F471464

General Info

Members Datasets Scaffolds Average Seq Length
637 202 620 292

Family's Representative Sequence

Representative Sequence 3300048905|Ga0496102_0000234|Ga0496102_0000234_50230_51099
Length 279
Sequence LCIGLALMAASLASNASGAVSVRDDNGNIVTLAKPAQRIVSLAPHVTELLFAAGAGARIVGTVSYSDYPEAAKTIPRIGTYSEIDPERVLAMKPDLIVVWTNGNSAREIDTLRRLGIPVFHSEPRKLEDIPDSILRMGQLLGTEVSALAALTRQYANRPPVRMFYQVWDKPMYTLSGAHILSEAIRLCGGTNIFAHLKATAPEVSVEGVLREDPEAIFATAEKNYAGVNIWRPYPAMAAVRADNLFTLDGDLLNRAGPRMITGTAMLCEKLELARRHRK

Samples

Sample ID Description Type Environment
1 2643221554 Duganella sp. Root1480D1 Isolate Unclassified
2 2643221556 Massilia sp. Root1485 Isolate Unclassified
3 2643221638 Duganella sp. Root336D2 Isolate Unclassified
4 2643221645 Massilia sp. Root351 Isolate Unclassified
5 2643221664 Massilia sp. Root418 Isolate Unclassified
6 2643221684 Massilia sp. Root133 Isolate Unclassified
7 2738541280 Massilia sp. GV090 Isolate Unclassified
8 2738541297 Duganella sp. GV083 Isolate Unclassified
9 2738541300 Massilia sp. GV016 Isolate Unclassified
10 2738541357 Duganella sp. GV053 Isolate Unclassified
11 2738543003 Duganella sp. GV066 Isolate Unclassified
12 2738543018 Massilia sp. GV045 Isolate Unclassified
13 2738543026 Duganella sp. GV089 Isolate Unclassified
14 2738543029 Duganella sp. GV039 Isolate Unclassified
15 2738543030 Massilia sp. GV097 Isolate Unclassified
16 2808606418 Herbaspirillum sp. SJZ107 Isolate Rhizosphere
17 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
18 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
19 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
20 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
21 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
22 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
23 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
24 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
25 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
26 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
27 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
28 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
29 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
30 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
31 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
32 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
33 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
34 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
35 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
41 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
42 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
43 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
44 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
45 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
46 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
47 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
48 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
49 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
50 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
51 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
52 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
53 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
54 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
55 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
56 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
57 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
58 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
59 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
60 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
61 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
62 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
63 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
64 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
65 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
66 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
67 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
77 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
78 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
79 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
80 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
81 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
82 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
83 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
84 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
85 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
86 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
87 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
88 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
89 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
90 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
91 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
92 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
93 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
94 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
95 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
96 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
97 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
98 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
99 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
100 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
101 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
102 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
103 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
104 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
105 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
106 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
107 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
108 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
109 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
110 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
111 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
112 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
113 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
114 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
115 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
116 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
117 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
118 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
119 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
120 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
121 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
122 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
123 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
124 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
125 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
126 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
127 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
128 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
129 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
130 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
131 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
132 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
133 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
134 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
135 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
136 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
137 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
138 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
139 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
140 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
141 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
142 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
143 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
144 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
145 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
146 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
147 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
148 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
149 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
150 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
151 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
152 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
153 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
154 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
155 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
156 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
157 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
158 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
159 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
160 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
161 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
162 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
163 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
164 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
165 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
166 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
167 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
168 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
169 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
170 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
171 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
172 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
173 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
174 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
175 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
176 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
177 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
178 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
179 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
180 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
181 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
182 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
183 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
184 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
185 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
186 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
187 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
188 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
189 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
190 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
191 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
192 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
193 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
194 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
195 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
196 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
197 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
198 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
199 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
200 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
201 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
202 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.33
Metatranscriptomes 0
Isolates 2.67

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.3
Nodule 0.31
Rhizoplane 2.98
Rhizosphere 78.81
Stem 0
Stem Tuber 0
Unclassified 6.59

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25158J39367_1000681 3300002739 Bacteria 6591
2 JGI25152J39213_1000549 3300002773 Bacteria 20603
3 JGI25152J39213_1021694 3300002773 Bacteria 1122
4 JGI25150J39212_1000502 3300002774 Bacteria 16240
5 JGI25150J39212_1004880 3300002774 Bacteria 2923
6 JGI25159J45721_1001798 3300002987 Bacteria 8601
7 JGI25159J45721_1002723 3300002987 Bacteria 6562
8 JGI25153J46596_10007043 3300003215 Bacteria 5598
9 rootL2_10140400 3300003322 Bacteria 1334
10 JGI25161J50226_1000379 3300003374 Bacteria 22378
11 Ga0055525_1000512 3300003759 Bacteria 19049
12 Ga0055526_1000877 3300003771 Bacteria 22381
13 Ga0055526_1000886 3300003771 Bacteria 22266
14 Ga0055526_1002284 3300003771 Bacteria 13083
15 Ga0055526_1006688 3300003771 Bacteria 6184
16 Ga0055537_1000672 3300003773 Bacteria 18000
17 Ga0055537_1004064 3300003773 Bacteria 4290
18 Ga0055524_1000819 3300003775 Bacteria 20578
19 Ga0055524_1000840 3300003775 Bacteria 20142
20 Ga0055524_1001202 3300003775 Bacteria 15361
21 Ga0055524_1013080 3300003775 Bacteria 3151
22 Ga0055524_1013579 3300003775 Bacteria 3066
23 Ga0055534_1000640 3300003784 Bacteria 17836
24 Ga0055534_1004505 3300003784 Bacteria 4017
25 Ga0055528_1001091 3300003790 Bacteria 17848
26 Ga0055528_1007142 3300003790 Bacteria 4982
27 Ga0055530_10001716 3300003791 Bacteria 15433
28 Ga0055543_1000506 3300004625 Bacteria 22416
29 Ga0065165_1001674 3300005262 Bacteria 22416
30 Ga0065165_1002135 3300005262 Bacteria 17962
31 Ga0065165_1002855 3300005262 Bacteria 13402
32 Ga0070660_100099016 3300005339 Bacteria 2308
33 Ga0070661_100184779 3300005344 Bacteria 1587
34 Ga0070659_100021686 3300005366 Bacteria 4897
35 Ga0070659_100085943 3300005366 Bacteria 2516
36 Ga0070662_100178974 3300005457 Bacteria 1670
37 Ga0068855_100024300 3300005563 Bacteria 7254
38 Ga0070664_100196894 3300005564 Bacteria 1796
39 Ga0070664_100564065 3300005564 Bacteria 1054
40 Ga0068857_100362507 3300005577 Bacteria 1344
41 Ga0068852_100004824 3300005616 Bacteria 9580
42 Ga0068865_100210435 3300006881 Bacteria 1515
43 Ga0099826_10000422 3300006948 Bacteria 20102
44 Ga0105244_10002702 3300009036 Bacteria 13261
45 Ga0105240_10628438 3300009093 Bacteria 1179
46 Ga0105243_10093566 3300009148 Bacteria 2481
47 Ga0105241_10118366 3300009174 Bacteria 2130
48 Ga0105242_10003480 3300009176 Bacteria 12240
49 Ga0105238_10254407 3300009551 Bacteria 1735
50 Ga0105239_10278621 3300010375 Bacteria 1882
51 Ga0157372_10197147 3300013307 Bacteria 2332
52 Ga0209436_100214 3300025208 Bacteria 26814
53 Ga0209563_100315 3300025230 Bacteria 19183
54 Ga0207425_1000342 3300025245 Bacteria 32358
55 Ga0207425_1000600 3300025245 Bacteria 20926
56 Ga0209677_104775 3300025253 Bacteria 3766
57 Ga0209148_1001274 3300025254 Bacteria 13775
58 Ga0209129_1000742 3300025258 Bacteria 20871
59 Ga0209129_1001471 3300025258 Bacteria 13108
60 Ga0209565_1000804 3300025263 Bacteria 17951
61 Ga0209565_1000845 3300025263 Bacteria 17315
62 Ga0209565_1002322 3300025263 Bacteria 6965
63 Ga0209565_1012418 3300025263 Bacteria 2033
64 Ga0209673_1001762 3300025273 Bacteria 18016
65 Ga0209673_1008832 3300025273 Bacteria 4439
66 Ga0209130_1000891 3300025284 Bacteria 24327
67 Ga0209130_1001230 3300025284 Bacteria 17998
68 Ga0209130_1006703 3300025284 Bacteria 3688
69 Ga0209675_1000977 3300025291 Bacteria 18066
70 Ga0209675_1023486 3300025291 Bacteria 1596
71 Ga0209675_1026531 3300025291 Bacteria 1439
72 Ga0209564_1001562 3300025295 Bacteria 22487
73 Ga0209564_1001569 3300025295 Bacteria 22420
74 Ga0209564_1001911 3300025295 Bacteria 18632
75 Ga0209564_1002214 3300025295 Bacteria 16195
76 Ga0209564_1017945 3300025295 Bacteria 2725
77 Ga0209564_1019176 3300025295 Bacteria 2570
78 Ga0209564_1048082 3300025295 Bacteria 1068
79 Ga0209758_1002107 3300025297 Bacteria 21096
80 Ga0209050_1001108 3300025298 Bacteria 32616
81 Ga0209050_1002184 3300025298 Bacteria 17657
82 Ga0209256_1001037 3300025299 Bacteria 32586
83 Ga0209256_1001732 3300025299 Bacteria 20873
84 Ga0209256_1001792 3300025299 Bacteria 20292
85 Ga0209256_1001848 3300025299 Bacteria 19616
86 Ga0209256_1002026 3300025299 Bacteria 18051
87 Ga0207426_1016899 3300025302 Bacteria 2605
88 Ga0207426_1032255 3300025302 Bacteria 1700
89 Ga0207426_1055840 3300025302 Bacteria 1155
90 Ga0209257_1002687 3300025304 Bacteria 17031
91 Ga0209257_1003159 3300025304 Bacteria 14674
92 Ga0207655_1015780 3300025728 Bacteria 4175
93 Ga0207705_10009946 3300025909 Bacteria 6926
94 Ga0207705_10048870 3300025909 Bacteria 3044
95 Ga0207654_10162008 3300025911 Bacteria 1446
96 Ga0207657_10014047 3300025919 Bacteria 7834
97 Ga0207657_10041578 3300025919 Bacteria 4064
98 Ga0207657_10321131 3300025919 Bacteria 1224
99 Ga0207690_10017125 3300025932 Bacteria 4420
100 Ga0207690_10503372 3300025932 Bacteria 980
101 Ga0207686_10047996 3300025934 Bacteria 2643
102 Ga0207679_10188978 3300025945 Bacteria 1711
103 Ga0207667_10005899 3300025949 Bacteria 14917
104 Ga0207667_10113180 3300025949 Bacteria 2798
105 Ga0207674_10244974 3300026116 Bacteria 1739
106 Ga0209282_1000454 3300027666 Bacteria 20110
107 Ga0316177_1064561 3300030731 Bacteria 1435
108 Ga0316180_1083442 3300030736 Bacteria 4854
109 Ga0307408_100000547 3300031548 Bacteria 32422
110 Ga0307408_100001099 3300031548 Bacteria 20618
111 Ga0307408_100001865 3300031548 Bacteria 15375
112 Ga0307408_100003280 3300031548 Bacteria 11125
113 Ga0307408_100017982 3300031548 Bacteria 4741
114 Ga0265314_10013340 3300031711 Bacteria 6643
115 Ga0307518_10027805 3300031838 Bacteria 4080
116 Ga0395899_0000575 3300037312 Bacteria 39137
117 Ga0395899_0010000 3300037312 Bacteria 7275
118 Ga0395899_0011505 3300037312 Bacteria 6774
119 Ga0395900_0004991 3300037418 Bacteria 13944
120 Ga0395900_0006961 3300037418 Bacteria 11726
121 Ga0395900_0010251 3300037418 Bacteria 9582
122 Ga0395900_0017243 3300037418 Bacteria 7370
123 Ga0395900_0056389 3300037418 Bacteria 4044
124 Ga0395898_0052493 3300037466 Bacteria 3983
125 Ga0395898_0139328 3300037466 Bacteria 2322
126 Ga0395905_0087245 3300037471 Bacteria 2925
127 Ga0395905_0173003 3300037471 Bacteria 2028
128 Ga0395905_0436000 3300037471 Bacteria 1207
129 Ga0395905_0584003 3300037471 Bacteria 1019
130 Ga0395901_0002314 3300038443 Bacteria 19420
131 Ga0395901_0014314 3300038443 Bacteria 8076
132 Ga0395901_0234390 3300038443 Bacteria 1916
133 Ga0395901_0601631 3300038443 Bacteria 1108
134 Ga0439448_0044832 3300042005 Bacteria 1438
135 Ga0439450_031742 3300042008 Bacteria 1190
136 Ga0450904_000471 3300042139 Bacteria 7911
137 Ga0450906_030041 3300042145 Unclassified 961
138 Ga0466969_0024243 3300044656 Bacteria 3121
139 Ga0466969_0031202 3300044656 Bacteria 2714
140 Ga0466972_0000921 3300044658 Bacteria 14160
141 Ga0466982_0073683 3300044672 Bacteria 2110
142 Ga0466965_0027340 3300044683 Bacteria 2769
143 Ga0466965_0035640 3300044683 Bacteria 2437
144 Ga0466965_0041753 3300044683 Bacteria 2260
145 Ga0466965_0075707 3300044683 Bacteria 1697
146 Ga0466965_0090591 3300044683 Bacteria 1555
147 Ga0466966_0027587 3300044684 Bacteria 3702
148 Ga0466966_0040908 3300044684 Bacteria 2980
149 Ga0466966_0112712 3300044684 Bacteria 1675
150 Ga0466966_0134333 3300044684 Bacteria 1513
151 Ga0466966_0151986 3300044684 Bacteria 1412
152 Ga0466961_0098650 3300044693 Bacteria 1841
153 Ga0466961_0164779 3300044693 Bacteria 1380
154 Ga0466963_0027664 3300044694 Bacteria 3633
155 Ga0466964_0000792 3300044706 Bacteria 10309
156 Ga0466964_0001636 3300044706 Bacteria 7733
157 Ga0466968_0000947 3300044735 Bacteria 10219
158 Ga0466970_0260684 3300044765 Bacteria 972
159 Ga0466957_0000785 3300044842 Bacteria 16255
160 Ga0466957_0012176 3300044842 Bacteria 4977
161 Ga0466959_0044702 3300045049 Bacteria 3262
162 Ga0466958_0037452 3300045836 Bacteria 2906
163 Ga0466958_0044808 3300045836 Bacteria 2666
164 Ga0466967_0004108 3300045976 Bacteria 9726
165 Ga0466967_0020244 3300045976 Bacteria 5372
166 Ga0466967_0048308 3300045976 Bacteria 3715
167 Ga0495617_000782 3300046452 Bacteria 15458
168 Ga0495617_001986 3300046452 Bacteria 8525
169 Ga0495627_001262 3300046453 Bacteria 15611
170 Ga0495627_006391 3300046453 Bacteria 4621
171 Ga0495603_0011730 3300046455 Bacteria 5304
172 Ga0495603_0133427 3300046455 Bacteria 1445
173 Ga0495590_0000697 3300046457 Bacteria 15390
174 Ga0495590_0007728 3300046457 Bacteria 4130
175 Ga0495590_0012030 3300046457 Bacteria 3221
176 Ga0495590_0014544 3300046457 Bacteria 2869
177 Ga0495591_002965 3300046458 Bacteria 9064
178 Ga0495591_010249 3300046458 Bacteria 3648
179 Ga0495629_0135195 3300046459 Bacteria 1716
180 Ga0495638_0010363 3300046460 Bacteria 6483
181 Ga0495638_0017175 3300046460 Bacteria 4832
182 Ga0495638_0030564 3300046460 Bacteria 3466
183 Ga0495638_0063899 3300046460 Bacteria 2268
184 Ga0495653_0000925 3300046463 Bacteria 22692
185 Ga0495653_0058490 3300046463 Bacteria 2929
186 Ga0495653_0076771 3300046463 Bacteria 2482
187 Ga0495653_0158657 3300046463 Bacteria 1572
188 Ga0495650_0001486 3300046471 Bacteria 22438
189 Ga0495650_0001826 3300046471 Bacteria 19087
190 Ga0495650_0001842 3300046471 Bacteria 18973
191 Ga0495650_0002555 3300046471 Bacteria 14451
192 Ga0495582_0009550 3300046473 Bacteria 5343
193 Ga0495605_0000802 3300046474 Bacteria 22441
194 Ga0495605_0001130 3300046474 Bacteria 17690
195 Ga0495605_0001456 3300046474 Bacteria 15465
196 Ga0495605_0002350 3300046474 Bacteria 11774
197 Ga0495605_0006640 3300046474 Bacteria 6626
198 Ga0495605_0011154 3300046474 Bacteria 5021
199 Ga0495605_0017844 3300046474 Bacteria 3812
200 Ga0495605_0017899 3300046474 Bacteria 3805
201 Ga0495605_0020590 3300046474 Bacteria 3504
202 Ga0495605_0033342 3300046474 Bacteria 2614
203 Ga0495605_0056799 3300046474 Bacteria 1887
204 Ga0495605_0060763 3300046474 Bacteria 1810
205 Ga0495639_0114394 3300046475 Bacteria 1283
206 Ga0495584_0000946 3300046491 Bacteria 18272
207 Ga0495584_0001277 3300046491 Bacteria 15320
208 Ga0495584_0001383 3300046491 Bacteria 14618
209 Ga0495584_0003485 3300046491 Bacteria 8639
210 Ga0495584_0006014 3300046491 Bacteria 6390
211 Ga0495584_0008232 3300046491 Bacteria 5406
212 Ga0495584_0008512 3300046491 Bacteria 5311
213 Ga0495584_0014493 3300046491 Bacteria 4016
214 Ga0495584_0023658 3300046491 Bacteria 3114
215 Ga0495584_0023762 3300046491 Bacteria 3107
216 Ga0495584_0110909 3300046491 Bacteria 1388
217 Ga0495584_0131685 3300046491 Bacteria 1269
218 Ga0495585_0007119 3300046492 Bacteria 6872
219 Ga0495585_0008253 3300046492 Bacteria 6322
220 Ga0495585_0009043 3300046492 Bacteria 6000
221 Ga0495585_0012538 3300046492 Bacteria 4993
222 Ga0495585_0018107 3300046492 Bacteria 4064
223 Ga0495585_0048508 3300046492 Bacteria 2360
224 Ga0495585_0049258 3300046492 Bacteria 2340
225 Ga0495594_0005077 3300046499 Bacteria 6774
226 Ga0495594_0009818 3300046499 Bacteria 4957
227 Ga0495596_0002084 3300046500 Bacteria 10960
228 Ga0495596_0002769 3300046500 Bacteria 9181
229 Ga0495596_0019127 3300046500 Bacteria 2817
230 Ga0495596_0021973 3300046500 Bacteria 2599
231 Ga0495596_0022390 3300046500 Bacteria 2573
232 Ga0495596_0025443 3300046500 Bacteria 2392
233 Ga0495596_0034448 3300046500 Bacteria 2010
234 Ga0495596_0037879 3300046500 Bacteria 1906
235 Ga0495596_0039576 3300046500 Bacteria 1862
236 Ga0495596_0062182 3300046500 Bacteria 1453
237 Ga0495607_0001012 3300046501 Bacteria 25861
238 Ga0495607_0002629 3300046501 Bacteria 14426
239 Ga0495607_0002912 3300046501 Bacteria 13496
240 Ga0495607_0003122 3300046501 Bacteria 12864
241 Ga0495607_0005328 3300046501 Bacteria 9241
242 Ga0495607_0006408 3300046501 Bacteria 8290
243 Ga0495607_0006789 3300046501 Bacteria 7996
244 Ga0495607_0008591 3300046501 Bacteria 6971
245 Ga0495607_0009636 3300046501 Bacteria 6527
246 Ga0495607_0010921 3300046501 Bacteria 6076
247 Ga0495607_0014580 3300046501 Bacteria 5111
248 Ga0495607_0017589 3300046501 Bacteria 4583
249 Ga0495607_0077505 3300046501 Bacteria 1836
250 Ga0495607_0154738 3300046501 Bacteria 1170
251 Ga0495583_0002012 3300046506 Bacteria 18526
252 Ga0495583_0002508 3300046506 Bacteria 15547
253 Ga0495583_0004714 3300046506 Bacteria 9593
254 Ga0495583_0005193 3300046506 Bacteria 8962
255 Ga0495583_0006362 3300046506 Bacteria 7741
256 Ga0495583_0006506 3300046506 Bacteria 7628
257 Ga0495583_0008287 3300046506 Bacteria 6372
258 Ga0495583_0015930 3300046506 Bacteria 4065
259 Ga0495583_0018766 3300046506 Bacteria 3631
260 Ga0495583_0119049 3300046506 Bacteria 1113
261 Ga0495606_0002301 3300046507 Bacteria 22541
262 Ga0495606_0004335 3300046507 Bacteria 14259
263 Ga0495606_0008407 3300046507 Bacteria 8977
264 Ga0495606_0009094 3300046507 Bacteria 8460
265 Ga0495606_0027804 3300046507 Bacteria 4002
266 Ga0495606_0112745 3300046507 Bacteria 1638
267 Ga0495606_0123921 3300046507 Bacteria 1543
268 Ga0495606_0153090 3300046507 Bacteria 1352
269 Ga0495610_0003292 3300046512 Bacteria 12716
270 Ga0495610_0005073 3300046512 Bacteria 9488
271 Ga0495616_0001607 3300046513 Bacteria 15485
272 Ga0495616_0004816 3300046513 Bacteria 8454
273 Ga0495616_0006982 3300046513 Bacteria 6799
274 Ga0495616_0010006 3300046513 Bacteria 5510
275 Ga0495616_0012547 3300046513 Bacteria 4806
276 Ga0495616_0014197 3300046513 Bacteria 4468
277 Ga0495616_0026755 3300046513 Bacteria 3065
278 Ga0495616_0032552 3300046513 Bacteria 2722
279 Ga0495616_0049640 3300046513 Bacteria 2102
280 Ga0495616_0115449 3300046513 Bacteria 1243
281 Ga0495631_0001278 3300046518 Bacteria 15495
282 Ga0495631_0001506 3300046518 Bacteria 14043
283 Ga0495631_0005842 3300046518 Bacteria 6413
284 Ga0495631_0008951 3300046518 Bacteria 5020
285 Ga0495631_0009728 3300046518 Bacteria 4791
286 Ga0495631_0014170 3300046518 Bacteria 3852
287 Ga0495631_0015523 3300046518 Bacteria 3646
288 Ga0495631_0046630 3300046518 Bacteria 1904
289 Ga0495631_0047948 3300046518 Bacteria 1874
290 Ga0495632_0002052 3300046519 Bacteria 15821
291 Ga0495632_0002136 3300046519 Bacteria 15352
292 Ga0495632_0002147 3300046519 Bacteria 15301
293 Ga0495632_0002589 3300046519 Bacteria 13637
294 Ga0495632_0009099 3300046519 Bacteria 6011
295 Ga0495632_0009511 3300046519 Bacteria 5854
296 Ga0495632_0011579 3300046519 Bacteria 5138
297 Ga0495632_0050663 3300046519 Bacteria 2046
298 Ga0495632_0152948 3300046519 Bacteria 1066
299 Ga0495637_0001253 3300046520 Bacteria 15327
300 Ga0495637_0003685 3300046520 Bacteria 8098
301 Ga0495637_0093198 3300046520 Bacteria 1185
302 Ga0495643_0001164 3300046522 Bacteria 25691
303 Ga0495643_0001336 3300046522 Bacteria 23272
304 Ga0495643_0008991 3300046522 Bacteria 6273
305 Ga0495643_0016175 3300046522 Bacteria 4388
306 Ga0495643_0080492 3300046522 Bacteria 1695
307 Ga0495643_0119777 3300046522 Bacteria 1331
308 Ga0495644_0000617 3300046523 Bacteria 14941
309 Ga0495644_0000677 3300046523 Bacteria 14170
310 Ga0495644_0003594 3300046523 Bacteria 6108
311 Ga0495644_0004334 3300046523 Bacteria 5575
312 Ga0495644_0004432 3300046523 Bacteria 5515
313 Ga0495644_0018567 3300046523 Bacteria 2657
314 Ga0495644_0024309 3300046523 Bacteria 2304
315 Ga0495648_0003847 3300046524 Bacteria 13024
316 Ga0495648_0003952 3300046524 Bacteria 12833
317 Ga0495648_0008223 3300046524 Bacteria 8227
318 Ga0495648_0019602 3300046524 Bacteria 4748
319 Ga0495648_0025252 3300046524 Bacteria 4026
320 Ga0495648_0055650 3300046524 Bacteria 2384
321 Ga0495666_0000849 3300046526 Bacteria 14167
322 Ga0495666_0015136 3300046526 Bacteria 3841
323 Ga0495666_0096674 3300046526 Bacteria 1392
324 Ga0495642_0000437 3300046528 Bacteria 22011
325 Ga0495642_0000792 3300046528 Bacteria 15337
326 Ga0495642_0001095 3300046528 Bacteria 12520
327 Ga0495642_0002612 3300046528 Bacteria 7264
328 Ga0495642_0004104 3300046528 Bacteria 5682
329 Ga0495642_0009103 3300046528 Bacteria 3800
330 Ga0495642_0009615 3300046528 Bacteria 3699
331 Ga0495642_0010069 3300046528 Bacteria 3620
332 Ga0495642_0019339 3300046528 Bacteria 2669
333 Ga0495642_0036289 3300046528 Bacteria 1992
334 Ga0495642_0045211 3300046528 Bacteria 1799
335 Ga0495654_0002902 3300046530 Bacteria 10750
336 Ga0495654_0005600 3300046530 Bacteria 7268
337 Ga0495654_0006437 3300046530 Bacteria 6673
338 Ga0495654_0024089 3300046530 Bacteria 3148
339 Ga0495665_0026819 3300046531 Bacteria 3093
340 Ga0495640_0123800 3300046533 Bacteria 1678
341 Ga0495586_0014891 3300046535 Bacteria 4133
342 Ga0495609_0001195 3300046538 Bacteria 17862
343 Ga0495609_0001452 3300046538 Bacteria 15745
344 Ga0495609_0001812 3300046538 Bacteria 13712
345 Ga0495609_0002751 3300046538 Bacteria 10582
346 Ga0495609_0003288 3300046538 Bacteria 9324
347 Ga0495609_0013720 3300046538 Bacteria 3821
348 Ga0495609_0014427 3300046538 Bacteria 3713
349 Ga0495609_0020364 3300046538 Bacteria 3065
350 Ga0495609_0035963 3300046538 Bacteria 2239
351 Ga0495609_0048855 3300046538 Bacteria 1889
352 Ga0495597_0000891 3300046542 Bacteria 23259
353 Ga0495597_0001690 3300046542 Bacteria 15303
354 Ga0495597_0001914 3300046542 Bacteria 14105
355 Ga0495597_0004571 3300046542 Bacteria 7564
356 Ga0495597_0006321 3300046542 Bacteria 6137
357 Ga0495597_0007924 3300046542 Bacteria 5354
358 Ga0495597_0022348 3300046542 Bacteria 2934
359 Ga0495597_0077299 3300046542 Bacteria 1427
360 Ga0495622_0000393 3300046557 Bacteria 29591
361 Ga0495622_0049321 3300046557 Bacteria 1954
362 Ga0495622_0113477 3300046557 Bacteria 1240
363 Ga0495633_0001179 3300046558 Bacteria 20985
364 Ga0495633_0001946 3300046558 Bacteria 15002
365 Ga0495633_0004089 3300046558 Bacteria 9413
366 Ga0495633_0004106 3300046558 Bacteria 9394
367 Ga0495633_0005277 3300046558 Bacteria 7953
368 Ga0495633_0014400 3300046558 Bacteria 4138
369 Ga0495633_0028343 3300046558 Bacteria 2730
370 Ga0495633_0036778 3300046558 Bacteria 2344
371 Ga0495633_0038100 3300046558 Bacteria 2297
372 Ga0495633_0042748 3300046558 Bacteria 2151
373 Ga0495633_0086085 3300046558 Bacteria 1461
374 Ga0495656_0004035 3300046615 Bacteria 4991
375 Ga0495656_0112345 3300046615 Bacteria 1276
376 Ga0495668_0001481 3300046616 Bacteria 22492
377 Ga0495668_0001986 3300046616 Bacteria 17919
378 Ga0495668_0001997 3300046616 Bacteria 17831
379 Ga0495668_0002377 3300046616 Bacteria 15621
380 Ga0495668_0002406 3300046616 Bacteria 15490
381 Ga0495668_0002431 3300046616 Bacteria 15345
382 Ga0495668_0010999 3300046616 Bacteria 5444
383 Ga0495668_0037307 3300046616 Bacteria 2719
384 Ga0495634_0046669 3300046642 Bacteria 2922
385 Ga0495611_0001011 3300046648 Bacteria 14895
386 Ga0495611_0001330 3300046648 Bacteria 12528
387 Ga0495611_0001846 3300046648 Bacteria 10118
388 Ga0495611_0005157 3300046648 Bacteria 5600
389 Ga0495611_0014575 3300046648 Bacteria 3361
390 Ga0495611_0015458 3300046648 Bacteria 3263
391 Ga0495611_0050834 3300046648 Bacteria 1867
392 Ga0495611_0116584 3300046648 Bacteria 1245
393 Ga0495625_0002013 3300046660 Bacteria 22900
394 Ga0495625_0025968 3300046660 Bacteria 4432
395 Ga0495625_0044254 3300046660 Bacteria 3224
396 Ga0495625_0066969 3300046660 Bacteria 2528
397 Ga0495625_0074719 3300046660 Bacteria 2373
398 Ga0495625_0197130 3300046660 Bacteria 1331
399 Ga0495625_0272727 3300046660 Bacteria 1091
400 Ga0495659_0000322 3300046664 Bacteria 18883
401 Ga0495659_0000611 3300046664 Bacteria 13148
402 Ga0495659_0010267 3300046664 Bacteria 3000
403 Ga0495661_0002518 3300046665 Bacteria 14074
404 Ga0495661_0002637 3300046665 Bacteria 13722
405 Ga0495661_0003056 3300046665 Bacteria 12601
406 Ga0495661_0005248 3300046665 Bacteria 9218
407 Ga0495661_0008903 3300046665 Bacteria 6913
408 Ga0495661_0009955 3300046665 Bacteria 6499
409 Ga0495661_0012579 3300046665 Bacteria 5712
410 Ga0495661_0020515 3300046665 Bacteria 4312
411 Ga0495661_0024872 3300046665 Bacteria 3875
412 Ga0495661_0024940 3300046665 Bacteria 3869
413 Ga0495661_0055295 3300046665 Bacteria 2379
414 Ga0495661_0066896 3300046665 Bacteria 2112
415 Ga0495661_0113124 3300046665 Bacteria 1510
416 Ga0495661_0130038 3300046665 Bacteria 1380
417 Ga0495661_0168409 3300046665 Bacteria 1170
418 Ga0495661_0183941 3300046665 Bacteria 1105
419 Ga0495588_0000503 3300046674 Bacteria 18986
420 Ga0495588_0007186 3300046674 Bacteria 5053
421 Ga0495588_0070143 3300046674 Bacteria 1821
422 Ga0495588_0072309 3300046674 Bacteria 1794
423 Ga0495669_0006338 3300046684 Bacteria 4942
424 Ga0495669_0009869 3300046684 Bacteria 4034
425 Ga0495669_0020502 3300046684 Bacteria 2862
426 Ga0495669_0041813 3300046684 Bacteria 2036
427 Ga0495613_0048950 3300046689 Bacteria 3120
428 Ga0495613_0125236 3300046689 Bacteria 1843
429 Ga0495670_0002302 3300046691 Bacteria 9439
430 Ga0495670_0008668 3300046691 Bacteria 5004
431 Ga0495670_0013230 3300046691 Bacteria 4058
432 Ga0495670_0026716 3300046691 Bacteria 2858
433 Ga0495670_0069099 3300046691 Bacteria 1785
434 Ga0495670_0069703 3300046691 Bacteria 1778
435 Ga0495670_0095058 3300046691 Bacteria 1528
436 Ga0495670_0168917 3300046691 Bacteria 1151
437 Ga0495671_0001117 3300046692 Bacteria 18541
438 Ga0495671_0001521 3300046692 Bacteria 15467
439 Ga0495671_0002076 3300046692 Bacteria 12852
440 Ga0495671_0004627 3300046692 Bacteria 8162
441 Ga0495671_0004650 3300046692 Bacteria 8131
442 Ga0495671_0008181 3300046692 Bacteria 5902
443 Ga0495671_0025028 3300046692 Bacteria 3105
444 Ga0495671_0033527 3300046692 Bacteria 2615
445 Ga0495671_0052160 3300046692 Bacteria 2033
446 Ga0495649_0001876 3300046694 Bacteria 15366
447 Ga0495649_0003339 3300046694 Bacteria 10888
448 Ga0495649_0005080 3300046694 Bacteria 8450
449 Ga0495649_0022613 3300046694 Bacteria 3517
450 Ga0495649_0045760 3300046694 Bacteria 2384
451 Ga0495649_0048379 3300046694 Bacteria 2311
452 Ga0495649_0079796 3300046694 Bacteria 1750
453 Ga0495589_0000956 3300046794 Bacteria 17690
454 Ga0495589_0001061 3300046794 Bacteria 16503
455 Ga0495589_0001434 3300046794 Bacteria 13757
456 Ga0495589_0006715 3300046794 Bacteria 6060
457 Ga0495589_0062507 3300046794 Bacteria 1826
458 Ga0495589_0103269 3300046794 Bacteria 1378
459 Ga0495589_0115441 3300046794 Bacteria 1294
460 Ga0495660_0001178 3300046810 Bacteria 18436
461 Ga0495660_0001254 3300046810 Bacteria 17689
462 Ga0495660_0002693 3300046810 Bacteria 11223
463 Ga0495660_0007698 3300046810 Bacteria 6329
464 Ga0495660_0008473 3300046810 Bacteria 6022
465 Ga0495660_0030903 3300046810 Bacteria 3014
466 Ga0495660_0034188 3300046810 Bacteria 2846
467 Ga0495660_0035285 3300046810 Bacteria 2795
468 Ga0495660_0041471 3300046810 Bacteria 2548
469 Ga0495660_0048748 3300046810 Bacteria 2315
470 Ga0495660_0099189 3300046810 Bacteria 1501
471 Ga0495604_0018958 3300047317 Bacteria 5509
472 Ga0495604_0043075 3300047317 Bacteria 3535
473 Ga0495636_0000622 3300047318 Bacteria 12995
474 Ga0495636_0013551 3300047318 Bacteria 3235
475 Ga0495672_0001453 3300047320 Bacteria 23234
476 Ga0495672_0002076 3300047320 Bacteria 18808
477 Ga0495672_0002266 3300047320 Bacteria 17886
478 Ga0495672_0002777 3300047320 Bacteria 15660
479 Ga0495672_0003190 3300047320 Bacteria 14258
480 Ga0495672_0003721 3300047320 Bacteria 12860
481 Ga0495672_0003834 3300047320 Bacteria 12653
482 Ga0495672_0014636 3300047320 Bacteria 5360
483 Ga0495672_0021698 3300047320 Bacteria 4185
484 Ga0495672_0145556 3300047320 Bacteria 1233
485 Ga0495676_0047413 3300047321 Bacteria 3474
486 Ga0495680_0046687 3300047322 Bacteria 3413
487 Ga0495680_0070933 3300047322 Bacteria 2654
488 Ga0495683_0003077 3300047323 Bacteria 9784
489 Ga0495683_0003094 3300047323 Bacteria 9754
490 Ga0495683_0017462 3300047323 Bacteria 3718
491 Ga0495683_0021917 3300047323 Bacteria 3289
492 Ga0495683_0034204 3300047323 Bacteria 2585
493 Ga0495683_0045335 3300047323 Bacteria 2209
494 Ga0495687_001898 3300047443 Bacteria 18011
495 Ga0495687_001987 3300047443 Bacteria 17397
496 Ga0495687_002098 3300047443 Bacteria 16758
497 Ga0495687_002610 3300047443 Bacteria 14164
498 Ga0495687_002714 3300047443 Bacteria 13734
499 Ga0495687_003136 3300047443 Bacteria 12332
500 Ga0495675_0029302 3300047444 Bacteria 3510
501 Ga0495677_0000687 3300047445 Bacteria 13734
502 Ga0495677_0001296 3300047445 Bacteria 9985
503 Ga0495677_0001351 3300047445 Bacteria 9795
504 Ga0495677_0011354 3300047445 Bacteria 3260
505 Ga0495677_0018974 3300047445 Bacteria 2494
506 Ga0495677_0026622 3300047445 Bacteria 2097
507 Ga0495677_0032290 3300047445 Bacteria 1906
508 Ga0495677_0051762 3300047445 Bacteria 1512
509 Ga0495679_002988 3300047446 Bacteria 8333
510 Ga0495679_005275 3300047446 Bacteria 5764
511 Ga0495679_005879 3300047446 Bacteria 5381
512 Ga0495679_008750 3300047446 Bacteria 4092
513 Ga0495679_008940 3300047446 Bacteria 4038
514 Ga0495679_018082 3300047446 Bacteria 2510
515 Ga0495679_024623 3300047446 Bacteria 2025
516 Ga0495679_035216 3300047446 Bacteria 1588
517 Ga0495685_001954 3300047447 Bacteria 6389
518 Ga0495685_010476 3300047447 Bacteria 3110
519 Ga0495673_0001145 3300047469 Bacteria 22673
520 Ga0495673_0001156 3300047469 Bacteria 22410
521 Ga0495673_0006770 3300047469 Bacteria 6693
522 Ga0495673_0024159 3300047469 Bacteria 2943
523 Ga0495681_0000433 3300047470 Bacteria 32077
524 Ga0495681_0004192 3300047470 Bacteria 9890
525 Ga0495681_0012958 3300047470 Bacteria 4869
526 Ga0495681_0013139 3300047470 Bacteria 4825
527 Ga0495681_0016911 3300047470 Bacteria 4068
528 Ga0495681_0021880 3300047470 Bacteria 3434
529 Ga0495681_0070313 3300047470 Bacteria 1587
530 Ga0495681_0087455 3300047470 Bacteria 1381
531 Ga0495686_0002039 3300047472 Bacteria 19903
532 Ga0495686_0002901 3300047472 Bacteria 15394
533 Ga0495686_0003304 3300047472 Bacteria 14076
534 Ga0495686_0018533 3300047472 Bacteria 4669
535 Ga0495686_0018798 3300047472 Bacteria 4627
536 Ga0495686_0023566 3300047472 Bacteria 4058
537 Ga0495686_0041130 3300047472 Bacteria 2944
538 Ga0495686_0050207 3300047472 Bacteria 2622
539 Ga0495686_0056399 3300047472 Bacteria 2455
540 Ga0495686_0076065 3300047472 Bacteria 2057
541 Ga0495593_0015721 3300047673 Bacteria 4280
542 Ga0495602_0048304 3300048088 Bacteria 3826
543 Ga0495614_0013144 3300048089 Bacteria 3630
544 Ga0495614_0014144 3300048089 Bacteria 3496
545 Ga0495626_0001560 3300048091 Bacteria 17972
546 Ga0495626_0002174 3300048091 Bacteria 14104
547 Ga0495626_0002204 3300048091 Bacteria 13980
548 Ga0495626_0004019 3300048091 Bacteria 9171
549 Ga0495626_0007383 3300048091 Bacteria 6120
550 Ga0495626_0008363 3300048091 Bacteria 5681
551 Ga0495626_0010695 3300048091 Bacteria 4882
552 Ga0495626_0011497 3300048091 Bacteria 4681
553 Ga0495626_0011649 3300048091 Bacteria 4641
554 Ga0495626_0016091 3300048091 Bacteria 3809
555 Ga0495626_0017613 3300048091 Bacteria 3604
556 Ga0495626_0023042 3300048091 Bacteria 3070
557 Ga0495626_0046832 3300048091 Bacteria 2012
558 Ga0496101_0015467 3300048904 Bacteria 5144
559 Ga0496102_0000234 3300048905 Bacteria 72781
560 Ga0496102_0004922 3300048905 Bacteria 11317
561 Ga0496102_0012967 3300048905 Bacteria 7218
562 Ga0496102_0205567 3300048905 Bacteria 1856
563 Ga0496103_0018766 3300048906 Bacteria 4151
564 Ga0496103_0039218 3300048906 Bacteria 2910
565 Ga0496105_0312112 3300048908 Bacteria 1262
566 Ga0496106_0039624 3300048909 Bacteria 3528
567 Ga0496106_0201244 3300048909 Bacteria 1585
568 Ga0496107_0055224 3300048910 Bacteria 2868
569 Ga0496107_0062127 3300048910 Bacteria 2706
570 Ga0496107_0148350 3300048910 Bacteria 1734
571 Ga0496109_0015803 3300048912 Bacteria 6589
572 Ga0496110_0003941 3300048913 Bacteria 11415
573 Ga0496110_0325330 3300048913 Bacteria 1400
574 Ga0496110_0432222 3300048913 Bacteria 1200
575 Ga0496111_0208496 3300048914 Bacteria 1452
576 Ga0496113_0006253 3300048916 Bacteria 7522
577 Ga0496116_0014288 3300048919 Bacteria 6351
578 Ga0496120_0084900 3300048923 Bacteria 1705
579 Ga0496121_0042279 3300048924 Bacteria 3967
580 Ga0496121_0119202 3300048924 Bacteria 1996
581 Ga0496122_0004547 3300048925 Bacteria 17100
582 Ga0496122_0006081 3300048925 Bacteria 14066
583 Ga0496122_0020125 3300048925 Bacteria 6055
584 Ga0496123_0004832 3300048926 Bacteria 13892
585 Ga0496123_0005062 3300048926 Bacteria 13468
586 Ga0496123_0006846 3300048926 Bacteria 10919
587 Ga0496123_0012105 3300048926 Bacteria 7391
588 Ga0496123_0084849 3300048926 Bacteria 1908
589 Ga0496124_0002636 3300048927 Bacteria 23068
590 Ga0496124_0010910 3300048927 Bacteria 9142
591 Ga0496124_0014866 3300048927 Bacteria 7499
592 Ga0496124_0022545 3300048927 Bacteria 5768
593 Ga0496124_0040379 3300048927 Bacteria 4036
594 Ga0496124_0068635 3300048927 Bacteria 2946
595 Ga0496124_0121177 3300048927 Bacteria 2090
596 Ga0496124_0138988 3300048927 Bacteria 1919
597 Ga0496124_0149055 3300048927 Bacteria 1838
598 Ga0496125_0005352 3300048928 Bacteria 14322
599 Ga0496125_0135496 3300048928 Bacteria 1723
600 Ga0496126_0016238 3300048929 Bacteria 7455
601 Ga0495678_001066 3300049459 Bacteria 23273
602 Ga0495678_001810 3300049459 Bacteria 15738
603 Ga0495678_001862 3300049459 Bacteria 15389
604 Ga0495678_001873 3300049459 Bacteria 15296
605 Ga0495678_001982 3300049459 Bacteria 14750
606 Ga0495678_014743 3300049459 Bacteria 3623
607 Ga0495678_056671 3300049459 Bacteria 1488
608 Ga0495678_067678 3300049459 Bacteria 1318
609 Ga0495682_0000880 3300049460 Bacteria 18619
610 Ga0495682_0000885 3300049460 Bacteria 18555
611 Ga0495682_0002530 3300049460 Bacteria 8612
612 Ga0495682_0005758 3300049460 Bacteria 5106
613 Ga0495682_0024865 3300049460 Bacteria 2230
614 Ga0501036_0355478 3300049572 Bacteria 1223
615 Ga0501227_002169 3300049665 Bacteria 4342
616 Ga0501230_000170 3300049667 Bacteria 5500
617 Ga0501035_0008430 3300049822 Bacteria 9598
618 Ga0500618_000583 3300053125 Bacteria 22556
619 Ga0500586_000260 3300053145 Bacteria 10537
620 Ga0466962_0030386 3300061719 Bacteria 2587

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048088 Ga0495602_0048304 Ga0495602_0048304_2817_3689 260
2 3300003771 Ga0055526_1000877 Ga0055526_10008779 264
3 3300025295 Ga0209564_1001562 Ga0209564_100156213 264
4 3300046616 Ga0495668_0001481 Ga0495668_0001481_10488_11360 264
5 3300048929 Ga0496126_0016238 Ga0496126_0016238_6520_7410 265
6 3300046694 Ga0495649_0001876 Ga0495649_0001876_11115_12011 266
7 3300047469 Ga0495673_0001156 Ga0495673_0001156_10598_11488 266
8 3300047472 Ga0495686_0018798 Ga0495686_0018798_3317_4213 266
9 3300049459 Ga0495678_001873 Ga0495678_001873_3356_4252 266
10 3300046460 Ga0495638_0010363 Ga0495638_0010363_1940_2830 268
11 3300046501 Ga0495607_0154738 Ga0495607_0154738_229_1113 268
12 3300046558 Ga0495633_0004089 Ga0495633_0004089_6509_7393 268
13 3300046660 Ga0495625_0002013 Ga0495625_0002013_11393_12283 268
14 3300045836 Ga0466958_0037452 Ga0466958_0037452_1903_2781 269
15 3300046474 Ga0495605_0000802 Ga0495605_0000802_10559_11443 270
16 3300046457 Ga0495590_0000697 Ga0495590_0000697_11117_12007 271
17 3300046458 Ga0495591_002965 Ga0495591_002965_3365_4255 271
18 3300046474 Ga0495605_0002350 Ga0495605_0002350_2775_3665 271
19 3300046491 Ga0495584_0001277 Ga0495584_0001277_3352_4242 271
20 3300046492 Ga0495585_0008253 Ga0495585_0008253_3121_4011 271
21 3300046500 Ga0495596_0019127 Ga0495596_0019127_972_1862 271
22 3300046501 Ga0495607_0006408 Ga0495607_0006408_3369_4259 271
23 3300046506 Ga0495583_0002508 Ga0495583_0002508_11300_12190 271
24 3300046512 Ga0495610_0005073 Ga0495610_0005073_5226_6116 271
25 3300046518 Ga0495631_0001506 Ga0495631_0001506_2181_3071 271
26 3300046519 Ga0495632_0011579 Ga0495632_0011579_2082_2972 271
27 3300046520 Ga0495637_0001253 Ga0495637_0001253_11082_11972 271
28 3300046522 Ga0495643_0080492 Ga0495643_0080492_674_1564 271
29 3300046523 Ga0495644_0004334 Ga0495644_0004334_236_1126 271
30 3300046528 Ga0495642_0002612 Ga0495642_0002612_3717_4607 271
31 3300046558 Ga0495633_0001946 Ga0495633_0001946_2852_3742 271
32 3300046616 Ga0495668_0037307 Ga0495668_0037307_1243_2133 271
33 3300046648 Ga0495611_0001330 Ga0495611_0001330_8287_9177 271
34 3300046665 Ga0495661_0066896 Ga0495661_0066896_515_1405 271
35 3300046794 Ga0495589_0006715 Ga0495589_0006715_4694_5584 271
36 3300047320 Ga0495672_0003834 Ga0495672_0003834_11116_12006 271
37 3300047323 Ga0495683_0003077 Ga0495683_0003077_8264_9154 271
38 3300047445 Ga0495677_0001296 Ga0495677_0001296_5712_6602 271
39 3300047446 Ga0495679_005275 Ga0495679_005275_3324_4214 271
40 3300048091 Ga0495626_0010695 Ga0495626_0010695_3301_4194 271
41 3300048091 Ga0495626_0011649 Ga0495626_0011649_3121_4011 271
42 3300048913 Ga0496110_0003941 Ga0496110_0003941_3335_4225 271
43 3300037471 Ga0395905_0436000 Ga0395905_0436000_103_981 272
44 3300038443 Ga0395901_0234390 Ga0395901_0234390_432_1322 272
45 3300046512 Ga0495610_0003292 Ga0495610_0003292_1356_2240 272
46 3300048914 Ga0496111_0208496 Ga0496111_0208496_125_1030 272
47 3300048927 Ga0496124_0138988 Ga0496124_0138988_793_1698 272
48 3300025728 Ga0207655_1015780 Ga0207655_10157802 273
49 3300046471 Ga0495650_0001826 Ga0495650_0001826_11257_12144 273
50 3300046507 Ga0495606_0004335 Ga0495606_0004335_2647_3534 273
51 3300046528 Ga0495642_0009615 Ga0495642_0009615_2775_3662 273
52 3300048905 Ga0496102_0000234 Ga0496102_0000234_50230_51099 273
53 3300046694 Ga0495649_0048379 Ga0495649_0048379_339_1229 275
54 3300048910 Ga0496107_0062127 Ga0496107_0062127_1324_2208 275
55 3300048923 Ga0496120_0084900 Ga0496120_0084900_777_1670 275
56 3300009036 Ga0105244_10002702 Ga0105244_100027022 276
57 3300046471 Ga0495650_0001486 Ga0495650_0001486_10470_11354 276
58 3300046507 Ga0495606_0002301 Ga0495606_0002301_10644_11537 276
59 3300046616 Ga0495668_0002431 Ga0495668_0002431_3337_4239 277
60 3300046522 Ga0495643_0001336 Ga0495643_0001336_11176_12066 278
61 3300047320 Ga0495672_0001453 Ga0495672_0001453_11207_12097 278
62 3300048091 Ga0495626_0016091 Ga0495626_0016091_939_1823 278
63 3300049459 Ga0495678_001066 Ga0495678_001066_11177_12067 278
64 3300046542 Ga0495597_0000891 Ga0495597_0000891_11181_12083 280
65 3300046491 Ga0495584_0006014 Ga0495584_0006014_2578_3480 281
66 3300046524 Ga0495648_0055650 Ga0495648_0055650_938_1828 281
67 3300046542 Ga0495597_0006321 Ga0495597_0006321_2365_3267 281
68 3300046665 Ga0495661_0012579 Ga0495661_0012579_4622_5512 281
69 3300046692 Ga0495671_0004627 Ga0495671_0004627_3877_4767 281
70 3300046463 Ga0495653_0000925 Ga0495653_0000925_10904_11797 282
71 3300046538 Ga0495609_0003288 Ga0495609_0003288_6606_7496 282
72 3300046558 Ga0495633_0001179 Ga0495633_0001179_8837_9745 282
73 3300046518 Ga0495631_0005842 Ga0495631_0005842_3149_4078 283
74 3300046523 Ga0495644_0004432 Ga0495644_0004432_2669_3598 283
75 3300046665 Ga0495661_0024872 Ga0495661_0024872_1053_1982 283
76 3300046691 Ga0495670_0168917 Ga0495670_0168917_177_1106 283
77 3300047445 Ga0495677_0018974 Ga0495677_0018974_576_1505 283
78 iso_pu_bacteria 2643221556 2643801033 283
79 iso_pu_bacteria 2643221684 2644473314 283
80 iso_pu_bacteria 8047673197 8047676457 283
81 3300002773 JGI25152J39213_1000549 JGI25152J39213_100054916 284
82 3300002774 JGI25150J39212_1000502 JGI25150J39212_100050212 284
83 3300003215 JGI25153J46596_10007043 JGI25153J46596_100070433 284
84 3300003775 Ga0055524_1000819 Ga0055524_100081916 284
85 3300025245 Ga0207425_1000600 Ga0207425_100060017 284
86 3300025258 Ga0209129_1000742 Ga0209129_100074216 284
87 3300025263 Ga0209565_1012418 Ga0209565_10124182 284
88 3300025297 Ga0209758_1002107 Ga0209758_10021076 284
89 3300025299 Ga0209256_1001732 Ga0209256_100173216 284
90 3300046453 Ga0495627_006391 Ga0495627_006391_3227_4117 284
91 3300046528 Ga0495642_0004104 Ga0495642_0004104_3388_4278 284
92 3300046558 Ga0495633_0014400 Ga0495633_0014400_2276_3166 284
93 3300046691 Ga0495670_0008668 Ga0495670_0008668_2946_3836 284
94 3300047470 Ga0495681_0000433 Ga0495681_0000433_3388_4278 284
95 3300047472 Ga0495686_0056399 Ga0495686_0056399_1009_1893 284
96 3300049667 Ga0501230_000170 Ga0501230_000170_3028_3915 284
97 iso_pu_bacteria 2643221645 2644252553 284
98 3300005564 Ga0070664_100564065 Ga0070664_1005640652 285
99 3300025945 Ga0207679_10188978 Ga0207679_101889782 285
100 3300042139 Ga0450904_000471 Ga0450904_000471_1849_2724 285
101 3300042145 Ga0450906_030041 Ga0450906_030041_46_924 285
102 3300046457 Ga0495590_0012030 Ga0495590_0012030_146_1006 285
103 3300046665 Ga0495661_0055295 Ga0495661_0055295_796_1653 285
104 3300046692 Ga0495671_0002076 Ga0495671_0002076_11050_11985 285
105 iso_pu_bacteria 2738541297 2738830636 285
106 iso_pu_bacteria 2738541357 2739154432 285
107 iso_pu_bacteria 2738543003 2739196352 285
108 iso_pu_bacteria 2738543026 2739322828 285
109 iso_pu_bacteria 2738543029 2739341069 285
110 3300003322 rootL2_10140400 rootL2_101404002 286
111 3300003759 Ga0055525_1000512 Ga0055525_100051212 286
112 3300005262 Ga0065165_1002855 Ga0065165_10028552 286
113 3300005339 Ga0070660_100099016 Ga0070660_1000990163 286
114 3300005344 Ga0070661_100184779 Ga0070661_1001847792 286
115 3300005366 Ga0070659_100021686 Ga0070659_1000216863 286
116 3300005366 Ga0070659_100085943 Ga0070659_1000859431 286
117 3300005457 Ga0070662_100178974 Ga0070662_1001789742 286
118 3300005563 Ga0068855_100024300 Ga0068855_1000243002 286
119 3300005564 Ga0070664_100196894 Ga0070664_1001968941 286
120 3300005577 Ga0068857_100362507 Ga0068857_1003625072 286
121 3300005616 Ga0068852_100004824 Ga0068852_1000048242 286
122 3300009093 Ga0105240_10628438 Ga0105240_106284382 286
123 3300009148 Ga0105243_10093566 Ga0105243_100935662 286
124 3300009174 Ga0105241_10118366 Ga0105241_101183663 286
125 3300009176 Ga0105242_10003480 Ga0105242_100034807 286
126 3300009551 Ga0105238_10254407 Ga0105238_102544072 286
127 3300010375 Ga0105239_10278621 Ga0105239_102786212 286
128 3300013307 Ga0157372_10197147 Ga0157372_101971471 286
129 3300025230 Ga0209563_100315 Ga0209563_1003156 286
130 3300025253 Ga0209677_104775 Ga0209677_1047752 286
131 3300025254 Ga0209148_1001274 Ga0209148_10012743 286
132 3300025909 Ga0207705_10009946 Ga0207705_100099461 286
133 3300025909 Ga0207705_10048870 Ga0207705_100488704 286
134 3300025911 Ga0207654_10162008 Ga0207654_101620082 286
135 3300025919 Ga0207657_10014047 Ga0207657_100140473 286
136 3300025919 Ga0207657_10041578 Ga0207657_100415782 286
137 3300025919 Ga0207657_10321131 Ga0207657_103211312 286
138 3300025932 Ga0207690_10017125 Ga0207690_100171253 286
139 3300025932 Ga0207690_10503372 Ga0207690_105033721 286
140 3300025934 Ga0207686_10047996 Ga0207686_100479962 286
141 3300025949 Ga0207667_10005899 Ga0207667_1000589913 286
142 3300025949 Ga0207667_10113180 Ga0207667_101131802 286
143 3300026116 Ga0207674_10244974 Ga0207674_102449741 286
144 3300037312 Ga0395899_0010000 Ga0395899_0010000_2082_2960 286
145 3300037312 Ga0395899_0011505 Ga0395899_0011505_1272_2156 286
146 3300037418 Ga0395900_0004991 Ga0395900_0004991_2112_2990 286
147 3300037418 Ga0395900_0006961 Ga0395900_0006961_937_1821 286
148 3300037418 Ga0395900_0010251 Ga0395900_0010251_3635_4516 286
149 3300037418 Ga0395900_0017243 Ga0395900_0017243_2140_3030 286
150 3300037466 Ga0395898_0052493 Ga0395898_0052493_2112_2990 286
151 3300037466 Ga0395898_0139328 Ga0395898_0139328_703_1593 286
152 3300037471 Ga0395905_0173003 Ga0395905_0173003_964_1842 286
153 3300037471 Ga0395905_0584003 Ga0395905_0584003_86_958 286
154 3300038443 Ga0395901_0002314 Ga0395901_0002314_7406_8299 286
155 3300038443 Ga0395901_0014314 Ga0395901_0014314_4848_5726 286
156 3300038443 Ga0395901_0601631 Ga0395901_0601631_84_965 286
157 3300042005 Ga0439448_0044832 Ga0439448_0044832_493_1371 286
158 3300042008 Ga0439450_031742 Ga0439450_031742_238_1116 286
159 3300044656 Ga0466969_0024243 Ga0466969_0024243_1639_2517 286
160 3300044656 Ga0466969_0031202 Ga0466969_0031202_1116_2006 286
161 3300044658 Ga0466972_0000921 Ga0466972_0000921_7111_7992 286
162 3300044683 Ga0466965_0035640 Ga0466965_0035640_1093_1974 286
163 3300044683 Ga0466965_0041753 Ga0466965_0041753_906_1784 286
164 3300044683 Ga0466965_0075707 Ga0466965_0075707_366_1244 286
165 3300044683 Ga0466965_0090591 Ga0466965_0090591_77_967 286
166 3300044684 Ga0466966_0027587 Ga0466966_0027587_1701_2591 286
167 3300044684 Ga0466966_0040908 Ga0466966_0040908_72_956 286
168 3300044684 Ga0466966_0112712 Ga0466966_0112712_102_980 286
169 3300044684 Ga0466966_0134333 Ga0466966_0134333_139_1017 286
170 3300044684 Ga0466966_0151986 Ga0466966_0151986_457_1341 286
171 3300044693 Ga0466961_0098650 Ga0466961_0098650_455_1339 286
172 3300044693 Ga0466961_0164779 Ga0466961_0164779_361_1239 286
173 3300044706 Ga0466964_0000792 Ga0466964_0000792_3484_4365 286
174 3300044706 Ga0466964_0001636 Ga0466964_0001636_3658_4548 286
175 3300044735 Ga0466968_0000947 Ga0466968_0000947_7038_7919 286
176 3300044765 Ga0466970_0260684 Ga0466970_0260684_54_938 286
177 3300044842 Ga0466957_0000785 Ga0466957_0000785_4332_5222 286
178 3300045049 Ga0466959_0044702 Ga0466959_0044702_978_1862 286
179 3300045836 Ga0466958_0044808 Ga0466958_0044808_1551_2429 286
180 3300045976 Ga0466967_0004108 Ga0466967_0004108_5276_6166 286
181 3300045976 Ga0466967_0020244 Ga0466967_0020244_2863_3753 286
182 3300046457 Ga0495590_0014544 Ga0495590_0014544_1475_2353 286
183 3300046463 Ga0495653_0076771 Ga0495653_0076771_141_1013 286
184 3300046463 Ga0495653_0158657 Ga0495653_0158657_170_1042 286
185 3300046471 Ga0495650_0001842 Ga0495650_0001842_10665_11600 286
186 3300046473 Ga0495582_0009550 Ga0495582_0009550_4361_5233 286
187 3300046474 Ga0495605_0001130 Ga0495605_0001130_11112_11990 286
188 3300046474 Ga0495605_0033342 Ga0495605_0033342_1569_2447 286
189 3300046475 Ga0495639_0114394 Ga0495639_0114394_339_1211 286
190 3300046491 Ga0495584_0008232 Ga0495584_0008232_451_1329 286
191 3300046491 Ga0495584_0014493 Ga0495584_0014493_2499_3377 286
192 3300046491 Ga0495584_0023762 Ga0495584_0023762_1972_2850 286
193 3300046492 Ga0495585_0007119 Ga0495585_0007119_728_1663 286
194 3300046492 Ga0495585_0018107 Ga0495585_0018107_2530_3408 286
195 3300046499 Ga0495594_0005077 Ga0495594_0005077_2594_3472 286
196 3300046500 Ga0495596_0037879 Ga0495596_0037879_201_1079 286
197 3300046501 Ga0495607_0002629 Ga0495607_0002629_6765_7643 286
198 3300046501 Ga0495607_0002912 Ga0495607_0002912_11093_11971 286
199 3300046501 Ga0495607_0003122 Ga0495607_0003122_6454_7332 286
200 3300046507 Ga0495606_0123921 Ga0495606_0123921_556_1428 286
201 3300046513 Ga0495616_0004816 Ga0495616_0004816_1680_2558 286
202 3300046518 Ga0495631_0014170 Ga0495631_0014170_2509_3387 286
203 3300046524 Ga0495648_0019602 Ga0495648_0019602_2548_3483 286
204 3300046526 Ga0495666_0015136 Ga0495666_0015136_2101_2982 286
205 3300046526 Ga0495666_0096674 Ga0495666_0096674_239_1123 286
206 3300046528 Ga0495642_0000437 Ga0495642_0000437_9835_10716 286
207 3300046528 Ga0495642_0019339 Ga0495642_0019339_1448_2326 286
208 3300046528 Ga0495642_0036289 Ga0495642_0036289_548_1423 286
209 3300046530 Ga0495654_0002902 Ga0495654_0002902_8549_9484 286
210 3300046531 Ga0495665_0026819 Ga0495665_0026819_186_1058 286
211 3300046535 Ga0495586_0014891 Ga0495586_0014891_1401_2279 286
212 3300046538 Ga0495609_0001812 Ga0495609_0001812_1680_2558 286
213 3300046557 Ga0495622_0049321 Ga0495622_0049321_162_1040 286
214 3300046558 Ga0495633_0005277 Ga0495633_0005277_2826_3761 286
215 3300046558 Ga0495633_0038100 Ga0495633_0038100_710_1588 286
216 3300046615 Ga0495656_0112345 Ga0495656_0112345_222_1100 286
217 3300046616 Ga0495668_0001997 Ga0495668_0001997_6232_7167 286
218 3300046642 Ga0495634_0046669 Ga0495634_0046669_2033_2905 286
219 3300046660 Ga0495625_0272727 Ga0495625_0272727_101_979 286
220 3300046665 Ga0495661_0002637 Ga0495661_0002637_1727_2605 286
221 3300046665 Ga0495661_0020515 Ga0495661_0020515_2495_3373 286
222 3300046665 Ga0495661_0113124 Ga0495661_0113124_326_1204 286
223 3300046665 Ga0495661_0130038 Ga0495661_0130038_202_1080 286
224 3300046674 Ga0495588_0000503 Ga0495588_0000503_11189_12070 286
225 3300046674 Ga0495588_0072309 Ga0495588_0072309_837_1715 286
226 3300046684 Ga0495669_0006338 Ga0495669_0006338_201_1079 286
227 3300046691 Ga0495670_0013230 Ga0495670_0013230_2513_3391 286
228 3300046794 Ga0495589_0000956 Ga0495589_0000956_11279_12157 286
229 3300046794 Ga0495589_0001434 Ga0495589_0001434_1725_2603 286
230 3300046810 Ga0495660_0001178 Ga0495660_0001178_6497_7411 286
231 3300046810 Ga0495660_0001254 Ga0495660_0001254_11278_12156 286
232 3300046810 Ga0495660_0002693 Ga0495660_0002693_8375_9310 286
233 3300046810 Ga0495660_0035285 Ga0495660_0035285_1178_2056 286
234 3300047317 Ga0495604_0043075 Ga0495604_0043075_1106_1984 286
235 3300047320 Ga0495672_0002266 Ga0495672_0002266_5729_6607 286
236 3300047321 Ga0495676_0047413 Ga0495676_0047413_181_1059 286
237 3300047322 Ga0495680_0070933 Ga0495680_0070933_1307_2179 286
238 3300047323 Ga0495683_0021917 Ga0495683_0021917_465_1343 286
239 3300047323 Ga0495683_0034204 Ga0495683_0034204_1419_2354 286
240 3300047443 Ga0495687_002714 Ga0495687_002714_11155_12033 286
241 3300047443 Ga0495687_003136 Ga0495687_003136_176_1054 286
242 3300047444 Ga0495675_0029302 Ga0495675_0029302_112_984 286
243 3300047445 Ga0495677_0000687 Ga0495677_0000687_1702_2580 286
244 3300047445 Ga0495677_0026622 Ga0495677_0026622_558_1436 286
245 3300047446 Ga0495679_024623 Ga0495679_024623_958_1836 286
246 3300047469 Ga0495673_0001145 Ga0495673_0001145_10649_11584 286
247 3300047470 Ga0495681_0016911 Ga0495681_0016911_655_1533 286
248 3300047472 Ga0495686_0023566 Ga0495686_0023566_2427_3341 286
249 3300047472 Ga0495686_0076065 Ga0495686_0076065_975_1910 286
250 3300048091 Ga0495626_0001560 Ga0495626_0001560_5815_6693 286
251 3300048091 Ga0495626_0002204 Ga0495626_0002204_11156_12034 286
252 3300048091 Ga0495626_0023042 Ga0495626_0023042_1353_2231 286
253 3300048905 Ga0496102_0004922 Ga0496102_0004922_7040_7918 286
254 3300048905 Ga0496102_0012967 Ga0496102_0012967_5363_6247 286
255 3300048906 Ga0496103_0018766 Ga0496103_0018766_876_1760 286
256 3300048908 Ga0496105_0312112 Ga0496105_0312112_40_930 286
257 3300048909 Ga0496106_0039624 Ga0496106_0039624_2507_3400 286
258 3300048910 Ga0496107_0148350 Ga0496107_0148350_198_1091 286
259 3300048913 Ga0496110_0432222 Ga0496110_0432222_201_1079 286
260 3300048916 Ga0496113_0006253 Ga0496113_0006253_5296_6186 286
261 3300048924 Ga0496121_0119202 Ga0496121_0119202_1104_1982 286
262 3300048925 Ga0496122_0004547 Ga0496122_0004547_11094_11984 286
263 3300048925 Ga0496122_0020125 Ga0496122_0020125_594_1472 286
264 3300048926 Ga0496123_0006846 Ga0496123_0006846_1661_2551 286
265 3300048926 Ga0496123_0012105 Ga0496123_0012105_6173_7051 286
266 3300048927 Ga0496124_0002636 Ga0496124_0002636_10958_11842 286
267 3300048927 Ga0496124_0010910 Ga0496124_0010910_5137_6027 286
268 3300048927 Ga0496124_0022545 Ga0496124_0022545_4245_5123 286
269 3300048928 Ga0496125_0135496 Ga0496125_0135496_276_1160 286
270 3300049459 Ga0495678_056671 Ga0495678_056671_398_1312 286
271 3300049572 Ga0501036_0355478 Ga0501036_0355478_190_1068 286
272 3300049822 Ga0501035_0008430 Ga0501035_0008430_8239_9132 286
273 3300053145 Ga0500586_000260 Ga0500586_000260_8593_9528 286
274 3300061719 Ga0466962_0030386 Ga0466962_0030386_548_1432 286
275 iso_pu_bacteria 2808606418 2809147765 286
276 3300037312 Ga0395899_0000575 Ga0395899_0000575_2888_3763 287
277 3300044842 Ga0466957_0012176 Ga0466957_0012176_1092_1976 287
278 3300046471 Ga0495650_0002555 Ga0495650_0002555_11349_12236 287
279 3300046474 Ga0495605_0017899 Ga0495605_0017899_553_1461 287
280 3300046474 Ga0495605_0020590 Ga0495605_0020590_181_1068 287
281 3300046474 Ga0495605_0060763 Ga0495605_0060763_767_1639 287
282 3300046491 Ga0495584_0001383 Ga0495584_0001383_7639_8529 287
283 3300046491 Ga0495584_0003485 Ga0495584_0003485_355_1227 287
284 3300046491 Ga0495584_0023658 Ga0495584_0023658_2033_2941 287
285 3300046500 Ga0495596_0021973 Ga0495596_0021973_736_1623 287
286 3300046500 Ga0495596_0022390 Ga0495596_0022390_589_1461 287
287 3300046501 Ga0495607_0001012 Ga0495607_0001012_12875_13756 287
288 3300046501 Ga0495607_0077505 Ga0495607_0077505_667_1563 287
289 3300046506 Ga0495583_0005193 Ga0495583_0005193_6606_7478 287
290 3300046507 Ga0495606_0008407 Ga0495606_0008407_5793_6683 287
291 3300046507 Ga0495606_0153090 Ga0495606_0153090_391_1263 287
292 3300046513 Ga0495616_0006982 Ga0495616_0006982_1643_2530 287
293 3300046513 Ga0495616_0010006 Ga0495616_0010006_3561_4451 287
294 3300046513 Ga0495616_0026755 Ga0495616_0026755_165_1046 287
295 3300046518 Ga0495631_0047948 Ga0495631_0047948_919_1803 287
296 3300046519 Ga0495632_0002589 Ga0495632_0002589_12419_13300 287
297 3300046519 Ga0495632_0009099 Ga0495632_0009099_3366_4238 287
298 3300046519 Ga0495632_0009511 Ga0495632_0009511_1458_2342 287
299 3300046520 Ga0495637_0093198 Ga0495637_0093198_167_1054 287
300 3300046522 Ga0495643_0001164 Ga0495643_0001164_12224_13096 287
301 3300046522 Ga0495643_0008991 Ga0495643_0008991_1925_2797 287
302 3300046524 Ga0495648_0003847 Ga0495648_0003847_1481_2416 287
303 3300046524 Ga0495648_0025252 Ga0495648_0025252_940_1827 287
304 3300046528 Ga0495642_0010069 Ga0495642_0010069_2005_2913 287
305 3300046530 Ga0495654_0024089 Ga0495654_0024089_1388_2296 287
306 3300046533 Ga0495640_0123800 Ga0495640_0123800_246_1133 287
307 3300046538 Ga0495609_0035963 Ga0495609_0035963_701_1609 287
308 3300046542 Ga0495597_0007924 Ga0495597_0007924_2464_3372 287
309 3300046558 Ga0495633_0042748 Ga0495633_0042748_1118_1990 287
310 3300046616 Ga0495668_0010999 Ga0495668_0010999_2495_3403 287
311 3300046648 Ga0495611_0014575 Ga0495611_0014575_1398_2270 287
312 3300046665 Ga0495661_0005248 Ga0495661_0005248_2089_2970 287
313 3300046665 Ga0495661_0168409 Ga0495661_0168409_223_1113 287
314 3300046674 Ga0495588_0007186 Ga0495588_0007186_2478_3368 287
315 3300046684 Ga0495669_0009869 Ga0495669_0009869_1540_2412 287
316 3300046694 Ga0495649_0003339 Ga0495649_0003339_8027_8899 287
317 3300046794 Ga0495589_0062507 Ga0495589_0062507_796_1704 287
318 3300046794 Ga0495589_0115441 Ga0495589_0115441_276_1163 287
319 3300046810 Ga0495660_0030903 Ga0495660_0030903_1456_2328 287
320 3300047317 Ga0495604_0018958 Ga0495604_0018958_4485_5393 287
321 3300047320 Ga0495672_0003190 Ga0495672_0003190_2168_3055 287
322 3300047320 Ga0495672_0014636 Ga0495672_0014636_2441_3349 287
323 3300047320 Ga0495672_0145556 Ga0495672_0145556_126_1007 287
324 3300047323 Ga0495683_0017462 Ga0495683_0017462_609_1496 287
325 3300047443 Ga0495687_001898 Ga0495687_001898_6049_6939 287
326 3300047445 Ga0495677_0001351 Ga0495677_0001351_6969_7841 287
327 3300047445 Ga0495677_0032290 Ga0495677_0032290_194_1066 287
328 3300047446 Ga0495679_008940 Ga0495679_008940_2141_3013 287
329 3300047470 Ga0495681_0021880 Ga0495681_0021880_1119_1991 287
330 3300047472 Ga0495686_0003304 Ga0495686_0003304_2063_2956 287
331 3300048091 Ga0495626_0002174 Ga0495626_0002174_1961_2854 287
332 3300048091 Ga0495626_0007383 Ga0495626_0007383_3299_4171 287
333 3300048091 Ga0495626_0008363 Ga0495626_0008363_2837_3721 287
334 3300048091 Ga0495626_0011497 Ga0495626_0011497_1430_2302 287
335 3300048091 Ga0495626_0017613 Ga0495626_0017613_2136_3008 287
336 3300048927 Ga0496124_0014866 Ga0496124_0014866_2133_3014 287
337 3300049459 Ga0495678_014743 Ga0495678_014743_76_948 287
338 iso_pu_bacteria 2643221664 2644356123 287
339 3300002987 JGI25159J45721_1002723 JGI25159J45721_10027232 288
340 3300003771 Ga0055526_1006688 Ga0055526_10066883 288
341 3300003773 Ga0055537_1000672 Ga0055537_100067218 288
342 3300003775 Ga0055524_1013080 Ga0055524_10130802 288
343 3300003784 Ga0055534_1000640 Ga0055534_10006402 288
344 3300003790 Ga0055528_1001091 Ga0055528_100109117 288
345 3300005262 Ga0065165_1002135 Ga0065165_100213516 288
346 3300006881 Ga0068865_100210435 Ga0068865_1002104352 288
347 3300025263 Ga0209565_1000804 Ga0209565_100080416 288
348 3300025273 Ga0209673_1001762 Ga0209673_100176217 288
349 3300025284 Ga0209130_1001230 Ga0209130_100123016 288
350 3300025291 Ga0209675_1000977 Ga0209675_100097717 288
351 3300025295 Ga0209564_1002214 Ga0209564_10022143 288
352 3300025299 Ga0209256_1002026 Ga0209256_100202617 288
353 3300025302 Ga0207426_1016899 Ga0207426_10168992 288
354 3300025304 Ga0209257_1003159 Ga0209257_10031594 288
355 3300031548 Ga0307408_100001099 Ga0307408_10000109911 288
356 3300044694 Ga0466963_0027664 Ga0466963_0027664_1217_2101 288
357 3300045976 Ga0466967_0048308 Ga0466967_0048308_1894_2778 288
358 3300046460 Ga0495638_0063899 Ga0495638_0063899_1239_2105 288
359 3300046474 Ga0495605_0056799 Ga0495605_0056799_858_1742 288
360 3300046501 Ga0495607_0005328 Ga0495607_0005328_1709_2593 288
361 3300046506 Ga0495583_0018766 Ga0495583_0018766_1108_1974 288
362 3300046513 Ga0495616_0115449 Ga0495616_0115449_167_1033 288
363 3300046526 Ga0495666_0000849 Ga0495666_0000849_4319_5212 288
364 3300046538 Ga0495609_0001195 Ga0495609_0001195_1560_2444 288
365 3300046542 Ga0495597_0077299 Ga0495597_0077299_261_1127 288
366 3300046616 Ga0495668_0001986 Ga0495668_0001986_1657_2541 288
367 3300046648 Ga0495611_0116584 Ga0495611_0116584_91_957 288
368 3300046660 Ga0495625_0066969 Ga0495625_0066969_975_1859 288
369 3300046664 Ga0495659_0010267 Ga0495659_0010267_1507_2373 288
370 3300046684 Ga0495669_0020502 Ga0495669_0020502_1588_2472 288
371 3300046694 Ga0495649_0045760 Ga0495649_0045760_889_1755 288
372 3300046810 Ga0495660_0034188 Ga0495660_0034188_165_1049 288
373 3300047318 Ga0495636_0013551 Ga0495636_0013551_1657_2523 288
374 3300047445 Ga0495677_0011354 Ga0495677_0011354_341_1207 288
375 3300047446 Ga0495679_018082 Ga0495679_018082_78_962 288
376 3300047470 Ga0495681_0012958 Ga0495681_0012958_1356_2240 288
377 3300047472 Ga0495686_0002039 Ga0495686_0002039_17322_18206 288
378 3300048924 Ga0496121_0042279 Ga0496121_0042279_1214_2113 288
379 3300048927 Ga0496124_0149055 Ga0496124_0149055_490_1389 288
380 3300053125 Ga0500618_000583 Ga0500618_000583_11107_11982 288
381 iso_pu_bacteria 2643221554 2643790385 288
382 iso_pu_bacteria 2643221638 2644214194 288
383 iso_pu_bacteria 2738541280 2738743001 288
384 iso_pu_bacteria 2738541300 2738847153 288
385 iso_pu_bacteria 2738543018 2739277932 288
386 iso_pu_bacteria 2738543030 2739346975 288
387 3300003775 Ga0055524_1000840 Ga0055524_100084017 289
388 3300006948 Ga0099826_10000422 Ga0099826_1000042217 289
389 3300025295 Ga0209564_1017945 Ga0209564_10179452 289
390 3300025299 Ga0209256_1001792 Ga0209256_100179217 289
391 3300027666 Ga0209282_1000454 Ga0209282_100045417 289
392 3300030731 Ga0316177_1064561 Ga0316177_10645612 289
393 3300030736 Ga0316180_1083442 Ga0316180_10834423 289
394 3300031838 Ga0307518_10027805 Ga0307518_100278053 289
395 3300046452 Ga0495617_000782 Ga0495617_000782_3455_4345 289
396 3300046453 Ga0495627_001262 Ga0495627_001262_11295_12185 289
397 3300046455 Ga0495603_0011730 Ga0495603_0011730_3033_3923 289
398 3300046455 Ga0495603_0133427 Ga0495603_0133427_453_1403 289
399 3300046457 Ga0495590_0007728 Ga0495590_0007728_1360_2250 289
400 3300046458 Ga0495591_010249 Ga0495591_010249_2716_3606 289
401 3300046459 Ga0495629_0135195 Ga0495629_0135195_565_1515 289
402 3300046460 Ga0495638_0017175 Ga0495638_0017175_3811_4701 289
403 3300046460 Ga0495638_0030564 Ga0495638_0030564_660_1550 289
404 3300046463 Ga0495653_0058490 Ga0495653_0058490_1944_2834 289
405 3300046474 Ga0495605_0001456 Ga0495605_0001456_3455_4345 289
406 3300046474 Ga0495605_0006640 Ga0495605_0006640_2315_3205 289
407 3300046474 Ga0495605_0011154 Ga0495605_0011154_306_1196 289
408 3300046474 Ga0495605_0017844 Ga0495605_0017844_422_1312 289
409 3300046491 Ga0495584_0008512 Ga0495584_0008512_2902_3792 289
410 3300046491 Ga0495584_0131685 Ga0495584_0131685_148_1101 289
411 3300046492 Ga0495585_0012538 Ga0495585_0012538_686_1576 289
412 3300046492 Ga0495585_0048508 Ga0495585_0048508_137_1087 289
413 3300046492 Ga0495585_0049258 Ga0495585_0049258_1248_2138 289
414 3300046500 Ga0495596_0034448 Ga0495596_0034448_952_1842 289
415 3300046500 Ga0495596_0039576 Ga0495596_0039576_167_1057 289
416 3300046500 Ga0495596_0062182 Ga0495596_0062182_203_1093 289
417 3300046501 Ga0495607_0008591 Ga0495607_0008591_3191_4081 289
418 3300046501 Ga0495607_0010921 Ga0495607_0010921_4556_5446 289
419 3300046501 Ga0495607_0017589 Ga0495607_0017589_3673_4563 289
420 3300046506 Ga0495583_0004714 Ga0495583_0004714_6715_7605 289
421 3300046506 Ga0495583_0006506 Ga0495583_0006506_3342_4232 289
422 3300046506 Ga0495583_0015930 Ga0495583_0015930_2689_3579 289
423 3300046506 Ga0495583_0119049 Ga0495583_0119049_11_961 289
424 3300046507 Ga0495606_0027804 Ga0495606_0027804_3011_3901 289
425 3300046513 Ga0495616_0001607 Ga0495616_0001607_11117_12007 289
426 3300046513 Ga0495616_0012547 Ga0495616_0012547_2930_3820 289
427 3300046513 Ga0495616_0049640 Ga0495616_0049640_439_1389 289
428 3300046518 Ga0495631_0001278 Ga0495631_0001278_11229_12119 289
429 3300046518 Ga0495631_0008951 Ga0495631_0008951_3414_4304 289
430 3300046518 Ga0495631_0009728 Ga0495631_0009728_3852_4742 289
431 3300046518 Ga0495631_0015523 Ga0495631_0015523_2126_3016 289
432 3300046519 Ga0495632_0002052 Ga0495632_0002052_11210_12112 289
433 3300046519 Ga0495632_0002136 Ga0495632_0002136_10958_11848 289
434 3300046519 Ga0495632_0050663 Ga0495632_0050663_872_1762 289
435 3300046519 Ga0495632_0152948 Ga0495632_0152948_24_914 289
436 3300046522 Ga0495643_0016175 Ga0495643_0016175_1275_2165 289
437 3300046522 Ga0495643_0119777 Ga0495643_0119777_67_960 289
438 3300046523 Ga0495644_0003594 Ga0495644_0003594_866_1756 289
439 3300046523 Ga0495644_0018567 Ga0495644_0018567_280_1170 289
440 3300046523 Ga0495644_0024309 Ga0495644_0024309_1274_2224 289
441 3300046524 Ga0495648_0008223 Ga0495648_0008223_3883_4773 289
442 3300046528 Ga0495642_0000792 Ga0495642_0000792_10958_11848 289
443 3300046528 Ga0495642_0001095 Ga0495642_0001095_346_1236 289
444 3300046528 Ga0495642_0009103 Ga0495642_0009103_2662_3552 289
445 3300046528 Ga0495642_0045211 Ga0495642_0045211_694_1644 289
446 3300046530 Ga0495654_0006437 Ga0495654_0006437_2476_3366 289
447 3300046538 Ga0495609_0013720 Ga0495609_0013720_537_1427 289
448 3300046538 Ga0495609_0014427 Ga0495609_0014427_249_1139 289
449 3300046538 Ga0495609_0020364 Ga0495609_0020364_504_1394 289
450 3300046538 Ga0495609_0048855 Ga0495609_0048855_671_1561 289
451 3300046542 Ga0495597_0001690 Ga0495597_0001690_3336_4229 289
452 3300046542 Ga0495597_0001914 Ga0495597_0001914_8642_9532 289
453 3300046557 Ga0495622_0000393 Ga0495622_0000393_6898_7782 289
454 3300046558 Ga0495633_0028343 Ga0495633_0028343_253_1143 289
455 3300046558 Ga0495633_0086085 Ga0495633_0086085_218_1168 289
456 3300046616 Ga0495668_0002377 Ga0495668_0002377_11294_12184 289
457 3300046616 Ga0495668_0002406 Ga0495668_0002406_3378_4268 289
458 3300046648 Ga0495611_0005157 Ga0495611_0005157_3362_4252 289
459 3300046648 Ga0495611_0015458 Ga0495611_0015458_92_982 289
460 3300046648 Ga0495611_0050834 Ga0495611_0050834_340_1230 289
461 3300046660 Ga0495625_0074719 Ga0495625_0074719_891_1781 289
462 3300046660 Ga0495625_0197130 Ga0495625_0197130_393_1283 289
463 3300046665 Ga0495661_0002518 Ga0495661_0002518_2128_3018 289
464 3300046665 Ga0495661_0003056 Ga0495661_0003056_11108_12010 289
465 3300046665 Ga0495661_0008903 Ga0495661_0008903_2529_3419 289
466 3300046665 Ga0495661_0009955 Ga0495661_0009955_3362_4252 289
467 3300046665 Ga0495661_0183941 Ga0495661_0183941_60_950 289
468 3300046674 Ga0495588_0070143 Ga0495588_0070143_387_1277 289
469 3300046684 Ga0495669_0041813 Ga0495669_0041813_956_1846 289
470 3300046689 Ga0495613_0048950 Ga0495613_0048950_1134_2024 289
471 3300046689 Ga0495613_0125236 Ga0495613_0125236_180_1130 289
472 3300046691 Ga0495670_0026716 Ga0495670_0026716_643_1533 289
473 3300046691 Ga0495670_0069703 Ga0495670_0069703_783_1673 289
474 3300046691 Ga0495670_0095058 Ga0495670_0095058_361_1311 289
475 3300046692 Ga0495671_0001521 Ga0495671_0001521_3454_4344 289
476 3300046692 Ga0495671_0025028 Ga0495671_0025028_114_1004 289
477 3300046692 Ga0495671_0052160 Ga0495671_0052160_698_1588 289
478 3300046694 Ga0495649_0022613 Ga0495649_0022613_244_1134 289
479 3300046694 Ga0495649_0079796 Ga0495649_0079796_788_1678 289
480 3300046794 Ga0495589_0001061 Ga0495589_0001061_4565_5455 289
481 3300046810 Ga0495660_0041471 Ga0495660_0041471_1216_2106 289
482 3300046810 Ga0495660_0048748 Ga0495660_0048748_272_1162 289
483 3300047320 Ga0495672_0002777 Ga0495672_0002777_11236_12138 289
484 3300047320 Ga0495672_0021698 Ga0495672_0021698_79_969 289
485 3300047322 Ga0495680_0046687 Ga0495680_0046687_1848_2738 289
486 3300047323 Ga0495683_0045335 Ga0495683_0045335_689_1579 289
487 3300047443 Ga0495687_002098 Ga0495687_002098_4555_5445 289
488 3300047443 Ga0495687_002610 Ga0495687_002610_11182_12072 289
489 3300047445 Ga0495677_0051762 Ga0495677_0051762_499_1389 289
490 3300047446 Ga0495679_002988 Ga0495679_002988_4085_4975 289
491 3300047446 Ga0495679_005879 Ga0495679_005879_982_1872 289
492 3300047446 Ga0495679_035216 Ga0495679_035216_128_1018 289
493 3300047447 Ga0495685_001954 Ga0495685_001954_2314_3204 289
494 3300047447 Ga0495685_010476 Ga0495685_010476_1605_2495 289
495 3300047470 Ga0495681_0004192 Ga0495681_0004192_6797_7687 289
496 3300047470 Ga0495681_0070313 Ga0495681_0070313_320_1210 289
497 3300047470 Ga0495681_0087455 Ga0495681_0087455_364_1314 289
498 3300047472 Ga0495686_0002901 Ga0495686_0002901_11138_12028 289
499 3300047472 Ga0495686_0041130 Ga0495686_0041130_85_975 289
500 3300047472 Ga0495686_0050207 Ga0495686_0050207_848_1738 289
501 3300047673 Ga0495593_0015721 Ga0495593_0015721_2480_3370 289
502 3300048089 Ga0495614_0013144 Ga0495614_0013144_2454_3344 289
503 3300048089 Ga0495614_0014144 Ga0495614_0014144_2376_3326 289
504 3300048091 Ga0495626_0046832 Ga0495626_0046832_631_1521 289
505 3300048904 Ga0496101_0015467 Ga0496101_0015467_1856_2746 289
506 3300048905 Ga0496102_0205567 Ga0496102_0205567_714_1604 289
507 3300048906 Ga0496103_0039218 Ga0496103_0039218_1938_2828 289
508 3300048909 Ga0496106_0201244 Ga0496106_0201244_384_1274 289
509 3300048910 Ga0496107_0055224 Ga0496107_0055224_853_1743 289
510 3300048912 Ga0496109_0015803 Ga0496109_0015803_3575_4465 289
511 3300048913 Ga0496110_0325330 Ga0496110_0325330_276_1166 289
512 3300048919 Ga0496116_0014288 Ga0496116_0014288_4482_5366 289
513 3300048925 Ga0496122_0006081 Ga0496122_0006081_2102_2992 289
514 3300048926 Ga0496123_0004832 Ga0496123_0004832_2049_2939 289
515 3300048926 Ga0496123_0084849 Ga0496123_0084849_406_1296 289
516 3300048927 Ga0496124_0040379 Ga0496124_0040379_1438_2328 289
517 3300048927 Ga0496124_0068635 Ga0496124_0068635_83_973 289
518 3300048927 Ga0496124_0121177 Ga0496124_0121177_460_1350 289
519 3300048928 Ga0496125_0005352 Ga0496125_0005352_11339_12229 289
520 3300049459 Ga0495678_001810 Ga0495678_001810_11227_12117 289
521 3300049459 Ga0495678_067678 Ga0495678_067678_286_1176 289
522 3300049460 Ga0495682_0005758 Ga0495682_0005758_873_1763 289
523 3300049460 Ga0495682_0024865 Ga0495682_0024865_827_1717 289
524 3300031711 Ga0265314_10013340 Ga0265314_100133402 290
525 3300037418 Ga0395900_0056389 Ga0395900_0056389_1779_2681 290
526 3300037471 Ga0395905_0087245 Ga0395905_0087245_406_1308 290
527 3300044672 Ga0466982_0073683 Ga0466982_0073683_768_1658 290
528 3300046491 Ga0495584_0110909 Ga0495584_0110909_448_1347 290
529 3300046499 Ga0495594_0009818 Ga0495594_0009818_2447_3349 290
530 3300046500 Ga0495596_0002084 Ga0495596_0002084_6370_7272 290
531 3300046500 Ga0495596_0002769 Ga0495596_0002769_8187_9089 290
532 3300046500 Ga0495596_0025443 Ga0495596_0025443_456_1358 290
533 3300046506 Ga0495583_0006362 Ga0495583_0006362_3463_4365 290
534 3300046506 Ga0495583_0008287 Ga0495583_0008287_2010_2912 290
535 3300046507 Ga0495606_0112745 Ga0495606_0112745_176_1078 290
536 3300046513 Ga0495616_0014197 Ga0495616_0014197_2495_3397 290
537 3300046518 Ga0495631_0046630 Ga0495631_0046630_563_1465 290
538 3300046519 Ga0495632_0002147 Ga0495632_0002147_3388_4290 290
539 3300046520 Ga0495637_0003685 Ga0495637_0003685_5468_6367 290
540 3300046660 Ga0495625_0044254 Ga0495625_0044254_1328_2230 290
541 3300046692 Ga0495671_0004650 Ga0495671_0004650_3865_4767 290
542 3300046694 Ga0495649_0005080 Ga0495649_0005080_4406_5308 290
543 3300046794 Ga0495589_0103269 Ga0495589_0103269_42_944 290
544 3300046810 Ga0495660_0008473 Ga0495660_0008473_1737_2639 290
545 3300047470 Ga0495681_0013139 Ga0495681_0013139_3669_4571 290
546 3300048091 Ga0495626_0004019 Ga0495626_0004019_2459_3358 290
547 3300048926 Ga0496123_0005062 Ga0496123_0005062_8682_9575 290
548 3300049459 Ga0495678_001862 Ga0495678_001862_3416_4318 290
549 3300049460 Ga0495682_0002530 Ga0495682_0002530_3553_4455 290
550 3300031548 Ga0307408_100001865 Ga0307408_1000018655 291
551 3300044683 Ga0466965_0027340 Ga0466965_0027340_1218_2099 291
552 3300046452 Ga0495617_001986 Ga0495617_001986_5208_6092 291
553 3300046491 Ga0495584_0000946 Ga0495584_0000946_11193_12077 291
554 3300046492 Ga0495585_0009043 Ga0495585_0009043_4655_5557 291
555 3300046501 Ga0495607_0006789 Ga0495607_0006789_6262_7164 291
556 3300046501 Ga0495607_0009636 Ga0495607_0009636_5236_6138 291
557 3300046501 Ga0495607_0014580 Ga0495607_0014580_3309_4193 291
558 3300046506 Ga0495583_0002012 Ga0495583_0002012_11209_12093 291
559 3300046513 Ga0495616_0032552 Ga0495616_0032552_1140_2024 291
560 3300046523 Ga0495644_0000617 Ga0495644_0000617_6586_7488 291
561 3300046523 Ga0495644_0000677 Ga0495644_0000677_5812_6696 291
562 3300046524 Ga0495648_0003952 Ga0495648_0003952_5474_6358 291
563 3300046538 Ga0495609_0001452 Ga0495609_0001452_6434_7318 291
564 3300046538 Ga0495609_0002751 Ga0495609_0002751_5986_6870 291
565 3300046557 Ga0495622_0113477 Ga0495622_0113477_273_1157 291
566 3300046558 Ga0495633_0004106 Ga0495633_0004106_6549_7433 291
567 3300046558 Ga0495633_0036778 Ga0495633_0036778_388_1272 291
568 3300046615 Ga0495656_0004035 Ga0495656_0004035_1610_2494 291
569 3300046648 Ga0495611_0001011 Ga0495611_0001011_5961_6863 291
570 3300046648 Ga0495611_0001846 Ga0495611_0001846_2801_3685 291
571 3300046664 Ga0495659_0000611 Ga0495659_0000611_6384_7268 291
572 3300046665 Ga0495661_0024940 Ga0495661_0024940_371_1255 291
573 3300046691 Ga0495670_0002302 Ga0495670_0002302_5659_6543 291
574 3300046691 Ga0495670_0069099 Ga0495670_0069099_249_1133 291
575 3300046692 Ga0495671_0008181 Ga0495671_0008181_489_1373 291
576 3300046692 Ga0495671_0033527 Ga0495671_0033527_1489_2373 291
577 3300046810 Ga0495660_0099189 Ga0495660_0099189_117_1001 291
578 3300047318 Ga0495636_0000622 Ga0495636_0000622_11202_12086 291
579 3300047320 Ga0495672_0003721 Ga0495672_0003721_6344_7246 291
580 3300047323 Ga0495683_0003094 Ga0495683_0003094_1649_2551 291
581 3300047443 Ga0495687_001987 Ga0495687_001987_11209_12093 291
582 3300047446 Ga0495679_008750 Ga0495679_008750_2291_3226 291
583 3300047469 Ga0495673_0006770 Ga0495673_0006770_1885_2787 291
584 3300047469 Ga0495673_0024159 Ga0495673_0024159_689_1573 291
585 3300047472 Ga0495686_0018533 Ga0495686_0018533_609_1493 291
586 3300049459 Ga0495678_001982 Ga0495678_001982_6434_7318 291
587 3300049460 Ga0495682_0000880 Ga0495682_0000880_6434_7318 291
588 3300049460 Ga0495682_0000885 Ga0495682_0000885_11281_12165 291
589 3300002739 JGI25158J39367_1000681 JGI25158J39367_10006811 292
590 3300002773 JGI25152J39213_1021694 JGI25152J39213_10216942 292
591 3300002774 JGI25150J39212_1004880 JGI25150J39212_10048803 292
592 3300002987 JGI25159J45721_1001798 JGI25159J45721_10017983 292
593 3300003374 JGI25161J50226_1000379 JGI25161J50226_100037916 292
594 3300003771 Ga0055526_1000886 Ga0055526_10008864 292
595 3300003771 Ga0055526_1002284 Ga0055526_10022846 292
596 3300003773 Ga0055537_1004064 Ga0055537_10040644 292
597 3300003775 Ga0055524_1001202 Ga0055524_10012024 292
598 3300003775 Ga0055524_1013579 Ga0055524_10135793 292
599 3300003784 Ga0055534_1004505 Ga0055534_10045053 292
600 3300003790 Ga0055528_1007142 Ga0055528_10071423 292
601 3300003791 Ga0055530_10001716 Ga0055530_100017164 292
602 3300004625 Ga0055543_1000506 Ga0055543_10005064 292
603 3300005262 Ga0065165_1001674 Ga0065165_10016744 292
604 3300025208 Ga0209436_100214 Ga0209436_10021417 292
605 3300025245 Ga0207425_1000342 Ga0207425_100034217 292
606 3300025258 Ga0209129_1001471 Ga0209129_10014713 292
607 3300025263 Ga0209565_1000845 Ga0209565_10008452 292
608 3300025263 Ga0209565_1002322 Ga0209565_10023223 292
609 3300025273 Ga0209673_1008832 Ga0209673_10088323 292
610 3300025284 Ga0209130_1000891 Ga0209130_100089116 292
611 3300025284 Ga0209130_1006703 Ga0209130_10067034 292
612 3300025291 Ga0209675_1023486 Ga0209675_10234862 292
613 3300025291 Ga0209675_1026531 Ga0209675_10265312 292
614 3300025295 Ga0209564_1001569 Ga0209564_100156916 292
615 3300025295 Ga0209564_1001911 Ga0209564_10019113 292
616 3300025295 Ga0209564_1019176 Ga0209564_10191762 292
617 3300025295 Ga0209564_1048082 Ga0209564_10480821 292
618 3300025298 Ga0209050_1001108 Ga0209050_100110817 292
619 3300025298 Ga0209050_1002184 Ga0209050_10021842 292
620 3300025299 Ga0209256_1001037 Ga0209256_100103717 292
621 3300025299 Ga0209256_1001848 Ga0209256_100184814 292
622 3300025302 Ga0207426_1032255 Ga0207426_10322552 292
623 3300025302 Ga0207426_1055840 Ga0207426_10558402 292
624 3300025304 Ga0209257_1002687 Ga0209257_10026874 292
625 3300031548 Ga0307408_100000547 Ga0307408_10000054711 292
626 3300031548 Ga0307408_100003280 Ga0307408_1000032803 292
627 3300031548 Ga0307408_100017982 Ga0307408_1000179825 292
628 3300046507 Ga0495606_0009094 Ga0495606_0009094_4192_5079 292
629 3300046530 Ga0495654_0005600 Ga0495654_0005600_4334_5221 292
630 3300046542 Ga0495597_0004571 Ga0495597_0004571_1889_2776 292
631 3300046542 Ga0495597_0022348 Ga0495597_0022348_501_1388 292
632 3300046660 Ga0495625_0025968 Ga0495625_0025968_2705_3592 292
633 3300046664 Ga0495659_0000322 Ga0495659_0000322_11477_12364 292
634 3300046692 Ga0495671_0001117 Ga0495671_0001117_11292_12179 292
635 3300046810 Ga0495660_0007698 Ga0495660_0007698_3077_3964 292
636 3300047320 Ga0495672_0002076 Ga0495672_0002076_6414_7301 292
637 3300049665 Ga0501227_002169 Ga0501227_002169_1870_2766 292

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01497

Peripla_BP_2

Periplasmic binding protein

39

252

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
5m29-assembly2.cif.gz_B structure of cobinamide-bound btuf, the periplasmic vitamin b12 binding protein in e.coli 0.9586 37 285
5m34-assembly2.cif.gz_B structure of cobinamide-bound btuf mutant w66y, the periplasmic vitamin b12 binding protein in e.coli 0.9566 35 284
5m2q-assembly1.cif.gz_A structure of cobinamide-bound btuf mutant w66f, the periplasmic vitamin b12 binding protein in e.coli 0.9532 37 285
5m3b-assembly1.cif.gz_A structure of cobinamide-bound btuf mutant w66l, the periplasmic vitamin b12 binding protein in e.coli 0.9501 35 284
5m34-assembly2.cif.gz_B structure of cobinamide-bound btuf mutant w66y, the periplasmic vitamin b12 binding protein in e.coli 0.9485 35 284
ID Description Score Start End Superfamily
5yscA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nitrogenase molybdenum iron protein domain 0.9572 36 154 3.40.50.1980
af_P37028_21_140_3.40.50.1980 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nitrogenase molybdenum iron protein domain 0.9338 35 154 3.40.50.1980
5m2qB02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nitrogenase molybdenum iron protein domain 0.9207 158 284 3.40.50.1980
5yscA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nitrogenase molybdenum iron protein domain 0.9199 36 154 3.40.50.1980
af_P37028_21_140_3.40.50.1980 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nitrogenase molybdenum iron protein domain 0.9116 35 154 3.40.50.1980
ID Description Score Start End GO Terms
AF-A0A562B4V2-F1-model_v4 Iron complex transport system substrate-binding protein 0.976 12 292
AF-A0A1F4AHU8-F1-model_v4 Cobalamin-binding protein 0.9743 13 203
AF-A0A3A6NXE8-F1-model_v4 Cobalamin-binding protein 0.9729 17 285
AF-A0A498EZX2-F1-model_v4 deleted 0.9684 139 291
AF-A0A1Y5D0U5-F1-model_v4 Cobalamin-binding protein 0.9597 38 285 GO:0071281

Feature Viewer

pLDDT pTM Quality
90.03 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map