439432_005607_3608_4423 271
353 3300042010 Ga0439452_000620 Ga0439452_000620_7508_8323 271
354 3300042013 Ga0439456_014610 Ga0439456_014610_620_1435 271
355 3300042016 Ga0439463_007097 Ga0439463_007097_1353_2168 271
356 3300042016 Ga0439463_018294 Ga0439463_018294_864_1679 271
357 3300042115 Ga0450911_000325 Ga0450911_000325_10624_11439 271
358 3300042115 Ga0450911_000350 Ga0450911_000350_5355_6170 271
359 3300042137 Ga0450902_001989 Ga0450902_001989_482_1297 271
360 3300042139 Ga0450904_000312 Ga0450904_000312_1685_2500 271
361 3300042139 Ga0450904_002025 Ga0450904_002025_632_1447 271
362 3300042145 Ga0450906_000403 Ga0450906_000403_800_1615 271
363 3300042146 Ga0450907_008192 Ga0450907_008192_134_949 271
364 3300042146 Ga0450907_008902 Ga0450907_008902_82_897 271
365 3300042184 Ga0450908_013401 Ga0450908_013401_277_1092 271
366 3300042531 Ga0450918_004907 Ga0450918_004907_400_1215 271
367 3300042532 Ga0450893_0015017 Ga0450893_0015017_353_1168 271
368 3300046452 Ga0495617_005526 Ga0495617_005526_2711_3526 271
369 3300046452 Ga0495617_008081 Ga0495617_008081_2164_2979 271
370 3300046452 Ga0495617_008484 Ga0495617_008484_1744_2559 271
371 3300046452 Ga0495617_021744 Ga0495617_021744_765_1580 271
372 3300046452 Ga0495617_034985 Ga0495617_034985_260_1075 271
373 3300046452 Ga0495617_091182 Ga0495617_091182_35_850 271
374 3300046452 Ga0495617_098780 Ga0495617_098780_89_904 271
375 3300046453 Ga0495627_000953 Ga0495627_000953_5539_6354 271
376 3300046453 Ga0495627_001633 Ga0495627_001633_4422_5237 271
377 3300046453 Ga0495627_001765 Ga0495627_001765_3709_4524 271
378 3300046454 Ga0495592_0164223 Ga0495592_0164223_489_1304 271
379 3300046455 Ga0495603_0031023 Ga0495603_0031023_2033_2848 271
380 3300046457 Ga0495590_0003047 Ga0495590_0003047_1716_2531 271
381 3300046457 Ga0495590_0008358 Ga0495590_0008358_1014_1829 271
382 3300046457 Ga0495590_0026094 Ga0495590_0026094_339_1154 271
383 3300046457 Ga0495590_0047869 Ga0495590_0047869_476_1291 271
384 3300046458 Ga0495591_001566 Ga0495591_001566_7301_8116 271
385 3300046458 Ga0495591_001624 Ga0495591_001624_7273_8088 271
386 3300046458 Ga0495591_001930 Ga0495591_001930_7269_8084 271
387 3300046458 Ga0495591_003011 Ga0495591_003011_968_1783 271
388 3300046458 Ga0495591_003045 Ga0495591_003045_1028_1843 271
389 3300046458 Ga0495591_005380 Ga0495591_005380_2930_3745 271
390 3300046458 Ga0495591_010956 Ga0495591_010956_929_1744 271
391 3300046458 Ga0495591_025152 Ga0495591_025152_12_827 271
392 3300046458 Ga0495591_063080 Ga0495591_063080_153_968 271
393 3300046459 Ga0495629_0203851 Ga0495629_0203851_375_1190 271
394 3300046460 Ga0495638_0002867 Ga0495638_0002867_2412_3227 271
395 3300046460 Ga0495638_0004852 Ga0495638_0004852_5176_5991 271
396 3300046460 Ga0495638_0058519 Ga0495638_0058519_1048_1863 271
397 3300046460 Ga0495638_0078968 Ga0495638_0078968_575_1390 271
398 3300046460 Ga0495638_0099796 Ga0495638_0099796_75_890 271
399 3300046463 Ga0495653_0002354 Ga0495653_0002354_5729_6544 271
400 3300046463 Ga0495653_0115921 Ga0495653_0115921_703_1518 271
401 3300046471 Ga0495650_0002459 Ga0495650_0002459_2159_2974 271
402 3300046471 Ga0495650_0002495 Ga0495650_0002495_9890_10705 271
403 3300046471 Ga0495650_0006047 Ga0495650_0006047_1283_2098 271
404 3300046471 Ga0495650_0017582 Ga0495650_0017582_1962_2777 271
405 3300046471 Ga0495650_0026026 Ga0495650_0026026_893_1708 271
406 3300046471 Ga0495650_0026743 Ga0495650_0026743_728_1543 271
407 3300046474 Ga0495605_0002004 Ga0495605_0002004_6989_7804 271
408 3300046474 Ga0495605_0003819 Ga0495605_0003819_2160_2975 271
409 3300046474 Ga0495605_0045658 Ga0495605_0045658_680_1495 271
410 3300046474 Ga0495605_0099892 Ga0495605_0099892_325_1140 271
411 3300046475 Ga0495639_0149550 Ga0495639_0149550_119_934 271
412 3300046491 Ga0495584_0003815 Ga0495584_0003815_4712_5527 271
413 3300046491 Ga0495584_0007706 Ga0495584_0007706_4614_5429 271
414 3300046491 Ga0495584_0013835 Ga0495584_0013835_824_1639 271
415 3300046491 Ga0495584_0017822 Ga0495584_0017822_2010_2825 271
416 3300046491 Ga0495584_0022528 Ga0495584_0022528_703_1518 271
417 3300046492 Ga0495585_0001101 Ga0495585_0001101_13890_14705 271
418 3300046492 Ga0495585_0001554 Ga0495585_0001554_7204_8019 271
419 3300046492 Ga0495585_0002369 Ga0495585_0002369_4399_5214 271
420 3300046492 Ga0495585_0002609 Ga0495585_0002609_7243_8058 271
421 3300046492 Ga0495585_0009593 Ga0495585_0009593_4665_5480 271
422 3300046492 Ga0495585_0019075 Ga0495585_0019075_2778_3593 271
423 3300046492 Ga0495585_0032322 Ga0495585_0032322_758_1573 271
424 3300046492 Ga0495585_0039371 Ga0495585_0039371_977_1792 271
425 3300046500 Ga0495596_0007899 Ga0495596_0007899_514_1329 271
426 3300046500 Ga0495596_0040155 Ga0495596_0040155_722_1537 271
427 3300046501 Ga0495607_0001843 Ga0495607_0001843_11585_12400 271
428 3300046501 Ga0495607_0005045 Ga0495607_0005045_6602_7417 271
429 3300046501 Ga0495607_0014389 Ga0495607_0014389_2934_3749 271
430 3300046501 Ga0495607_0016905 Ga0495607_0016905_993_1808 271
431 3300046501 Ga0495607_0022877 Ga0495607_0022877_2039_2854 271
432 3300046501 Ga0495607_0026020 Ga0495607_0026020_876_1691 271
433 3300046501 Ga0495607_0198349 Ga0495607_0198349_92_907 271
434 3300046506 Ga0495583_0002423 Ga0495583_0002423_5457_6272 271
435 3300046507 Ga0495606_0003494 Ga0495606_0003494_10529_11344 271
436 3300046507 Ga0495606_0003509 Ga0495606_0003509_5515_6330 271
437 3300046507 Ga0495606_0016662 Ga0495606_0016662_2808_3623 271
438 3300046507 Ga0495606_0030789 Ga0495606_0030789_893_1708 271
439 3300046507 Ga0495606_0163348 Ga0495606_0163348_153_968 271
440 3300046507 Ga0495606_0218514 Ga0495606_0218514_207_1022 271
441 3300046512 Ga0495610_0002277 Ga0495610_0002277_5728_6543 271
442 3300046512 Ga0495610_0002473 Ga0495610_0002473_9255_10070 271
443 3300046512 Ga0495610_0012014 Ga0495610_0012014_3336_4151 271
444 3300046512 Ga0495610_0038143 Ga0495610_0038143_1001_1816 271
445 3300046513 Ga0495616_0001700 Ga0495616_0001700_9967_10782 271
446 3300046513 Ga0495616_0001714 Ga0495616_0001714_9908_10723 271
447 3300046513 Ga0495616_0002067 Ga0495616_0002067_5468_6283 271
448 3300046513 Ga0495616_0017724 Ga0495616_0017724_2309_3124 271
449 3300046513 Ga0495616_0020556 Ga0495616_0020556_790_1605 271
450 3300046513 Ga0495616_0062333 Ga0495616_0062333_944_1759 271
451 3300046513 Ga0495616_0133161 Ga0495616_0133161_44_859 271
452 3300046515 Ga0495620_0000851 Ga0495620_0000851_7301_8116 271
453 3300046515 Ga0495620_0001961 Ga0495620_0001961_4122_4937 271
454 3300046515 Ga0495620_0004762 Ga0495620_0004762_5983_6798 271
455 3300046515 Ga0495620_0010109 Ga0495620_0010109_1989_2804 271
456 3300046515 Ga0495620_0036761 Ga0495620_0036761_322_1137 271
457 3300046517 Ga0495630_0002286 Ga0495630_0002286_5505_6320 271
458 3300046517 Ga0495630_0073628 Ga0495630_0073628_1714_2529 271
459 3300046518 Ga0495631_0000488 Ga0495631_0000488_7521_8336 271
460 3300046518 Ga0495631_0001163 Ga0495631_0001163_9939_10754 271
461 3300046518 Ga0495631_0022087 Ga0495631_0022087_1502_2317 271
462 3300046519 Ga0495632_0002117 Ga0495632_0002117_3875_4690 271
463 3300046519 Ga0495632_0004418 Ga0495632_0004418_2972_3787 271
464 3300046519 Ga0495632_0005155 Ga0495632_0005155_7095_7910 271
465 3300046519 Ga0495632_0019488 Ga0495632_0019488_2379_3194 271
466 3300046519 Ga0495632_0045471 Ga0495632_0045471_170_985 271
467 3300046520 Ga0495637_0002393 Ga0495637_0002393_5880_6695 271
468 3300046520 Ga0495637_0005108 Ga0495637_0005108_5359_6174 271
469 3300046520 Ga0495637_0007678 Ga0495637_0007678_2457_3272 271
470 3300046520 Ga0495637_0009117 Ga0495637_0009117_1450_2265 271
471 3300046520 Ga0495637_0035414 Ga0495637_0035414_571_1386 271
472 3300046522 Ga0495643_0005003 Ga0495643_0005003_1068_1883 271
473 3300046522 Ga0495643_0067591 Ga0495643_0067591_548_1363 271
474 3300046523 Ga0495644_0001826 Ga0495644_0001826_6415_7230 271
475 3300046524 Ga0495648_0003731 Ga0495648_0003731_7290_8105 271
476 3300046524 Ga0495648_0003891 Ga0495648_0003891_5166_5981 271
477 3300046524 Ga0495648_0006276 Ga0495648_0006276_7259_8074 271
478 3300046524 Ga0495648_0006947 Ga0495648_0006947_2423_3238 271
479 3300046524 Ga0495648_0017674 Ga0495648_0017674_1628_2443 271
480 3300046524 Ga0495648_0060303 Ga0495648_0060303_621_1436 271
481 3300046524 Ga0495648_0158205 Ga0495648_0158205_166_981 271
482 3300046526 Ga0495666_0001124 Ga0495666_0001124_6708_7523 271
483 3300046526 Ga0495666_0126585 Ga0495666_0126585_158_973 271
484 3300046530 Ga0495654_0001918 Ga0495654_0001918_7272_8087 271
485 3300046530 Ga0495654_0002652 Ga0495654_0002652_3287_4102 271
486 3300046530 Ga0495654_0003715 Ga0495654_0003715_6438_7253 271
487 3300046530 Ga0495654_0006803 Ga0495654_0006803_1929_2744 271
488 3300046530 Ga0495654_0041287 Ga0495654_0041287_973_1788 271
489 3300046530 Ga0495654_0074700 Ga0495654_0074700_278_1093 271
490 3300046530 Ga0495654_0154854 Ga0495654_0154854_26_841 271
491 3300046530 Ga0495654_0154858 Ga0495654_0154858_26_841 271
492 3300046536 Ga0495587_0002952 Ga0495587_0002952_4681_5496 271
493 3300046536 Ga0495587_0123399 Ga0495587_0123399_63_878 271
494 3300046538 Ga0495609_0001176 Ga0495609_0001176_6291_7106 271
495 3300046538 Ga0495609_0002123 Ga0495609_0002123_7246_8061 271
496 3300046538 Ga0495609_0005019 Ga0495609_0005019_2189_3004 271
497 3300046538 Ga0495609_0010441 Ga0495609_0010441_2803_3618 271
498 3300046542 Ga0495597_0003333 Ga0495597_0003333_1361_2176 271
499 3300046542 Ga0495597_0029473 Ga0495597_0029473_1278_2093 271
500 3300046542 Ga0495597_0043221 Ga0495597_0043221_634_1449 271
501 3300046557 Ga0495622_0001169 Ga0495622_0001169_7289_8104 271
502 3300046557 Ga0495622_0055409 Ga0495622_0055409_107_922 271
503 3300046558 Ga0495633_0004331 Ga0495633_0004331_7301_8116 271
504 3300046558 Ga0495633_0106384 Ga0495633_0106384_421_1236 271
505 3300046615 Ga0495656_0108201 Ga0495656_0108201_294_1109 271
506 3300046616 Ga0495668_0005345 Ga0495668_0005345_7226_8041 271
507 3300046616 Ga0495668_0016347 Ga0495668_0016347_1222_2037 271
508 3300046616 Ga0495668_0105878 Ga0495668_0105878_202_1017 271
509 3300046642 Ga0495634_0002180 Ga0495634_0002180_7522_8337 271
510 3300046648 Ga0495611_0000824 Ga0495611_0000824_10748_11563 271
511 3300046648 Ga0495611_0034951 Ga0495611_0034951_568_1383 271
512 3300046648 Ga0495611_0120115 Ga0495611_0120115_13_828 271
513 3300046660 Ga0495625_0005248 Ga0495625_0005248_3832_4647 271
514 3300046660 Ga0495625_0006726 Ga0495625_0006726_2193_3008 271
515 3300046660 Ga0495625_0056939 Ga0495625_0056939_755_1570 271
516 3300046660 Ga0495625_0164562 Ga0495625_0164562_166_981 271
517 3300046663 Ga0495635_0000990 Ga0495635_0000990_7238_8053 271
518 3300046665 Ga0495661_0005146 Ga0495661_0005146_3215_4030 271
519 3300046665 Ga0495661_0005533 Ga0495661_0005533_7061_7876 271
520 3300046665 Ga0495661_0022810 Ga0495661_0022810_1265_2080 271
521 3300046665 Ga0495661_0040565 Ga0495661_0040565_1163_1978 271
522 3300046675 Ga0495657_0067708 Ga0495657_0067708_1052_1867 271
523 3300046679 Ga0495623_0001930 Ga0495623_0001930_4925_5740 271
524 3300046679 Ga0495623_0005963 Ga0495623_0005963_6531_7346 271
525 3300046680 Ga0495646_0006821 Ga0495646_0006821_5545_6360 271
526 3300046680 Ga0495646_0019031 Ga0495646_0019031_1418_2233 271
527 3300046689 Ga0495613_0007975 Ga0495613_0007975_4879_5694 271
528 3300046689 Ga0495613_0017806 Ga0495613_0017806_717_1532 271
529 3300046689 Ga0495613_0262665 Ga0495613_0262665_172_987 271
530 3300046690 Ga0495624_0001662 Ga0495624_0001662_5769_6584 271
531 3300046691 Ga0495670_0000636 Ga0495670_0000636_5455_6270 271
532 3300046692 Ga0495671_0003114 Ga0495671_0003114_2619_3434 271
533 3300046692 Ga0495671_0006265 Ga0495671_0006265_3826_4641 271
534 3300046692 Ga0495671_0013449 Ga0495671_0013449_3025_3840 271
535 3300046692 Ga0495671_0100758 Ga0495671_0100758_72_887 271
536 3300046694 Ga0495649_0003038 Ga0495649_0003038_3702_4517 271
537 3300046694 Ga0495649_0004810 Ga0495649_0004810_808_1623 271
538 3300046694 Ga0495649_0009238 Ga0495649_0009238_1229_2044 271
539 3300046694 Ga0495649_0019982 Ga0495649_0019982_2909_3724 271
540 3300046694 Ga0495649_0029277 Ga0495649_0029277_529_1344 271
541 3300046694 Ga0495649_0076121 Ga0495649_0076121_146_961 271
542 3300046694 Ga0495649_0083311 Ga0495649_0083311_290_1105 271
543 3300046794 Ga0495589_0001025 Ga0495589_0001025_9786_10601 271
544 3300046794 Ga0495589_0004632 Ga0495589_0004632_5981_6796 271
545 3300046794 Ga0495589_0019198 Ga0495589_0019198_276_1091 271
546 3300046794 Ga0495589_0052528 Ga0495589_0052528_419_1234 271
547 3300046810 Ga0495660_0002035 Ga0495660_0002035_6994_7809 271
548 3300046810 Ga0495660_0002728 Ga0495660_0002728_3075_3890 271
549 3300046810 Ga0495660_0003528 Ga0495660_0003528_5550_6365 271
550 3300046810 Ga0495660_0003972 Ga0495660_0003972_979_1794 271
551 3300046810 Ga0495660_0004059 Ga0495660_0004059_7099_7914 271
552 3300046810 Ga0495660_0090393 Ga0495660_0090393_239_1054 271
553 3300046810 Ga0495660_0210489 Ga0495660_0210489_65_880 271
554 3300047317 Ga0495604_0021656 Ga0495604_0021656_34_849 271
555 3300047319 Ga0495674_0003856 Ga0495674_0003856_5626_6441 271
556 3300047320 Ga0495672_0002363 Ga0495672_0002363_10760_11575 271
557 3300047320 Ga0495672_0018050 Ga0495672_0018050_2947_3762 271
558 3300047320 Ga0495672_0024909 Ga0495672_0024909_2412_3227 271
559 3300047320 Ga0495672_0106452 Ga0495672_0106452_305_1120 271
560 3300047321 Ga0495676_0003312 Ga0495676_0003312_8174_8989 271
561 3300047321 Ga0495676_0016858 Ga0495676_0016858_2876_3691 271
562 3300047322 Ga0495680_0008109 Ga0495680_0008109_1700_2515 271
563 3300047322 Ga0495680_0049125 Ga0495680_0049125_518_1333 271
564 3300047322 Ga0495680_0054495 Ga0495680_0054495_1245_2060 271
565 3300047322 Ga0495680_0059450 Ga0495680_0059450_682_1497 271
566 3300047322 Ga0495680_0371231 Ga0495680_0371231_88_903 271
567 3300047322 Ga0495680_0422681 Ga0495680_0422681_61_876 271
568 3300047323 Ga0495683_0000806 Ga0495683_0000806_14153_14968 271
569 3300047323 Ga0495683_0003986 Ga0495683_0003986_7053_7868 271
570 3300047323 Ga0495683_0007398 Ga0495683_0007398_2951_3766 271
571 3300047323 Ga0495683_0032373 Ga0495683_0032373_637_1452 271
572 3300047323 Ga0495683_0072786 Ga0495683_0072786_737_1552 271
573 3300047323 Ga0495683_0192414 Ga0495683_0192414_61_876 271
574 3300047444 Ga0495675_0039103 Ga0495675_0039103_489_1304 271
575 3300047446 Ga0495679_002188 Ga0495679_002188_2291_3106 271
576 3300047446 Ga0495679_010729 Ga0495679_010729_1729_2544 271
577 3300047446 Ga0495679_027065 Ga0495679_027065_801_1616 271
578 3300047469 Ga0495673_0001688 Ga0495673_0001688_14264_15079 271
579 3300047469 Ga0495673_0004551 Ga0495673_0004551_7057_7872 271
580 3300047469 Ga0495673_0004808 Ga0495673_0004808_7278_8093 271
581 3300047469 Ga0495673_0011535 Ga0495673_0011535_3823_4638 271
582 3300047469 Ga0495673_0024355 Ga0495673_0024355_110_925 271
583 3300047469 Ga0495673_0029244 Ga0495673_0029244_1656_2471 271
584 3300047469 Ga0495673_0040280 Ga0495673_0040280_1256_2071 271
585 3300047469 Ga0495673_0068626 Ga0495673_0068626_425_1240 271
586 3300047470 Ga0495681_0001778 Ga0495681_0001778_10882_11697 271
587 3300047470 Ga0495681_0003991 Ga0495681_0003991_3819_4634 271
588 3300047470 Ga0495681_0005183 Ga0495681_0005183_694_1509 271
589 3300047470 Ga0495681_0007335 Ga0495681_0007335_851_1666 271
590 3300047470 Ga0495681_0015490 Ga0495681_0015490_706_1521 271
591 3300047470 Ga0495681_0056153 Ga0495681_0056153_575_1390 271
592 3300047470 Ga0495681_0074420 Ga0495681_0074420_285_1100 271
593 3300047470 Ga0495681_0111965 Ga0495681_0111965_98_913 271
594 3300047471 Ga0495684_0025230 Ga0495684_0025230_2801_3616 271
595 3300047472 Ga0495686_0005736 Ga0495686_0005736_8119_8934 271
596 3300047472 Ga0495686_0025137 Ga0495686_0025137_998_1813 271
597 3300047673 Ga0495593_0003875 Ga0495593_0003875_7061_7876 271
598 3300048088 Ga0495602_0007090 Ga0495602_0007090_5190_6005 271
599 3300048091 Ga0495626_0002705 Ga0495626_0002705_3933_4748 271
600 3300048091 Ga0495626_0005843 Ga0495626_0005843_5951_6766 271
601 3300048091 Ga0495626_0006552 Ga0495626_0006552_3969_4784 271
602 3300048091 Ga0495626_0008729 Ga0495626_0008729_636_1451 271
603 3300048091 Ga0495626_0026105 Ga0495626_0026105_1683_2498 271
604 3300048091 Ga0495626_0067670 Ga0495626_0067670_19_834 271
605 3300048905 Ga0496102_0000897 Ga0496102_0000897_19988_20803 271
606 3300048906 Ga0496103_0001672 Ga0496103_0001672_5760_6575 271
607 3300048909 Ga0496106_0069999 Ga0496106_0069999_1280_2095 271
608 3300048919 Ga0496116_0004738 Ga0496116_0004738_4966_5781 271
609 3300048919 Ga0496116_0006230 Ga0496116_0006230_7257_8072 271
610 3300048919 Ga0496116_0008850 Ga0496116_0008850_634_1449 271
611 3300048920 Ga0496117_0004144 Ga0496117_0004144_8025_8840 271
612 3300048920 Ga0496117_0005741 Ga0496117_0005741_6744_7559 271
613 3300048920 Ga0496117_0022230 Ga0496117_0022230_3655_4470 271
614 3300048921 Ga0496118_0009822 Ga0496118_0009822_6418_7233 271
615 3300048921 Ga0496118_0010381 Ga0496118_0010381_8145_8960 271
616 3300048921 Ga0496118_0011218 Ga0496118_0011218_764_1579 271
617 3300048921 Ga0496118_0179873 Ga0496118_0179873_139_954 271
618 3300048924 Ga0496121_0008345 Ga0496121_0008345_4405_5220 271
619 3300048925 Ga0496122_0017459 Ga0496122_0017459_637_1452 271
620 3300048925 Ga0496122_0131385 Ga0496122_0131385_44_859 271
621 3300048926 Ga0496123_0007295 Ga0496123_0007295_7141_7956 271
622 3300048927 Ga0496124_0047031 Ga0496124_0047031_1298_2113 271
623 3300048927 Ga0496124_0147699 Ga0496124_0147699_728_1543 271
624 3300048927 Ga0496124_0176765 Ga0496124_0176765_283_1098 271
625 3300048927 Ga0496124_0309142 Ga0496124_0309142_154_969 271
626 3300048928 Ga0496125_0009805 Ga0496125_0009805_6376_7191 271
627 3300048928 Ga0496125_0010144 Ga0496125_0010144_1928_2743 271
628 3300048929 Ga0496126_0043517 Ga0496126_0043517_2454_3269 271
629 3300049459 Ga0495678_001621 Ga0495678_001621_10610_11425 271
630 3300049459 Ga0495678_003112 Ga0495678_003112_5968_6783 271
631 3300049459 Ga0495678_015083 Ga0495678_015083_2440_3255 271
632 3300049459 Ga0495678_016490 Ga0495678_016490_1601_2416 271
633 3300049459 Ga0495678_021574 Ga0495678_021574_1297_2112 271
634 3300049459 Ga0495678_060719 Ga0495678_060719_287_1102 271
635 3300049460 Ga0495682_0001846 Ga0495682_0001846_7272_8087 271
636 3300049460 Ga0495682_0003067 Ga0495682_0003067_2687_3502 271
637 3300049460 Ga0495682_0011210 Ga0495682_0011210_2029_2844 271
638 3300049758 Ga0501241_000147 Ga0501241_000147_4543_5358 271
639 3300053111 Ga0500572_000925 Ga0500572_000925_1008_1823 271
640 3300053145 Ga0500586_021640 Ga0500586_021640_251_1066 271

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07103

DUF1365

Protein of unknown function (DUF1365)

5

247

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
2pim-assembly1.cif.gz_A crystal structure of a putative thioesterase, phenylacetic acid degradation-related protein (reut_b4779) from ralstonia eutropha jmp134 at 2.20 a resolution 0.7002 171 205
3hm0-assembly1.cif.gz_C crystal structure of probable thioesterase from bartonella henselae 0.6913 171 207
3azb-assembly4.cif.gz_W beta-hydroxyacyl-acyl carrier protein dehydratase (fabz) from plasmodium falciparum in complex with nas91-11 0.6857 171 204
3hm0-assembly1.cif.gz_D crystal structure of probable thioesterase from bartonella henselae 0.6838 171 207
4i83-assembly1.cif.gz_F crystal structure of (3r)-hydroxymyristoyl-acp dehydratase from neisseria meningitidis fam18 0.6768 171 205
ID Description Score Start End Superfamily
af_O46009_146_303_3.40.630.90 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase; 0.7099 107 142 3.40.630.90
3hm0D00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.6838 171 207 3.10.129.10
4zw0B00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.6602 171 205 3.10.129.10
3k67A00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.6534 171 207 3.10.129.10
2gllA00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.6487 171 206 3.10.129.10
ID Description Score Start End GO Terms
AF-A0A2R7QNK0-F1-model_v4 deleted 0.9838 1 231
AF-A0A2R7QNK0-F1-model_v4 deleted 0.9754 1 231
AF-A0A433F9E3-F1-model_v4 deleted 0.973 1 181
AF-A0A2V4LU64-F1-model_v4 DUF1365 domain-containing protein 0.9717 1 268
AF-A0A2V4LU64-F1-model_v4 DUF1365 domain-containing protein 0.9681 1 268

Feature Viewer

pLDDT pTM Quality
82.52 0.82 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map