F471427

General Info

Members Datasets Scaffolds Average Seq Length
637 302 632 100

Family's Representative Sequence

Representative Sequence 3300021377|Ga0213874_10011311|Ga0213874_100113112
Length 101
Sequence MRIKLDRTVCDGFGACAKHAPEYFSLDDWGYASLVGNGDPDGEIPEQDHDAVLRALLDCPVHAIIEMGEHRAAAPPAHNAEEAHEPHVKSDDSEAIWGFVR

Samples

Sample ID Description Type Environment
1 2738541274 Mycobacterium sp. YR708 Isolate Unclassified
2 2738543028 Mycobacterium sp. YR782 Isolate Unclassified
3 2842134933 Mycolicibacterium obuense SEMIA 442 Isolate Nodule
4 2902799365 Mycolicibacterium sp. P1-5 Isolate Unclassified
5 2929212328 Mycolicibacterium sp. R-73050 Hybrid assembly Isolate Unclassified
6 3300000545 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNX_Illumina_Assembled Metagenome Rhizosphere
7 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
8 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
9 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
10 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
11 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
12 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
13 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
14 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
15 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
16 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
17 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
18 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
19 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
20 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
21 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
22 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
23 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
24 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
25 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
26 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
27 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
28 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
29 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
30 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
31 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
32 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
33 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
34 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
35 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
36 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
37 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
38 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
39 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
40 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
41 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
42 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
43 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
44 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
45 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
46 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
47 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
48 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
49 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
50 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
51 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
52 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
53 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
54 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
55 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
56 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
57 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
58 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
59 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
60 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
61 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
62 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
63 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
64 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
65 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
66 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
67 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
68 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
69 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
70 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
71 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
72 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
73 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
74 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
75 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
76 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
77 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
78 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
79 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
80 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
81 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
82 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
83 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
84 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
85 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
86 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
87 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
88 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
89 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
90 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
91 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
92 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
93 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
94 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
95 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
96 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
97 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
98 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
99 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
100 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
101 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
102 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
103 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
104 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
105 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
106 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
107 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
108 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
109 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
110 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
111 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
112 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
113 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
114 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
115 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
116 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
117 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
118 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
119 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
120 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
121 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
170 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
174 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
175 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
176 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
177 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
178 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
179 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
180 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
181 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
182 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
183 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
184 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
185 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
186 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
187 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
188 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
189 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
190 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
191 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
192 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
193 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
194 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
195 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
196 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
197 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
198 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
199 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
200 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
201 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
202 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
203 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
204 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
205 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
206 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
207 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
208 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
209 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
210 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
211 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
212 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
213 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
214 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
215 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
216 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
217 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
218 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
219 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
220 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
221 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
222 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
223 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
224 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
225 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
226 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
227 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
228 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
229 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
230 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
231 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
232 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
233 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
234 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
235 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
236 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
237 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
238 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
239 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
240 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
241 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
242 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
243 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
244 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
245 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
246 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
247 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
248 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
249 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
250 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
251 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
252 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
253 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
254 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
255 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
256 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
257 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
258 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
259 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
260 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
261 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
262 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
263 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
264 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
265 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
266 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
267 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
268 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
269 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
270 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
271 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
272 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
273 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
274 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
275 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
276 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
277 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
278 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
279 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
280 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
281 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
282 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
283 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
284 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
285 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
286 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
287 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
288 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
289 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
290 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
291 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
292 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
293 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
294 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
295 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
296 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
297 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
298 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
299 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
300 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
301 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
302 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.22
Metatranscriptomes 0
Isolates 0.78

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 17.11
Nodule 0.16
Rhizoplane 8.95
Rhizosphere 68.45
Stem 0
Stem Tuber 0
Unclassified 5.34

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 CNXas_1010893 3300000545 Bacteria 644
2 JGI24737J22298_10025242 3300001990 Bacteria 1880
3 JGI24737J22298_10061817 3300001990 Bacteria 1126
4 JGI24743J22301_10001574 3300001991 Bacteria 3208
5 JGI24750J21931_1004851 3300002070 Bacteria 1639
6 JGI24750J21931_1019345 3300002070 Bacteria 943
7 JGI24745J21846_1007131 3300002073 Bacteria 1250
8 JGI24748J21848_1057785 3300002074 Bacteria 514
9 JGI24738J21930_10013020 3300002075 Bacteria 1807
10 JGI24738J21930_10110247 3300002075 Bacteria 592
11 JGI24034J26672_10024535 3300002239 Bacteria 961
12 Ga0070676_10145981 3300005328 Bacteria 1510
13 Ga0070690_100006335 3300005330 Bacteria 6711
14 Ga0070677_10164421 3300005333 Bacteria 1044
15 Ga0068869_100044467 3300005334 Bacteria 3194
16 Ga0070666_10129144 3300005335 Bacteria 1755
17 Ga0070680_100693416 3300005336 Bacteria 876
18 Ga0070682_100021569 3300005337 Bacteria 3804
19 Ga0068868_100001175 3300005338 Bacteria 17927
20 Ga0068868_100008132 3300005338 Bacteria 7503
21 Ga0070689_100193339 3300005340 Bacteria 1657
22 Ga0070691_10002313 3300005341 Bacteria 8446
23 Ga0070687_100010588 3300005343 Bacteria 3996
24 Ga0070668_100001742 3300005347 Bacteria 15831
25 Ga0070668_100162368 3300005347 Bacteria 1813
26 Ga0070669_100028149 3300005353 Bacteria 4046
27 Ga0070669_100085651 3300005353 Bacteria 2353
28 Ga0070675_100059181 3300005354 Bacteria 3160
29 Ga0070671_100095424 3300005355 Bacteria 2493
30 Ga0070671_100153639 3300005355 Bacteria 1944
31 Ga0070671_100979154 3300005355 Bacteria 740
32 Ga0070674_100000563 3300005356 Bacteria 18666
33 Ga0070674_100067024 3300005356 Bacteria 2524
34 Ga0070673_100156894 3300005364 Bacteria 1932
35 Ga0070688_100003575 3300005365 Bacteria 8016
36 Ga0070659_100050166 3300005366 Bacteria 3282
37 Ga0070667_100006165 3300005367 Bacteria 9967
38 Ga0070667_100111791 3300005367 Bacteria 2370
39 Ga0070667_100212532 3300005367 Bacteria 1719
40 Ga0070667_100594535 3300005367 Bacteria 1019
41 Ga0070667_100687616 3300005367 Bacteria 946
42 Ga0070703_10051976 3300005406 Bacteria 1313
43 Ga0070709_10018035 3300005434 Bacteria 4057
44 Ga0070714_100268680 3300005435 Bacteria 1581
45 Ga0070714_100656632 3300005435 Bacteria 1010
46 Ga0070714_100797076 3300005435 Bacteria 915
47 Ga0070710_10001265 3300005437 Bacteria 12001
48 Ga0070701_10007816 3300005438 Bacteria 4593
49 Ga0070711_100000861 3300005439 Bacteria 15962
50 Ga0070700_100003148 3300005441 Bacteria 8480
51 Ga0070700_100195649 3300005441 Bacteria 1417
52 Ga0070694_100001137 3300005444 Bacteria 15245
53 Ga0070694_101735054 3300005444 Bacteria 531
54 Ga0070678_100001636 3300005456 Bacteria 11994
55 Ga0070678_100240101 3300005456 Bacteria 1515
56 Ga0070678_101508923 3300005456 Bacteria 629
57 Ga0070662_100177256 3300005457 Bacteria 1678
58 Ga0068867_100000117 3300005459 Bacteria 50416
59 Ga0070685_10047141 3300005466 Bacteria 2477
60 Ga0070685_10183191 3300005466 Bacteria 1350
61 Ga0070685_11436691 3300005466 Bacteria 530
62 Ga0070707_100637624 3300005468 Bacteria 1028
63 Ga0070679_100404325 3300005530 Bacteria 1311
64 Ga0070684_101980851 3300005535 Bacteria 550
65 Ga0068853_100002723 3300005539 Bacteria 13340
66 Ga0070672_100106676 3300005543 Bacteria 2279
67 Ga0070686_100106006 3300005544 Bacteria 1907
68 Ga0070686_101954020 3300005544 Bacteria 501
69 Ga0070696_100005500 3300005546 Bacteria 8452
70 Ga0070693_100007978 3300005547 Bacteria 5196
71 Ga0070665_100011478 3300005548 Bacteria 8960
72 Ga0070665_100027250 3300005548 Bacteria 5755
73 Ga0070665_100046080 3300005548 Bacteria 4380
74 Ga0070665_100383979 3300005548 Bacteria 1412
75 Ga0070665_101371986 3300005548 Bacteria 716
76 Ga0070704_100000959 3300005549 Bacteria 14633
77 Ga0070704_101108720 3300005549 Bacteria 719
78 Ga0068855_100138771 3300005563 Bacteria 2773
79 Ga0068854_100000583 3300005578 Bacteria 21768
80 Ga0068856_101291651 3300005614 Bacteria 745
81 Ga0070702_100000286 3300005615 Bacteria 17291
82 Ga0068852_100172433 3300005616 Bacteria 2029
83 Ga0068852_100414733 3300005616 Bacteria 1327
84 Ga0068859_100001965 3300005617 Bacteria 20980
85 Ga0068859_100218349 3300005617 Bacteria 1994
86 Ga0068859_100261796 3300005617 Bacteria 1821
87 Ga0068859_100751308 3300005617 Bacteria 1064
88 Ga0068866_10000573 3300005718 Bacteria 16728
89 Ga0068866_10037642 3300005718 Bacteria 2377
90 Ga0068861_100000507 3300005719 Bacteria 22720
91 Ga0068861_100073514 3300005719 Bacteria 2656
92 Ga0068861_100783892 3300005719 Bacteria 893
93 Ga0068851_10276985 3300005834 Bacteria 958
94 Ga0068870_10169290 3300005840 Bacteria 1302
95 Ga0068863_100013142 3300005841 Bacteria 7991
96 Ga0068863_100436395 3300005841 Bacteria 1284
97 Ga0068858_100009407 3300005842 Bacteria 9325
98 Ga0068858_100202546 3300005842 Bacteria 1877
99 Ga0068858_100581825 3300005842 Bacteria 1085
100 Ga0068858_101273536 3300005842 Bacteria 723
101 Ga0068860_100003792 3300005843 Bacteria 15553
102 Ga0068860_100096383 3300005843 Bacteria 2820
103 Ga0068860_100166994 3300005843 Bacteria 2125
104 Ga0068860_100433987 3300005843 Bacteria 1304
105 Ga0068860_101259973 3300005843 Bacteria 760
106 Ga0068862_100006603 3300005844 Bacteria 9619
107 Ga0068862_100262096 3300005844 Bacteria 1578
108 Ga0068862_100352947 3300005844 Bacteria 1365
109 Ga0068862_100988847 3300005844 Bacteria 831
110 Ga0081455_10086958 3300005937 Bacteria 2545
111 Ga0081538_10141284 3300005981 Bacteria 1110
112 Ga0081538_10166467 3300005981 Bacteria 969
113 Ga0070717_10523600 3300006028 Bacteria 1073
114 Ga0075365_10022376 3300006038 Bacteria 3960
115 Ga0075365_10029962 3300006038 Bacteria 3482
116 Ga0075365_10047244 3300006038 Bacteria 2829
117 Ga0075365_10178581 3300006038 Bacteria 1484
118 Ga0075365_10972940 3300006038 Bacteria 598
119 Ga0075368_10190061 3300006042 Bacteria 867
120 Ga0075363_100000791 3300006048 Bacteria 10922
121 Ga0075363_100008208 3300006048 Bacteria 4849
122 Ga0075363_100009271 3300006048 Bacteria 4623
123 Ga0075363_100014948 3300006048 Bacteria 3806
124 Ga0075363_100102581 3300006048 Bacteria 1584
125 Ga0075363_100203738 3300006048 Bacteria 1131
126 Ga0075363_100313673 3300006048 Bacteria 911
127 Ga0075363_100322409 3300006048 Bacteria 899
128 Ga0075363_100397858 3300006048 Bacteria 809
129 Ga0075363_100645556 3300006048 Bacteria 636
130 Ga0075364_10003160 3300006051 Bacteria 9321
131 Ga0075364_10011854 3300006051 Bacteria 5308
132 Ga0075364_10017218 3300006051 Bacteria 4511
133 Ga0075364_10030170 3300006051 Bacteria 3479
134 Ga0075364_10034481 3300006051 Bacteria 3265
135 Ga0075364_10101347 3300006051 Bacteria 1917
136 Ga0075364_10195470 3300006051 Bacteria 1370
137 Ga0075364_10272700 3300006051 Bacteria 1151
138 Ga0075432_10539264 3300006058 Bacteria 525
139 Ga0070715_10014293 3300006163 Bacteria 2937
140 Ga0070716_100015321 3300006173 Bacteria 3938
141 Ga0070716_100785512 3300006173 Bacteria 736
142 Ga0070712_100002997 3300006175 Bacteria 10452
143 Ga0070712_100310972 3300006175 Bacteria 1278
144 Ga0070712_100333214 3300006175 Bacteria 1237
145 Ga0075362_10010473 3300006177 Bacteria 3621
146 Ga0075362_10031819 3300006177 Bacteria 2286
147 Ga0075362_10062103 3300006177 Bacteria 1692
148 Ga0075362_10086811 3300006177 Bacteria 1448
149 Ga0075362_10463495 3300006177 Bacteria 645
150 Ga0075367_10084486 3300006178 Bacteria 1925
151 Ga0075367_10120367 3300006178 Bacteria 1617
152 Ga0075367_10205824 3300006178 Bacteria 1230
153 Ga0075367_10528321 3300006178 Bacteria 749
154 Ga0075367_10736444 3300006178 Bacteria 627
155 Ga0075369_10000460 3300006186 Bacteria 12476
156 Ga0075369_10015929 3300006186 Bacteria 3025
157 Ga0075369_10031496 3300006186 Bacteria 2240
158 Ga0075369_10031965 3300006186 Bacteria 2224
159 Ga0075369_10051105 3300006186 Bacteria 1789
160 Ga0075369_10147381 3300006186 Bacteria 1075
161 Ga0075369_10157597 3300006186 Bacteria 1040
162 Ga0075369_10340299 3300006186 Bacteria 703
163 Ga0075366_10066310 3300006195 Bacteria 2147
164 Ga0075370_10008394 3300006353 Bacteria 5315
165 Ga0075370_10012155 3300006353 Bacteria 4542
166 Ga0075370_10013436 3300006353 Bacteria 4353
167 Ga0075370_10033080 3300006353 Bacteria 2893
168 Ga0075370_10326544 3300006353 Bacteria 914
169 Ga0075370_10339877 3300006353 Bacteria 896
170 Ga0075370_10865429 3300006353 Bacteria 552
171 Ga0075428_100000149 3300006844 Bacteria 63444
172 Ga0075428_102346536 3300006844 Bacteria 548
173 Ga0075430_100004305 3300006846 Bacteria 12021
174 Ga0075430_100103183 3300006846 Bacteria 2381
175 Ga0075431_100128400 3300006847 Bacteria 2616
176 Ga0068865_100007593 3300006881 Bacteria 6675
177 Ga0068865_100372737 3300006881 Bacteria 1162
178 Ga0097620_100001965 3300006931 Bacteria 20980
179 Ga0097620_100218363 3300006931 Bacteria 1994
180 Ga0097620_100261791 3300006931 Bacteria 1821
181 Ga0097620_100751261 3300006931 Bacteria 1064
182 Ga0105250_10027932 3300009092 Bacteria 2273
183 Ga0105250_10062864 3300009092 Bacteria 1494
184 Ga0105250_10546821 3300009092 Bacteria 531
185 Ga0105240_10664010 3300009093 Bacteria 1141
186 Ga0111539_10180160 3300009094 Bacteria 2468
187 Ga0105245_10001561 3300009098 Bacteria 20801
188 Ga0105245_10002923 3300009098 Bacteria 15332
189 Ga0105247_10005571 3300009101 Bacteria 7913
190 Ga0105247_10624379 3300009101 Bacteria 802
191 Ga0105247_10912751 3300009101 Bacteria 679
192 Ga0114129_10033330 3300009147 Bacteria 7278
193 Ga0105243_10002003 3300009148 Bacteria 17327
194 Ga0105241_10048224 3300009174 Bacteria 3241
195 Ga0105241_10558900 3300009174 Bacteria 1028
196 Ga0105241_10652139 3300009174 Bacteria 956
197 Ga0105242_10000979 3300009176 Bacteria 22301
198 Ga0105242_11654231 3300009176 Bacteria 675
199 Ga0105242_11695093 3300009176 Bacteria 668
200 Ga0105248_10011464 3300009177 Bacteria 9768
201 Ga0105248_10274560 3300009177 Bacteria 1898
202 Ga0105237_10020056 3300009545 Bacteria 6901
203 Ga0105237_10130252 3300009545 Bacteria 2510
204 Ga0105238_10742063 3300009551 Bacteria 995
205 Ga0105249_10001158 3300009553 Bacteria 23315
206 Ga0105249_10026757 3300009553 Bacteria 5202
207 Ga0105249_10123159 3300009553 Bacteria 2467
208 Ga0105239_10026074 3300010375 Bacteria 6435
209 Ga0105239_10173105 3300010375 Bacteria 2414
210 Ga0105246_10435318 3300011119 Bacteria 1098
211 Ga0105246_10526834 3300011119 Bacteria 1008
212 Ga0105246_10946714 3300011119 Bacteria 776
213 Ga0105246_11307745 3300011119 Bacteria 672
214 Ga0157371_10257777 3300013102 Bacteria 1257
215 Ga0157374_10007794 3300013296 Bacteria 9139
216 Ga0157374_10794436 3300013296 Bacteria 962
217 Ga0157374_11060681 3300013296 Bacteria 830
218 Ga0157378_10002180 3300013297 Bacteria 17360
219 Ga0157378_10504492 3300013297 Bacteria 1209
220 Ga0163162_10006763 3300013306 Bacteria 11128
221 Ga0163162_10089548 3300013306 Bacteria 3158
222 Ga0163162_10398058 3300013306 Bacteria 1510
223 Ga0163162_11468939 3300013306 Bacteria 776
224 Ga0163162_12027468 3300013306 Bacteria 659
225 Ga0157372_10007056 3300013307 Bacteria 11968
226 Ga0157375_10000151 3300013308 Bacteria 68008
227 Ga0157375_10028740 3300013308 Bacteria 5218
228 Ga0157375_10102500 3300013308 Bacteria 2947
229 Ga0163163_10350897 3300014325 Bacteria 1531
230 Ga0163163_10542803 3300014325 Bacteria 1225
231 Ga0163163_10899024 3300014325 Bacteria 949
232 Ga0157380_10008689 3300014326 Bacteria 7259
233 Ga0157380_10564538 3300014326 Bacteria 1119
234 Ga0157377_10023317 3300014745 Bacteria 3278
235 Ga0157377_10047941 3300014745 Bacteria 2395
236 Ga0157379_10006897 3300014968 Bacteria 9822
237 Ga0157379_10206471 3300014968 Bacteria 1777
238 Ga0157379_10403877 3300014968 Bacteria 1256
239 Ga0163161_10002439 3300017792 Bacteria 13286
240 Ga0163161_10153271 3300017792 Bacteria 1753
241 Ga0213874_10011311 3300021377 Bacteria 2257
242 Ga0213876_10000674 3300021384 Bacteria 24320
243 Ga0213876_10013547 3300021384 Bacteria 4327
244 Ga0213876_10041514 3300021384 Bacteria 2431
245 Ga0213875_10015301 3300021388 Bacteria 3733
246 Ga0213875_10023757 3300021388 Bacteria 2926
247 Ga0209051_1000011 3300025303 Bacteria 610828
248 Ga0209051_1058610 3300025303 Bacteria 1225
249 Ga0207696_1075485 3300025711 Bacteria 934
250 Ga0207653_10127458 3300025885 Bacteria 921
251 Ga0207682_10074748 3300025893 Bacteria 1441
252 Ga0207692_10006178 3300025898 Bacteria 4850
253 Ga0207642_10002544 3300025899 Bacteria 5676
254 Ga0207642_10034825 3300025899 Bacteria 2145
255 Ga0207710_10009664 3300025900 Bacteria 4053
256 Ga0207710_10205019 3300025900 Bacteria 975
257 Ga0207688_10000025 3300025901 Bacteria 48564
258 Ga0207688_10038428 3300025901 Bacteria 2656
259 Ga0207688_10276616 3300025901 Bacteria 1022
260 Ga0207680_10148925 3300025903 Bacteria 1559
261 Ga0207680_10864366 3300025903 Bacteria 648
262 Ga0207647_10094050 3300025904 Bacteria 1786
263 Ga0207647_10752579 3300025904 Bacteria 527
264 Ga0207699_10006989 3300025906 Bacteria 5497
265 Ga0207645_10090677 3300025907 Bacteria 1965
266 Ga0207643_10173066 3300025908 Bacteria 1304
267 Ga0207654_10025370 3300025911 Bacteria 3197
268 Ga0207695_10796547 3300025913 Bacteria 825
269 Ga0207671_10019240 3300025914 Bacteria 5225
270 Ga0207671_10076992 3300025914 Bacteria 2496
271 Ga0207693_10000123 3300025915 Bacteria 69311
272 Ga0207693_10176392 3300025915 Bacteria 1682
273 Ga0207663_10760543 3300025916 Bacteria 770
274 Ga0207662_10031759 3300025918 Bacteria 3069
275 Ga0207681_10011516 3300025923 Bacteria 5433
276 Ga0207681_10205015 3300025923 Bacteria 1516
277 Ga0207687_10005259 3300025927 Bacteria 8580
278 Ga0207664_10181617 3300025929 Bacteria 1806
279 Ga0207664_10753985 3300025929 Bacteria 875
280 Ga0207644_10023474 3300025931 Bacteria 4225
281 Ga0207644_10059568 3300025931 Bacteria 2761
282 Ga0207644_10466744 3300025931 Bacteria 1038
283 Ga0207690_10032613 3300025932 Bacteria 3343
284 Ga0207706_10008057 3300025933 Bacteria 9725
285 Ga0207686_10001243 3300025934 Bacteria 14738
286 Ga0207686_10219572 3300025934 Bacteria 1372
287 Ga0207686_11008968 3300025934 Bacteria 676
288 Ga0207709_10021107 3300025935 Bacteria 3683
289 Ga0207709_10405880 3300025935 Bacteria 1043
290 Ga0207670_10192611 3300025936 Bacteria 1543
291 Ga0207669_10000400 3300025937 Bacteria 19143
292 Ga0207669_10110722 3300025937 Bacteria 1839
293 Ga0207704_10000325 3300025938 Bacteria 22184
294 Ga0207665_10008251 3300025939 Bacteria 6875
295 Ga0207691_10293078 3300025940 Bacteria 1399
296 Ga0207689_10029664 3300025942 Bacteria 4565
297 Ga0207651_10887092 3300025960 Bacteria 794
298 Ga0207651_11768583 3300025960 Bacteria 556
299 Ga0207712_10006113 3300025961 Bacteria 7597
300 Ga0207712_10047263 3300025961 Bacteria 2987
301 Ga0207712_10188585 3300025961 Bacteria 1626
302 Ga0207668_10010813 3300025972 Bacteria 5528
303 Ga0207668_10092024 3300025972 Bacteria 2231
304 Ga0207668_11307170 3300025972 Bacteria 653
305 Ga0207640_10000582 3300025981 Bacteria 21781
306 Ga0207658_10003640 3300025986 Bacteria 10879
307 Ga0207658_10007427 3300025986 Bacteria 7475
308 Ga0207658_10294193 3300025986 Bacteria 1396
309 Ga0207658_10501793 3300025986 Bacteria 1081
310 Ga0207658_10966060 3300025986 Bacteria 777
311 Ga0207677_10009499 3300026023 Bacteria 5475
312 Ga0207677_10046075 3300026023 Bacteria 2917
313 Ga0207703_10005075 3300026035 Bacteria 10656
314 Ga0207703_10118513 3300026035 Bacteria 2270
315 Ga0207703_10206777 3300026035 Bacteria 1747
316 Ga0207703_10376879 3300026035 Bacteria 1312
317 Ga0207678_10006722 3300026067 Bacteria 10198
318 Ga0207708_10000452 3300026075 Bacteria 31890
319 Ga0207708_10052844 3300026075 Bacteria 3094
320 Ga0207702_10155061 3300026078 Bacteria 2087
321 Ga0207641_10008652 3300026088 Bacteria 8404
322 Ga0207641_10246696 3300026088 Bacteria 1666
323 Ga0207641_10376915 3300026088 Bacteria 1358
324 Ga0207641_10604433 3300026088 Bacteria 1074
325 Ga0207648_10000381 3300026089 Bacteria 48976
326 Ga0207676_12163036 3300026095 Bacteria 555
327 Ga0207675_100000406 3300026118 Bacteria 41422
328 Ga0207675_100177317 3300026118 Bacteria 2039
329 Ga0207675_100368408 3300026118 Bacteria 1411
330 Ga0207683_10001482 3300026121 Bacteria 21160
331 Ga0207683_10535077 3300026121 Bacteria 1083
332 Ga0207698_10107473 3300026142 Bacteria 2329
333 Ga0207698_10195168 3300026142 Bacteria 1808
334 Ga0207428_10698707 3300027907 Bacteria 725
335 Ga0268266_10008853 3300028379 Bacteria 8912
336 Ga0268266_10042708 3300028379 Bacteria 3873
337 Ga0268265_10011038 3300028380 Bacteria 6101
338 Ga0268265_10036750 3300028380 Bacteria 3589
339 Ga0268265_10086292 3300028380 Bacteria 2494
340 Ga0268265_10452801 3300028380 Bacteria 1199
341 Ga0268264_10009176 3300028381 Bacteria 8195
342 Ga0268264_10047094 3300028381 Bacteria 3584
343 Ga0268264_10231025 3300028381 Bacteria 1708
344 Ga0268264_10401514 3300028381 Bacteria 1317
345 Ga0265327_10001674 3300031251 Bacteria 26619
346 Ga0307405_10122475 3300031731 Bacteria 1782
347 Ga0307413_10768815 3300031824 Bacteria 807
348 Ga0307410_10084540 3300031852 Bacteria 2237
349 Ga0307410_10617173 3300031852 Bacteria 906
350 Ga0307407_11175874 3300031903 Bacteria 598
351 Ga0307407_11591261 3300031903 Bacteria 518
352 Ga0307412_10545127 3300031911 Bacteria 973
353 Ga0307409_100064748 3300031995 Bacteria 2873
354 Ga0307409_100189140 3300031995 Bacteria 1831
355 Ga0307416_100055630 3300032002 Bacteria 3188
356 Ga0307415_100544484 3300032126 Bacteria 1023
357 Ga0307415_101891387 3300032126 Bacteria 579
358 Ga0373948_0058465 3300034817 Bacteria 842
359 Ga0373941_0134358 3300035115 Bacteria 894
360 Ga0373943_0260349 3300035170 Bacteria 976
361 Ga0373931_0102713 3300035691 Bacteria 1610
362 Ga0373931_0579430 3300035691 Bacteria 732
363 Ga0373931_0911514 3300035691 Bacteria 591
364 Ga0373927_0499533 3300035695 Bacteria 804
365 Ga0373925_0234864 3300037068 Bacteria 1467
366 Ga0395900_1037395 3300037418 Bacteria 739
367 Ga0436364_0069881 3300037853 Bacteria 6243
368 Ga0436364_1184081 3300037853 Bacteria 5385
369 Ga0436365_0016980 3300039437 Bacteria 29756
370 Ga0436365_0105619 3300039437 Bacteria 1349
371 Ga0436365_0119240 3300039437 Bacteria 17758
372 Ga0436365_1625921 3300039437 Bacteria 3019
373 Ga0436365_1664352 3300039437 Bacteria 3811
374 Ga0436363_0736099 3300039450 Bacteria 860
375 Ga0436363_1120337 3300039450 Bacteria 1277
376 Ga0436363_1397604 3300039450 Bacteria 5061
377 Ga0436362_0172575 3300039453 Bacteria 1201
378 Ga0436362_0722193 3300039453 Bacteria 1058
379 Ga0439461_0017051 3300041410 Bacteria 1408
380 Ga0439466_0007599 3300041411 Bacteria 4096
381 Ga0439465_0007860 3300041413 Bacteria 3379
382 Ga0451795_1283116 3300041456 Bacteria 646
383 Ga0451795_1417478 3300041456 Bacteria 967
384 Ga0451800_0902335 3300041459 Bacteria 640
385 Ga0451849_0120400 3300041505 Bacteria 756
386 Ga0451851_0602247 3300041507 Bacteria 675
387 Ga0451843_0586096 3300041509 Bacteria 655
388 Ga0451853_1679459 3300041512 Bacteria 748
389 Ga0439431_0020797 3300041997 Bacteria 1571
390 Ga0439445_0047838 3300042004 Bacteria 1149
391 Ga0466972_0051302 3300044658 Bacteria 1991
392 Ga0466972_0092635 3300044658 Bacteria 1432
393 Ga0466972_0249680 3300044658 Bacteria 829
394 Ga0466965_0025575 3300044683 Bacteria 2857
395 Ga0466966_0049549 3300044684 Bacteria 2675
396 Ga0466966_0144880 3300044684 Bacteria 1450
397 Ga0466961_0010397 3300044693 Bacteria 5939
398 Ga0466961_0055822 3300044693 Bacteria 2517
399 Ga0466963_0088041 3300044694 Bacteria 2112
400 Ga0466963_0094907 3300044694 Bacteria 2035
401 Ga0466963_0220747 3300044694 Bacteria 1327
402 Ga0466964_0156680 3300044706 Bacteria 1061
403 Ga0466964_0188280 3300044706 Bacteria 983
404 Ga0466964_0506255 3300044706 Bacteria 649
405 Ga0466971_0084172 3300044719 Bacteria 1452
406 Ga0466971_0202708 3300044719 Bacteria 937
407 Ga0466971_0712499 3300044719 Bacteria 505
408 Ga0466968_0010864 3300044735 Bacteria 3538
409 Ga0466968_0076993 3300044735 Bacteria 1461
410 Ga0466968_0080788 3300044735 Bacteria 1428
411 Ga0466968_0570719 3300044735 Bacteria 569
412 Ga0466970_0486668 3300044765 Bacteria 709
413 Ga0466970_0676868 3300044765 Bacteria 601
414 Ga0466957_0031391 3300044842 Bacteria 3175
415 Ga0466957_0123033 3300044842 Bacteria 1655
416 Ga0466957_0163064 3300044842 Bacteria 1448
417 Ga0466957_0417272 3300044842 Bacteria 920
418 Ga0466957_1150119 3300044842 Bacteria 560
419 Ga0466960_0001941 3300044901 Bacteria 7645
420 Ga0466960_0075460 3300044901 Bacteria 1687
421 Ga0466960_0257482 3300044901 Bacteria 971
422 Ga0466960_0723194 3300044901 Bacteria 598
423 Ga0466959_0123552 3300045049 Bacteria 1838
424 Ga0466959_0980425 3300045049 Bacteria 563
425 Ga0466958_0071960 3300045836 Bacteria 2117
426 Ga0466958_0092797 3300045836 Bacteria 1869
427 Ga0466958_0113751 3300045836 Bacteria 1690
428 Ga0466958_0952401 3300045836 Bacteria 560
429 Ga0466967_0002447 3300045976 Bacteria 11559
430 Ga0466967_0002855 3300045976 Bacteria 10973
431 Ga0466967_0005640 3300045976 Bacteria 8712
432 Ga0466967_0007837 3300045976 Bacteria 7759
433 Ga0466967_0073050 3300045976 Bacteria 3076
434 Ga0466967_0167671 3300045976 Bacteria 2064
435 Ga0466967_0366997 3300045976 Bacteria 1396
436 Ga0466967_0502609 3300045976 Bacteria 1190
437 Ga0466967_0539819 3300045976 Bacteria 1147
438 Ga0466967_0812045 3300045976 Bacteria 929
439 Ga0466967_1804346 3300045976 Bacteria 609
440 Ga0466967_2166569 3300045976 Bacteria 552
441 Ga0495592_0254995 3300046454 Bacteria 1158
442 Ga0495603_0019675 3300046455 Bacteria 4087
443 Ga0495638_0006703 3300046460 Bacteria 8345
444 Ga0495641_0013995 3300046461 Bacteria 4367
445 Ga0495582_0295187 3300046473 Bacteria 932
446 Ga0495662_0040780 3300046476 Bacteria 2242
447 Ga0495606_0515215 3300046507 Bacteria 601
448 Ga0495608_0577260 3300046511 Bacteria 676
449 Ga0495665_0239131 3300046531 Bacteria 936
450 Ga0495640_0082949 3300046533 Bacteria 2127
451 Ga0495668_0383720 3300046616 Bacteria 772
452 Ga0495668_0843613 3300046616 Bacteria 508
453 Ga0495634_0759659 3300046642 Bacteria 555
454 Ga0495588_0025567 3300046674 Bacteria 2943
455 Ga0495658_0012503 3300046683 Bacteria 4304
456 Ga0495624_0038399 3300046690 Bacteria 3076
457 Ga0495674_0038390 3300047319 Bacteria 4299
458 Ga0495672_0044336 3300047320 Bacteria 2669
459 Ga0495672_0149048 3300047320 Bacteria 1215
460 Ga0495676_0103972 3300047321 Bacteria 2096
461 Ga0495686_0000940 3300047472 Bacteria 36165
462 Ga0495593_0006029 3300047673 Bacteria 7131
463 Ga0495626_0168880 3300048091 Bacteria 913
464 Ga0496100_0001254 3300048903 Bacteria 12378
465 Ga0496100_0956753 3300048903 Bacteria 673
466 Ga0496100_1342558 3300048903 Bacteria 564
467 Ga0496101_0003852 3300048904 Bacteria 9382
468 Ga0496101_0091634 3300048904 Bacteria 2262
469 Ga0496101_0565928 3300048904 Bacteria 899
470 Ga0496102_0002086 3300048905 Bacteria 17193
471 Ga0496102_0019989 3300048905 Bacteria 5908
472 Ga0496102_0057771 3300048905 Bacteria 3544
473 Ga0496102_0189442 3300048905 Bacteria 1938
474 Ga0496103_0000991 3300048906 Bacteria 20033
475 Ga0496103_0231298 3300048906 Bacteria 1189
476 Ga0496103_0310789 3300048906 Bacteria 1014
477 Ga0496104_0012733 3300048907 Bacteria 7577
478 Ga0496104_0737441 3300048907 Bacteria 892
479 Ga0496105_0150107 3300048908 Bacteria 1916
480 Ga0496106_0001129 3300048909 Bacteria 19754
481 Ga0496106_0447789 3300048909 Bacteria 1037
482 Ga0496106_0448498 3300048909 Bacteria 1036
483 Ga0496107_0000495 3300048910 Bacteria 21738
484 Ga0496107_0348733 3300048910 Bacteria 1102
485 Ga0496107_0852079 3300048910 Bacteria 666
486 Ga0496108_0001316 3300048911 Bacteria 19527
487 Ga0496108_0011021 3300048911 Bacteria 7341
488 Ga0496108_0344703 3300048911 Bacteria 1300
489 Ga0496109_0004469 3300048912 Bacteria 11684
490 Ga0496109_0048770 3300048912 Bacteria 3853
491 Ga0496109_0289565 3300048912 Bacteria 1544
492 Ga0496109_0440102 3300048912 Bacteria 1231
493 Ga0496110_0270550 3300048913 Bacteria 1547
494 Ga0496110_0319327 3300048913 Bacteria 1415
495 Ga0496110_0619501 3300048913 Bacteria 981
496 Ga0496110_0695185 3300048913 Bacteria 918
497 Ga0496111_0059303 3300048914 Bacteria 2773
498 Ga0496111_0903860 3300048914 Bacteria 636
499 Ga0496112_0008370 3300048915 Bacteria 9263
500 Ga0496112_0029700 3300048915 Bacteria 5289
501 Ga0496112_0045591 3300048915 Bacteria 4298
502 Ga0496112_0052846 3300048915 Bacteria 3989
503 Ga0496112_0243935 3300048915 Bacteria 1749
504 Ga0496112_0513168 3300048915 Bacteria 1134
505 Ga0496112_0821911 3300048915 Bacteria 853
506 Ga0496113_0005415 3300048916 Bacteria 7956
507 Ga0496113_0067648 3300048916 Bacteria 2709
508 Ga0496113_0417066 3300048916 Bacteria 1078
509 Ga0496113_0505642 3300048916 Bacteria 970
510 Ga0496113_0630352 3300048916 Bacteria 858
511 Ga0496113_1497868 3300048916 Bacteria 521
512 Ga0496114_0000419 3300048917 Bacteria 31425
513 Ga0496114_0929404 3300048917 Bacteria 752
514 Ga0496114_1157047 3300048917 Bacteria 659
515 Ga0496115_0090795 3300048918 Bacteria 2495
516 Ga0496115_1183967 3300048918 Bacteria 575
517 Ga0496115_1412279 3300048918 Bacteria 513
518 Ga0496118_0543670 3300048921 Bacteria 568
519 Ga0496120_0129904 3300048923 Bacteria 1291
520 Ga0496121_0265820 3300048924 Bacteria 1182
521 Ga0496122_0434412 3300048925 Bacteria 656
522 Ga0496123_0002306 3300048926 Bacteria 23967
523 Ga0496125_0306839 3300048928 Bacteria 969
524 Ga0496126_0004133 3300048929 Bacteria 17554
525 Ga0496126_0032421 3300048929 Bacteria 4922
526 Ga0496126_0169877 3300048929 Bacteria 1858
527 Ga0496126_0535744 3300048929 Bacteria 931
528 Ga0501031_0240025 3300049568 Bacteria 1178
529 Ga0501031_0595519 3300049568 Bacteria 711
530 Ga0501032_0036433 3300049569 Bacteria 3357
531 Ga0501032_0137596 3300049569 Bacteria 1609
532 Ga0501033_0006101 3300049570 Bacteria 9453
533 Ga0501033_0056622 3300049570 Bacteria 2897
534 Ga0501033_0243158 3300049570 Bacteria 1276
535 Ga0501034_0001987 3300049571 Bacteria 25894
536 Ga0501034_0454795 3300049571 Bacteria 1198
537 Ga0501034_0464683 3300049571 Bacteria 1182
538 Ga0501036_0131897 3300049572 Bacteria 2109
539 Ga0501037_0028731 3300049573 Bacteria 4108
540 Ga0501037_0408522 3300049573 Bacteria 930
541 Ga0501043_0015753 3300049579 Bacteria 5927
542 Ga0501043_0618976 3300049579 Bacteria 798
543 Ga0501043_0691279 3300049579 Bacteria 746
544 Ga0501046_0004078 3300049580 Bacteria 13317
545 Ga0501046_0336643 3300049580 Bacteria 1097
546 Ga0501047_0001180 3300049581 Bacteria 25903
547 Ga0501047_0708088 3300049581 Bacteria 824
548 Ga0501048_0047842 3300049582 Bacteria 3051
549 Ga0501067_0663368 3300049583 Bacteria 586
550 Ga0501069_0361505 3300049585 Bacteria 856
551 Ga0501069_0632952 3300049585 Bacteria 643
552 Ga0501070_0001918 3300049586 Bacteria 18362
553 Ga0501070_0025027 3300049586 Bacteria 5006
554 Ga0501070_0153243 3300049586 Bacteria 1901
555 Ga0501070_0699398 3300049586 Bacteria 802
556 Ga0501073_0888277 3300049589 Bacteria 614
557 Ga0501080_0066401 3300049742 Bacteria 3355
558 Ga0501080_0085313 3300049742 Bacteria 2934
559 Ga0501080_1550558 3300049742 Bacteria 562
560 Ga0501083_0221791 3300049744 Bacteria 1232
561 Ga0501035_0000385 3300049822 Bacteria 50730
562 Ga0501035_0003413 3300049822 Bacteria 15199
563 Ga0501035_0069213 3300049822 Bacteria 3129
564 Ga0501044_0001111 3300049823 Bacteria 31958
565 Ga0501044_0012026 3300049823 Bacteria 9376
566 Ga0501044_0338488 3300049823 Bacteria 1426
567 nmdc:mga03683_11119_c1 3300050489 Bacteria 3246
568 nmdc:mga03683_44298_c1 3300050489 Bacteria 1838
569 nmdc:mga03683_98788_c1 3300050489 Bacteria 1281
570 nmdc:mga03n38_131534_c1 3300050490 Bacteria 1240
571 nmdc:mga03n38_1616_c1 3300050490 Bacteria 6579
572 nmdc:mga03n38_284825_c1 3300050490 Bacteria 883
573 nmdc:mga03n38_370142_c1 3300050490 Bacteria 783
574 nmdc:mga03n38_41790_c1 3300050490 Bacteria 2000
575 nmdc:mga03n38_55980_c1 3300050490 Bacteria 1779
576 nmdc:mga03n38_6020_c1 3300050490 Bacteria 4181
577 nmdc:mga03n38_60749_c1 3300050490 Bacteria 1719
578 nmdc:mga03n38_71411_c1 3300050490 Bacteria 1608
579 nmdc:mga00v17_1224_c1 3300050491 Bacteria 13469
580 nmdc:mga00v17_13064_c1 3300050491 Bacteria 4601
581 nmdc:mga00v17_17049_c1 3300050491 Bacteria 4102
582 nmdc:mga00v17_24459_c1 3300050491 Bacteria 3505
583 nmdc:mga00v17_287505_c1 3300050491 Bacteria 1067
584 nmdc:mga00v17_357839_c1 3300050491 Bacteria 949
585 nmdc:mga00v17_38056_c1 3300050491 Bacteria 2875
586 nmdc:mga00v17_51768_c1 3300050491 Bacteria 2497
587 nmdc:mga0yw44_101392_c1 3300050492 Bacteria 1834
588 nmdc:mga0yw44_118789_c1 3300050492 Bacteria 1701
589 nmdc:mga0yw44_212413_c1 3300050492 Bacteria 1280
590 nmdc:mga0yw44_5588_c1 3300050492 Bacteria 5969
591 nmdc:mga0yw44_92961_c1 3300050492 Bacteria 1909
592 nmdc:mga0k408_158458_c1 3300050493 Bacteria 1348
593 nmdc:mga06z11_152360_c1 3300050494 Bacteria 989
594 nmdc:mga06z11_175482_c1 3300050494 Bacteria 1233
595 nmdc:mga06z11_197929_c1 3300050494 Bacteria 1166
596 nmdc:mga06z11_854449_c1 3300050494 Bacteria 554
597 nmdc:mga04h51_171451_c1 3300050495 Bacteria 840
598 nmdc:mga04h51_36143_c1 3300050495 Bacteria 1587
599 nmdc:mga04h51_446026_c1 3300050495 Bacteria 547
600 nmdc:mga04h51_493148_c1 3300050495 Bacteria 522
601 nmdc:mga07m45_107818_c1 3300050496 Bacteria 1602
602 nmdc:mga07m45_1850_c1 3300050496 Bacteria 9775
603 nmdc:mga07m45_20229_c1 3300050496 Bacteria 3615
604 nmdc:mga07m45_2352_c1 3300050496 Bacteria 8878
605 nmdc:mga07m45_62341_c1 3300050496 Bacteria 2113
606 nmdc:mga07m45_684_c2 3300050496 Bacteria 7355
607 nmdc:mga07m45_97142_c1 3300050496 Bacteria 1690
608 nmdc:mga05p37_7689_c2 3300050507 Bacteria 4594
609 nmdc:mga0qj67_237996_c1 3300050509 Bacteria 1477
610 nmdc:mga0qj67_3049_c1 3300050509 Bacteria 12034
611 nmdc:mga06r32_117924_c1 3300050510 Bacteria 2616
612 nmdc:mga08y16_146701_c1 3300050511 Bacteria 2453
613 nmdc:mga0sz30_1490_c2 3300050516 Bacteria 5861
614 nmdc:mga0sz30_151084_c1 3300050516 Bacteria 1027
615 nmdc:mga0sz30_1947_c1 3300050516 Bacteria 7377
616 nmdc:mga0sz30_2087_c1 3300050516 Bacteria 7140
617 nmdc:mga0sz30_28612_c1 3300050516 Bacteria 2294
618 nmdc:mga0sz30_29961_c1 3300050516 Bacteria 2246
619 nmdc:mga0sz30_36134_c1 3300050516 Bacteria 2064
620 nmdc:mga0sz30_461025_c1 3300050516 Bacteria 571
621 nmdc:mga0sz30_496142_c1 3300050516 Bacteria 549
622 Ga0495655_0074573 3300053083 Bacteria 956
623 Ga0495619_0037475 3300053085 Bacteria 3160
624 Ga0500641_0177028 3300053096 Bacteria 917
625 Ga0500561_0295419 3300053137 Bacteria 516
626 Ga0500568_0142018 3300053139 Bacteria 890
627 Ga0500588_0146165 3300053146 Bacteria 852
628 Ga0500604_0139072 3300053151 Bacteria 820
629 Ga0500627_0104692 3300053158 Bacteria 1272
630 Ga0500645_000181 3300053730 Bacteria 49626
631 Ga0466962_0002172 3300061719 Bacteria 9275
632 Ga0466962_0024421 3300061719 Bacteria 2903

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300047472 Ga0495686_0000940 Ga0495686_0000940_10304_10564 75
2 3300048929 Ga0496126_0535744 Ga0496126_0535744_114_374 75
3 3300041509 Ga0451843_0586096 Ga0451843_0586096_225_542 81
4 3300006051 Ga0075364_10101347 Ga0075364_101013472 83
5 3300049742 Ga0501080_0085313 Ga0501080_0085313_2651_2923 85
6 3300005563 Ga0068855_100138771 Ga0068855_1001387712 86
7 3300006038 Ga0075365_10972940 Ga0075365_109729402 86
8 3300006186 Ga0075369_10031965 Ga0075369_100319652 86
9 3300009092 Ga0105250_10546821 Ga0105250_105468212 86
10 3300009093 Ga0105240_10664010 Ga0105240_106640102 86
11 3300009098 Ga0105245_10002923 Ga0105245_100029238 86
12 3300009101 Ga0105247_10005571 Ga0105247_100055715 86
13 3300009148 Ga0105243_10002003 Ga0105243_100020036 86
14 3300009174 Ga0105241_10048224 Ga0105241_100482243 86
15 3300009176 Ga0105242_10000979 Ga0105242_1000097917 86
16 3300009177 Ga0105248_10011464 Ga0105248_100114643 86
17 3300009545 Ga0105237_10020056 Ga0105237_100200567 86
18 3300009553 Ga0105249_10001158 Ga0105249_1000115810 86
19 3300010375 Ga0105239_10026074 Ga0105239_100260743 86
20 3300013102 Ga0157371_10257777 Ga0157371_102577772 86
21 3300013296 Ga0157374_10794436 Ga0157374_107944362 86
22 3300013297 Ga0157378_10002180 Ga0157378_1000218018 86
23 3300013306 Ga0163162_10006763 Ga0163162_100067638 86
24 3300013307 Ga0157372_10007056 Ga0157372_100070567 86
25 3300013308 Ga0157375_10000151 Ga0157375_1000015157 86
26 3300014326 Ga0157380_10008689 Ga0157380_100086895 86
27 3300014745 Ga0157377_10047941 Ga0157377_100479412 86
28 3300014968 Ga0157379_10006897 Ga0157379_1000689710 86
29 3300021388 Ga0213875_10015301 Ga0213875_100153014 86
30 3300025303 Ga0209051_1058610 Ga0209051_10586102 86
31 3300025929 Ga0207664_10181617 Ga0207664_101816172 86
32 3300034817 Ga0373948_0058465 Ga0373948_0058465_118_393 86
33 3300035115 Ga0373941_0134358 Ga0373941_0134358_524_799 86
34 3300035691 Ga0373931_0102713 Ga0373931_0102713_1185_1460 86
35 3300035691 Ga0373931_0911514 Ga0373931_0911514_18_293 86
36 3300037853 Ga0436364_0069881 Ga0436364_0069881_1733_2032 86
37 3300039437 Ga0436365_1664352 Ga0436365_1664352_129_428 86
38 3300041456 Ga0451795_1283116 Ga0451795_1283116_88_375 86
39 3300046460 Ga0495638_0006703 Ga0495638_0006703_6826_7122 86
40 3300048091 Ga0495626_0168880 Ga0495626_0168880_222_518 86
41 3300048903 Ga0496100_0001254 Ga0496100_0001254_5148_5423 86
42 3300048904 Ga0496101_0003852 Ga0496101_0003852_1139_1414 86
43 3300048905 Ga0496102_0002086 Ga0496102_0002086_13913_14188 86
44 3300048906 Ga0496103_0000991 Ga0496103_0000991_12316_12591 86
45 3300048909 Ga0496106_0001129 Ga0496106_0001129_11673_11948 86
46 3300048910 Ga0496107_0000495 Ga0496107_0000495_11225_11500 86
47 3300048917 Ga0496114_0000419 Ga0496114_0000419_7116_7391 86
48 3300048918 Ga0496115_0090795 Ga0496115_0090795_1898_2173 86
49 3300048924 Ga0496121_0265820 Ga0496121_0265820_360_644 86
50 3300049579 Ga0501043_0691279 Ga0501043_0691279_296_580 86
51 3300050491 nmdc:mga00v17_287505_c1 nmdc:mga00v17_287505_c1_722_1018 86
52 3300050516 nmdc:mga0sz30_29961_c1 nmdc:mga0sz30_29961_c1_155_451 86
53 3300053139 Ga0500568_0142018 Ga0500568_0142018_388_672 86
54 3300053146 Ga0500588_0146165 Ga0500588_0146165_318_602 86
55 3300053158 Ga0500627_0104692 Ga0500627_0104692_851_1135 86
56 iso_pu_bacteria 2738541274 2738707877 86
57 iso_pu_bacteria 2738543028 2739334216 86
58 iso_pu_bacteria 2842134933 2842140111 86
59 iso_pu_bacteria 2902799365 2902802046 86
60 3300044706 Ga0466964_0506255 Ga0466964_0506255_55_366 87
61 3300045976 Ga0466967_0812045 Ga0466967_0812045_567_878 87
62 3300048916 Ga0496113_0505642 Ga0496113_0505642_628_927 87
63 3300048917 Ga0496114_0929404 Ga0496114_0929404_442_741 87
64 3300048925 Ga0496122_0434412 Ga0496122_0434412_20_319 87
65 3300048928 Ga0496125_0306839 Ga0496125_0306839_421_720 87
66 3300048929 Ga0496126_0169877 Ga0496126_0169877_963_1262 87
67 3300050516 nmdc:mga0sz30_36134_c1 nmdc:mga0sz30_36134_c1_1305_1604 87
68 3300053730 Ga0500645_000181 Ga0500645_000181_45884_46183 87
69 3300041456 Ga0451795_1417478 Ga0451795_1417478_102_389 90
70 iso_pu_bacteria 2929212328 2929216752 90
71 3300045976 Ga0466967_0366997 Ga0466967_0366997_775_1077 91
72 3300005842 Ga0068858_101273536 Ga0068858_1012735362 92
73 3300005981 Ga0081538_10141284 Ga0081538_101412842 92
74 3300005981 Ga0081538_10166467 Ga0081538_101664672 92
75 3300006048 Ga0075363_100397858 Ga0075363_1003978582 92
76 3300006051 Ga0075364_10030170 Ga0075364_100301702 92
77 3300006175 Ga0070712_100310972 Ga0070712_1003109722 92
78 3300006177 Ga0075362_10086811 Ga0075362_100868112 92
79 3300006178 Ga0075367_10736444 Ga0075367_107364442 92
80 3300006186 Ga0075369_10000460 Ga0075369_1000046015 92
81 3300006844 Ga0075428_102346536 Ga0075428_1023465362 92
82 3300013296 Ga0157374_11060681 Ga0157374_110606812 92
83 3300021377 Ga0213874_10011311 Ga0213874_100113112 92
84 3300025303 Ga0209051_1000011 Ga0209051_1000011410 92
85 3300025915 Ga0207693_10176392 Ga0207693_101763922 92
86 3300031251 Ga0265327_10001674 Ga0265327_1000167413 92
87 3300031852 Ga0307410_10617173 Ga0307410_106171732 92
88 3300031911 Ga0307412_10545127 Ga0307412_105451272 92
89 3300031995 Ga0307409_100064748 Ga0307409_1000647483 92
90 3300031995 Ga0307409_100189140 Ga0307409_1001891401 92
91 3300032126 Ga0307415_100544484 Ga0307415_1005444841 92
92 3300039450 Ga0436363_1397604 Ga0436363_1397604_3524_3829 92
93 3300041410 Ga0439461_0017051 Ga0439461_0017051_669_962 92
94 3300041411 Ga0439466_0007599 Ga0439466_0007599_3142_3435 92
95 3300041413 Ga0439465_0007860 Ga0439465_0007860_873_1166 92
96 3300041997 Ga0439431_0020797 Ga0439431_0020797_1212_1505 92
97 3300042004 Ga0439445_0047838 Ga0439445_0047838_570_863 92
98 3300044658 Ga0466972_0092635 Ga0466972_0092635_348_653 92
99 3300044683 Ga0466965_0025575 Ga0466965_0025575_1378_1683 92
100 3300044684 Ga0466966_0144880 Ga0466966_0144880_953_1258 92
101 3300044693 Ga0466961_0055822 Ga0466961_0055822_1002_1307 92
102 3300044706 Ga0466964_0156680 Ga0466964_0156680_689_994 92
103 3300044735 Ga0466968_0076993 Ga0466968_0076993_187_492 92
104 3300044735 Ga0466968_0570719 Ga0466968_0570719_93_398 92
105 3300044765 Ga0466970_0486668 Ga0466970_0486668_80_385 92
106 3300044765 Ga0466970_0676868 Ga0466970_0676868_283_579 92
107 3300044842 Ga0466957_0163064 Ga0466957_0163064_37_342 92
108 3300044842 Ga0466957_1150119 Ga0466957_1150119_217_522 92
109 3300045836 Ga0466958_0092797 Ga0466958_0092797_248_553 92
110 3300045976 Ga0466967_0002447 Ga0466967_0002447_5583_5879 92
111 3300050489 nmdc:mga03683_98788_c1 nmdc:mga03683_98788_c1_74_367 92
112 3300050490 nmdc:mga03n38_41790_c1 nmdc:mga03n38_41790_c1_390_683 92
113 3300050491 nmdc:mga00v17_24459_c1 nmdc:mga00v17_24459_c1_2918_3211 92
114 3300050492 nmdc:mga0yw44_212413_c1 nmdc:mga0yw44_212413_c1_513_806 92
115 3300050494 nmdc:mga06z11_152360_c1 nmdc:mga06z11_152360_c1_252_545 92
116 3300050516 nmdc:mga0sz30_2087_c1 nmdc:mga0sz30_2087_c1_3945_4238 92
117 3300061719 Ga0466962_0002172 Ga0466962_0002172_440_745 92
118 3300002070 JGI24750J21931_1019345 JGI24750J21931_10193452 93
119 3300002239 JGI24034J26672_10024535 JGI24034J26672_100245352 93
120 3300005336 Ga0070680_100693416 Ga0070680_1006934162 93
121 3300005347 Ga0070668_100162368 Ga0070668_1001623682 93
122 3300005355 Ga0070671_100153639 Ga0070671_1001536392 93
123 3300005355 Ga0070671_100979154 Ga0070671_1009791541 93
124 3300005367 Ga0070667_100111791 Ga0070667_1001117913 93
125 3300005367 Ga0070667_100212532 Ga0070667_1002125322 93
126 3300005367 Ga0070667_100594535 Ga0070667_1005945352 93
127 3300005367 Ga0070667_100687616 Ga0070667_1006876162 93
128 3300005435 Ga0070714_100656632 Ga0070714_1006566321 93
129 3300005435 Ga0070714_100797076 Ga0070714_1007970761 93
130 3300005468 Ga0070707_100637624 Ga0070707_1006376242 93
131 3300005544 Ga0070686_100106006 Ga0070686_1001060062 93
132 3300005548 Ga0070665_100011478 Ga0070665_1000114782 93
133 3300005548 Ga0070665_100383979 Ga0070665_1003839792 93
134 3300005548 Ga0070665_101371986 Ga0070665_1013719862 93
135 3300005617 Ga0068859_100751308 Ga0068859_1007513081 93
136 3300005719 Ga0068861_100783892 Ga0068861_1007838922 93
137 3300005841 Ga0068863_100436395 Ga0068863_1004363952 93
138 3300005842 Ga0068858_100581825 Ga0068858_1005818252 93
139 3300005843 Ga0068860_100166994 Ga0068860_1001669942 93
140 3300005843 Ga0068860_100433987 Ga0068860_1004339872 93
141 3300005843 Ga0068860_101259973 Ga0068860_1012599731 93
142 3300005844 Ga0068862_100988847 Ga0068862_1009888472 93
143 3300006028 Ga0070717_10523600 Ga0070717_105236001 93
144 3300006038 Ga0075365_10022376 Ga0075365_100223762 93
145 3300006038 Ga0075365_10047244 Ga0075365_100472442 93
146 3300006048 Ga0075363_100000791 Ga0075363_1000007912 93
147 3300006048 Ga0075363_100008208 Ga0075363_1000082085 93
148 3300006051 Ga0075364_10011854 Ga0075364_100118542 93
149 3300006051 Ga0075364_10017218 Ga0075364_100172184 93
150 3300006051 Ga0075364_10272700 Ga0075364_102727002 93
151 3300006058 Ga0075432_10539264 Ga0075432_105392642 93
152 3300006177 Ga0075362_10031819 Ga0075362_100318192 93
153 3300006178 Ga0075367_10205824 Ga0075367_102058242 93
154 3300006186 Ga0075369_10015929 Ga0075369_100159293 93
155 3300006186 Ga0075369_10031496 Ga0075369_100314963 93
156 3300006353 Ga0075370_10008394 Ga0075370_100083946 93
157 3300006844 Ga0075428_100000149 Ga0075428_10000014927 93
158 3300006846 Ga0075430_100004305 Ga0075430_1000043052 93
159 3300006847 Ga0075431_100128400 Ga0075431_1001284002 93
160 3300006931 Ga0097620_100751261 Ga0097620_1007512611 93
161 3300009092 Ga0105250_10062864 Ga0105250_100628642 93
162 3300009101 Ga0105247_10624379 Ga0105247_106243792 93
163 3300009147 Ga0114129_10033330 Ga0114129_100333302 93
164 3300009177 Ga0105248_10274560 Ga0105248_102745602 93
165 3300009551 Ga0105238_10742063 Ga0105238_107420632 93
166 3300009553 Ga0105249_10123159 Ga0105249_101231592 93
167 3300011119 Ga0105246_11307745 Ga0105246_113077451 93
168 3300013306 Ga0163162_12027468 Ga0163162_120274682 93
169 3300013308 Ga0157375_10028740 Ga0157375_100287406 93
170 3300014325 Ga0163163_10350897 Ga0163163_103508972 93
171 3300014968 Ga0157379_10403877 Ga0157379_104038772 93
172 3300021384 Ga0213876_10000674 Ga0213876_1000067416 93
173 3300021384 Ga0213876_10013547 Ga0213876_100135472 93
174 3300021384 Ga0213876_10041514 Ga0213876_100415144 93
175 3300021388 Ga0213875_10023757 Ga0213875_100237574 93
176 3300025901 Ga0207688_10276616 Ga0207688_102766162 93
177 3300025903 Ga0207680_10864366 Ga0207680_108643662 93
178 3300025929 Ga0207664_10753985 Ga0207664_107539851 93
179 3300025961 Ga0207712_10188585 Ga0207712_101885852 93
180 3300025972 Ga0207668_10092024 Ga0207668_100920242 93
181 3300025986 Ga0207658_10007427 Ga0207658_100074277 93
182 3300025986 Ga0207658_10501793 Ga0207658_105017932 93
183 3300025986 Ga0207658_10966060 Ga0207658_109660602 93
184 3300026035 Ga0207703_10376879 Ga0207703_103768791 93
185 3300026088 Ga0207641_10246696 Ga0207641_102466962 93
186 3300026118 Ga0207675_100368408 Ga0207675_1003684082 93
187 3300026121 Ga0207683_10535077 Ga0207683_105350772 93
188 3300027907 Ga0207428_10698707 Ga0207428_106987072 93
189 3300028380 Ga0268265_10452801 Ga0268265_104528012 93
190 3300028381 Ga0268264_10231025 Ga0268264_102310252 93
191 3300028381 Ga0268264_10401514 Ga0268264_104015142 93
192 3300032126 Ga0307415_101891387 Ga0307415_1018913872 93
193 3300037418 Ga0395900_1037395 Ga0395900_1037395_274_579 93
194 3300037853 Ga0436364_1184081 Ga0436364_1184081_2576_2884 93
195 3300039437 Ga0436365_0016980 Ga0436365_0016980_9711_10007 93
196 3300039437 Ga0436365_0105619 Ga0436365_0105619_462_770 93
197 3300039437 Ga0436365_0119240 Ga0436365_0119240_7877_8185 93
198 3300039437 Ga0436365_1625921 Ga0436365_1625921_2243_2539 93
199 3300039450 Ga0436363_0736099 Ga0436363_0736099_518_814 93
200 3300039450 Ga0436363_1120337 Ga0436363_1120337_743_1051 93
201 3300039453 Ga0436362_0172575 Ga0436362_0172575_444_752 93
202 3300039453 Ga0436362_0722193 Ga0436362_0722193_505_813 93
203 3300044658 Ga0466972_0051302 Ga0466972_0051302_1220_1525 93
204 3300044684 Ga0466966_0049549 Ga0466966_0049549_903_1202 93
205 3300044693 Ga0466961_0010397 Ga0466961_0010397_3853_4152 93
206 3300044694 Ga0466963_0088041 Ga0466963_0088041_1782_2078 93
207 3300044694 Ga0466963_0094907 Ga0466963_0094907_40_336 93
208 3300044694 Ga0466963_0220747 Ga0466963_0220747_836_1132 93
209 3300044719 Ga0466971_0084172 Ga0466971_0084172_709_1017 93
210 3300044719 Ga0466971_0202708 Ga0466971_0202708_131_430 93
211 3300044719 Ga0466971_0712499 Ga0466971_0712499_77_373 93
212 3300044735 Ga0466968_0010864 Ga0466968_0010864_3050_3355 93
213 3300044842 Ga0466957_0031391 Ga0466957_0031391_973_1269 93
214 3300044842 Ga0466957_0123033 Ga0466957_0123033_1033_1329 93
215 3300044842 Ga0466957_0417272 Ga0466957_0417272_10_306 93
216 3300044901 Ga0466960_0001941 Ga0466960_0001941_4771_5067 93
217 3300044901 Ga0466960_0257482 Ga0466960_0257482_164_463 93
218 3300044901 Ga0466960_0723194 Ga0466960_0723194_133_429 93
219 3300045049 Ga0466959_0123552 Ga0466959_0123552_759_1058 93
220 3300045049 Ga0466959_0980425 Ga0466959_0980425_78_383 93
221 3300045836 Ga0466958_0071960 Ga0466958_0071960_390_689 93
222 3300045836 Ga0466958_0113751 Ga0466958_0113751_1269_1565 93
223 3300045836 Ga0466958_0952401 Ga0466958_0952401_243_539 93
224 3300045976 Ga0466967_0005640 Ga0466967_0005640_2819_3115 93
225 3300045976 Ga0466967_0007837 Ga0466967_0007837_1667_1963 93
226 3300045976 Ga0466967_0073050 Ga0466967_0073050_2028_2333 93
227 3300045976 Ga0466967_0539819 Ga0466967_0539819_731_1027 93
228 3300045976 Ga0466967_1804346 Ga0466967_1804346_106_411 93
229 3300045976 Ga0466967_2166569 Ga0466967_2166569_195_494 93
230 3300046507 Ga0495606_0515215 Ga0495606_0515215_10_306 93
231 3300046616 Ga0495668_0383720 Ga0495668_0383720_427_732 93
232 3300048903 Ga0496100_1342558 Ga0496100_1342558_179_484 93
233 3300048904 Ga0496101_0091634 Ga0496101_0091634_878_1174 93
234 3300048906 Ga0496103_0310789 Ga0496103_0310789_112_417 93
235 3300048907 Ga0496104_0737441 Ga0496104_0737441_528_833 93
236 3300048911 Ga0496108_0011021 Ga0496108_0011021_1091_1396 93
237 3300048912 Ga0496109_0048770 Ga0496109_0048770_2617_2922 93
238 3300048912 Ga0496109_0440102 Ga0496109_0440102_687_992 93
239 3300048913 Ga0496110_0270550 Ga0496110_0270550_704_1009 93
240 3300048915 Ga0496112_0008370 Ga0496112_0008370_1393_1698 93
241 3300048915 Ga0496112_0045591 Ga0496112_0045591_799_1095 93
242 3300048916 Ga0496113_0005415 Ga0496113_0005415_3345_3641 93
243 3300048916 Ga0496113_0067648 Ga0496113_0067648_2068_2373 93
244 3300048917 Ga0496114_1157047 Ga0496114_1157047_216_536 93
245 3300048918 Ga0496115_1412279 Ga0496115_1412279_207_503 93
246 3300048923 Ga0496120_0129904 Ga0496120_0129904_800_1096 93
247 3300048926 Ga0496123_0002306 Ga0496123_0002306_269_565 93
248 3300048929 Ga0496126_0004133 Ga0496126_0004133_4426_4722 93
249 3300048929 Ga0496126_0032421 Ga0496126_0032421_2706_3002 93
250 3300049568 Ga0501031_0240025 Ga0501031_0240025_154_450 93
251 3300049568 Ga0501031_0595519 Ga0501031_0595519_44_340 93
252 3300049569 Ga0501032_0036433 Ga0501032_0036433_1300_1596 93
253 3300049569 Ga0501032_0137596 Ga0501032_0137596_68_364 93
254 3300049570 Ga0501033_0006101 Ga0501033_0006101_2281_2577 93
255 3300049570 Ga0501033_0056622 Ga0501033_0056622_1646_1942 93
256 3300049570 Ga0501033_0243158 Ga0501033_0243158_301_597 93
257 3300049571 Ga0501034_0001987 Ga0501034_0001987_13492_13788 93
258 3300049571 Ga0501034_0464683 Ga0501034_0464683_207_503 93
259 3300049572 Ga0501036_0131897 Ga0501036_0131897_1119_1415 93
260 3300049573 Ga0501037_0028731 Ga0501037_0028731_2154_2450 93
261 3300049573 Ga0501037_0408522 Ga0501037_0408522_477_773 93
262 3300049579 Ga0501043_0015753 Ga0501043_0015753_2698_2994 93
263 3300049579 Ga0501043_0618976 Ga0501043_0618976_306_602 93
264 3300049580 Ga0501046_0004078 Ga0501046_0004078_5656_5952 93
265 3300049580 Ga0501046_0336643 Ga0501046_0336643_595_891 93
266 3300049581 Ga0501047_0001180 Ga0501047_0001180_6394_6690 93
267 3300049581 Ga0501047_0708088 Ga0501047_0708088_433_729 93
268 3300049582 Ga0501048_0047842 Ga0501048_0047842_268_564 93
269 3300049583 Ga0501067_0663368 Ga0501067_0663368_98_403 93
270 3300049585 Ga0501069_0361505 Ga0501069_0361505_194_490 93
271 3300049585 Ga0501069_0632952 Ga0501069_0632952_145_441 93
272 3300049586 Ga0501070_0001918 Ga0501070_0001918_5737_6033 93
273 3300049586 Ga0501070_0153243 Ga0501070_0153243_140_436 93
274 3300049586 Ga0501070_0699398 Ga0501070_0699398_205_501 93
275 3300049589 Ga0501073_0888277 Ga0501073_0888277_133_429 93
276 3300049822 Ga0501035_0000385 Ga0501035_0000385_13971_14267 93
277 3300049822 Ga0501035_0003413 Ga0501035_0003413_2414_2710 93
278 3300049822 Ga0501035_0069213 Ga0501035_0069213_1457_1753 93
279 3300049823 Ga0501044_0001111 Ga0501044_0001111_2367_2663 93
280 3300049823 Ga0501044_0012026 Ga0501044_0012026_1691_1987 93
281 3300049823 Ga0501044_0338488 Ga0501044_0338488_264_560 93
282 3300050489 nmdc:mga03683_44298_c1 nmdc:mga03683_44298_c1_934_1239 93
283 3300050490 nmdc:mga03n38_1616_c1 nmdc:mga03n38_1616_c1_1130_1426 93
284 3300050490 nmdc:mga03n38_6020_c1 nmdc:mga03n38_6020_c1_3801_4106 93
285 3300050491 nmdc:mga00v17_1224_c1 nmdc:mga00v17_1224_c1_10730_11026 93
286 3300050491 nmdc:mga00v17_357839_c1 nmdc:mga00v17_357839_c1_315_608 93
287 3300050491 nmdc:mga00v17_38056_c1 nmdc:mga00v17_38056_c1_1356_1661 93
288 3300050492 nmdc:mga0yw44_5588_c1 nmdc:mga0yw44_5588_c1_2985_3290 93
289 3300050492 nmdc:mga0yw44_92961_c1 nmdc:mga0yw44_92961_c1_1286_1582 93
290 3300050494 nmdc:mga06z11_175482_c1 nmdc:mga06z11_175482_c1_858_1163 93
291 3300050494 nmdc:mga06z11_854449_c1 nmdc:mga06z11_854449_c1_205_510 93
292 3300050495 nmdc:mga04h51_36143_c1 nmdc:mga04h51_36143_c1_453_758 93
293 3300050496 nmdc:mga07m45_684_c2 nmdc:mga07m45_684_c2_6950_7246 93
294 3300050507 nmdc:mga05p37_7689_c2 nmdc:mga05p37_7689_c2_1434_1739 93
295 3300050509 nmdc:mga0qj67_3049_c1 nmdc:mga0qj67_3049_c1_334_639 93
296 3300050510 nmdc:mga06r32_117924_c1 nmdc:mga06r32_117924_c1_313_618 93
297 3300050516 nmdc:mga0sz30_1490_c2 nmdc:mga0sz30_1490_c2_4526_4822 93
298 3300050516 nmdc:mga0sz30_1947_c1 nmdc:mga0sz30_1947_c1_97_402 93
299 3300061719 Ga0466962_0024421 Ga0466962_0024421_2527_2835 93
300 3300000545 CNXas_1010893 CNXas_10108932 94
301 3300001990 JGI24737J22298_10025242 JGI24737J22298_100252422 94
302 3300001990 JGI24737J22298_10061817 JGI24737J22298_100618172 94
303 3300001991 JGI24743J22301_10001574 JGI24743J22301_100015744 94
304 3300002070 JGI24750J21931_1004851 JGI24750J21931_10048512 94
305 3300002073 JGI24745J21846_1007131 JGI24745J21846_10071312 94
306 3300002074 JGI24748J21848_1057785 JGI24748J21848_10577852 94
307 3300002075 JGI24738J21930_10013020 JGI24738J21930_100130202 94
308 3300002075 JGI24738J21930_10110247 JGI24738J21930_101102472 94
309 3300005328 Ga0070676_10145981 Ga0070676_101459812 94
310 3300005330 Ga0070690_100006335 Ga0070690_1000063358 94
311 3300005333 Ga0070677_10164421 Ga0070677_101644212 94
312 3300005334 Ga0068869_100044467 Ga0068869_1000444673 94
313 3300005335 Ga0070666_10129144 Ga0070666_101291442 94
314 3300005337 Ga0070682_100021569 Ga0070682_1000215692 94
315 3300005338 Ga0068868_100001175 Ga0068868_1000011758 94
316 3300005338 Ga0068868_100008132 Ga0068868_1000081323 94
317 3300005340 Ga0070689_100193339 Ga0070689_1001933392 94
318 3300005341 Ga0070691_10002313 Ga0070691_100023132 94
319 3300005343 Ga0070687_100010588 Ga0070687_1000105885 94
320 3300005347 Ga0070668_100001742 Ga0070668_1000017425 94
321 3300005353 Ga0070669_100028149 Ga0070669_1000281494 94
322 3300005353 Ga0070669_100085651 Ga0070669_1000856512 94
323 3300005354 Ga0070675_100059181 Ga0070675_1000591813 94
324 3300005355 Ga0070671_100095424 Ga0070671_1000954243 94
325 3300005356 Ga0070674_100000563 Ga0070674_1000005638 94
326 3300005356 Ga0070674_100067024 Ga0070674_1000670242 94
327 3300005364 Ga0070673_100156894 Ga0070673_1001568941 94
328 3300005365 Ga0070688_100003575 Ga0070688_1000035756 94
329 3300005366 Ga0070659_100050166 Ga0070659_1000501663 94
330 3300005367 Ga0070667_100006165 Ga0070667_1000061655 94
331 3300005406 Ga0070703_10051976 Ga0070703_100519761 94
332 3300005434 Ga0070709_10018035 Ga0070709_100180352 94
333 3300005435 Ga0070714_100268680 Ga0070714_1002686802 94
334 3300005437 Ga0070710_10001265 Ga0070710_100012655 94
335 3300005438 Ga0070701_10007816 Ga0070701_100078162 94
336 3300005439 Ga0070711_100000861 Ga0070711_10000086110 94
337 3300005441 Ga0070700_100003148 Ga0070700_1000031488 94
338 3300005441 Ga0070700_100195649 Ga0070700_1001956492 94
339 3300005444 Ga0070694_100001137 Ga0070694_1000011373 94
340 3300005444 Ga0070694_101735054 Ga0070694_1017350542 94
341 3300005456 Ga0070678_100001636 Ga0070678_1000016362 94
342 3300005456 Ga0070678_100240101 Ga0070678_1002401012 94
343 3300005456 Ga0070678_101508923 Ga0070678_1015089232 94
344 3300005457 Ga0070662_100177256 Ga0070662_1001772562 94
345 3300005459 Ga0068867_100000117 Ga0068867_10000011736 94
346 3300005466 Ga0070685_10047141 Ga0070685_100471412 94
347 3300005466 Ga0070685_10183191 Ga0070685_101831912 94
348 3300005466 Ga0070685_11436691 Ga0070685_114366912 94
349 3300005530 Ga0070679_100404325 Ga0070679_1004043252 94
350 3300005535 Ga0070684_101980851 Ga0070684_1019808512 94
351 3300005539 Ga0068853_100002723 Ga0068853_10000272310 94
352 3300005543 Ga0070672_100106676 Ga0070672_1001066763 94
353 3300005544 Ga0070686_101954020 Ga0070686_1019540201 94
354 3300005546 Ga0070696_100005500 Ga0070696_1000055002 94
355 3300005547 Ga0070693_100007978 Ga0070693_1000079782 94
356 3300005548 Ga0070665_100027250 Ga0070665_1000272506 94
357 3300005548 Ga0070665_100046080 Ga0070665_1000460803 94
358 3300005549 Ga0070704_100000959 Ga0070704_10000095912 94
359 3300005549 Ga0070704_101108720 Ga0070704_1011087202 94
360 3300005578 Ga0068854_100000583 Ga0068854_10000058322 94
361 3300005614 Ga0068856_101291651 Ga0068856_1012916512 94
362 3300005615 Ga0070702_100000286 Ga0070702_10000028616 94
363 3300005616 Ga0068852_100172433 Ga0068852_1001724332 94
364 3300005616 Ga0068852_100414733 Ga0068852_1004147332 94
365 3300005617 Ga0068859_100001965 Ga0068859_1000019657 94
366 3300005617 Ga0068859_100218349 Ga0068859_1002183492 94
367 3300005617 Ga0068859_100261796 Ga0068859_1002617962 94
368 3300005718 Ga0068866_10000573 Ga0068866_1000057313 94
369 3300005718 Ga0068866_10037642 Ga0068866_100376422 94
370 3300005719 Ga0068861_100000507 Ga0068861_10000050710 94
371 3300005719 Ga0068861_100073514 Ga0068861_1000735142 94
372 3300005834 Ga0068851_10276985 Ga0068851_102769852 94
373 3300005840 Ga0068870_10169290 Ga0068870_101692902 94
374 3300005841 Ga0068863_100013142 Ga0068863_1000131429 94
375 3300005842 Ga0068858_100009407 Ga0068858_1000094077 94
376 3300005842 Ga0068858_100202546 Ga0068858_1002025462 94
377 3300005843 Ga0068860_100003792 Ga0068860_1000037927 94
378 3300005843 Ga0068860_100096383 Ga0068860_1000963832 94
379 3300005844 Ga0068862_100006603 Ga0068862_1000066036 94
380 3300005844 Ga0068862_100262096 Ga0068862_1002620962 94
381 3300005844 Ga0068862_100352947 Ga0068862_1003529472 94
382 3300005937 Ga0081455_10086958 Ga0081455_100869582 94
383 3300006038 Ga0075365_10029962 Ga0075365_100299622 94
384 3300006038 Ga0075365_10178581 Ga0075365_101785812 94
385 3300006042 Ga0075368_10190061 Ga0075368_101900612 94
386 3300006048 Ga0075363_100009271 Ga0075363_1000092712 94
387 3300006048 Ga0075363_100014948 Ga0075363_1000149486 94
388 3300006048 Ga0075363_100102581 Ga0075363_1001025812 94
389 3300006048 Ga0075363_100203738 Ga0075363_1002037382 94
390 3300006048 Ga0075363_100313673 Ga0075363_1003136732 94
391 3300006048 Ga0075363_100322409 Ga0075363_1003224092 94
392 3300006048 Ga0075363_100645556 Ga0075363_1006455562 94
393 3300006051 Ga0075364_10003160 Ga0075364_100031604 94
394 3300006051 Ga0075364_10034481 Ga0075364_100344812 94
395 3300006051 Ga0075364_10195470 Ga0075364_101954702 94
396 3300006163 Ga0070715_10014293 Ga0070715_100142934 94
397 3300006173 Ga0070716_100015321 Ga0070716_1000153212 94
398 3300006173 Ga0070716_100785512 Ga0070716_1007855122 94
399 3300006175 Ga0070712_100002997 Ga0070712_1000029975 94
400 3300006175 Ga0070712_100333214 Ga0070712_1003332142 94
401 3300006177 Ga0075362_10010473 Ga0075362_100104733 94
402 3300006177 Ga0075362_10062103 Ga0075362_100621032 94
403 3300006177 Ga0075362_10463495 Ga0075362_104634951 94
404 3300006178 Ga0075367_10084486 Ga0075367_100844862 94
405 3300006178 Ga0075367_10120367 Ga0075367_101203672 94
406 3300006178 Ga0075367_10528321 Ga0075367_105283212 94
407 3300006186 Ga0075369_10051105 Ga0075369_100511052 94
408 3300006186 Ga0075369_10147381 Ga0075369_101473812 94
409 3300006186 Ga0075369_10157597 Ga0075369_101575972 94
410 3300006186 Ga0075369_10340299 Ga0075369_103402992 94
411 3300006195 Ga0075366_10066310 Ga0075366_100663102 94
412 3300006353 Ga0075370_10012155 Ga0075370_100121556 94
413 3300006353 Ga0075370_10013436 Ga0075370_100134364 94
414 3300006353 Ga0075370_10033080 Ga0075370_100330803 94
415 3300006353 Ga0075370_10326544 Ga0075370_103265442 94
416 3300006353 Ga0075370_10339877 Ga0075370_103398771 94
417 3300006353 Ga0075370_10865429 Ga0075370_108654291 94
418 3300006846 Ga0075430_100103183 Ga0075430_1001031832 94
419 3300006881 Ga0068865_100007593 Ga0068865_1000075935 94
420 3300006881 Ga0068865_100372737 Ga0068865_1003727372 94
421 3300006931 Ga0097620_100001965 Ga0097620_1000019657 94
422 3300006931 Ga0097620_100218363 Ga0097620_1002183632 94
423 3300006931 Ga0097620_100261791 Ga0097620_1002617912 94
424 3300009092 Ga0105250_10027932 Ga0105250_100279322 94
425 3300009094 Ga0111539_10180160 Ga0111539_101801602 94
426 3300009098 Ga0105245_10001561 Ga0105245_1000156118 94
427 3300009101 Ga0105247_10912751 Ga0105247_109127512 94
428 3300009174 Ga0105241_10558900 Ga0105241_105589002 94
429 3300009174 Ga0105241_10652139 Ga0105241_106521392 94
430 3300009176 Ga0105242_11654231 Ga0105242_116542312 94
431 3300009176 Ga0105242_11695093 Ga0105242_116950932 94
432 3300009545 Ga0105237_10130252 Ga0105237_101302522 94
433 3300009553 Ga0105249_10026757 Ga0105249_100267575 94
434 3300010375 Ga0105239_10173105 Ga0105239_101731052 94
435 3300011119 Ga0105246_10435318 Ga0105246_104353182 94
436 3300011119 Ga0105246_10526834 Ga0105246_105268342 94
437 3300011119 Ga0105246_10946714 Ga0105246_109467142 94
438 3300013296 Ga0157374_10007794 Ga0157374_100077946 94
439 3300013297 Ga0157378_10504492 Ga0157378_105044922 94
440 3300013306 Ga0163162_10089548 Ga0163162_100895482 94
441 3300013306 Ga0163162_10398058 Ga0163162_103980582 94
442 3300013306 Ga0163162_11468939 Ga0163162_114689392 94
443 3300013308 Ga0157375_10102500 Ga0157375_101025002 94
444 3300014325 Ga0163163_10542803 Ga0163163_105428032 94
445 3300014325 Ga0163163_10899024 Ga0163163_108990242 94
446 3300014326 Ga0157380_10564538 Ga0157380_105645382 94
447 3300014745 Ga0157377_10023317 Ga0157377_100233175 94
448 3300014968 Ga0157379_10206471 Ga0157379_102064712 94
449 3300017792 Ga0163161_10002439 Ga0163161_1000243914 94
450 3300017792 Ga0163161_10153271 Ga0163161_101532712 94
451 3300025711 Ga0207696_1075485 Ga0207696_10754852 94
452 3300025885 Ga0207653_10127458 Ga0207653_101274582 94
453 3300025893 Ga0207682_10074748 Ga0207682_100747483 94
454 3300025898 Ga0207692_10006178 Ga0207692_100061785 94
455 3300025899 Ga0207642_10002544 Ga0207642_100025442 94
456 3300025899 Ga0207642_10034825 Ga0207642_100348252 94
457 3300025900 Ga0207710_10009664 Ga0207710_100096645 94
458 3300025900 Ga0207710_10205019 Ga0207710_102050192 94
459 3300025901 Ga0207688_10000025 Ga0207688_1000002536 94
460 3300025901 Ga0207688_10038428 Ga0207688_100384282 94
461 3300025903 Ga0207680_10148925 Ga0207680_101489252 94
462 3300025904 Ga0207647_10094050 Ga0207647_100940502 94
463 3300025904 Ga0207647_10752579 Ga0207647_107525791 94
464 3300025906 Ga0207699_10006989 Ga0207699_100069893 94
465 3300025907 Ga0207645_10090677 Ga0207645_100906772 94
466 3300025908 Ga0207643_10173066 Ga0207643_101730662 94
467 3300025911 Ga0207654_10025370 Ga0207654_100253703 94
468 3300025913 Ga0207695_10796547 Ga0207695_107965472 94
469 3300025914 Ga0207671_10019240 Ga0207671_100192402 94
470 3300025914 Ga0207671_10076992 Ga0207671_100769922 94
471 3300025915 Ga0207693_10000123 Ga0207693_1000012340 94
472 3300025916 Ga0207663_10760543 Ga0207663_107605432 94
473 3300025918 Ga0207662_10031759 Ga0207662_100317593 94
474 3300025923 Ga0207681_10011516 Ga0207681_100115165 94
475 3300025923 Ga0207681_10205015 Ga0207681_102050152 94
476 3300025927 Ga0207687_10005259 Ga0207687_100052592 94
477 3300025931 Ga0207644_10023474 Ga0207644_100234742 94
478 3300025931 Ga0207644_10059568 Ga0207644_100595684 94
479 3300025931 Ga0207644_10466744 Ga0207644_104667442 94
480 3300025932 Ga0207690_10032613 Ga0207690_100326134 94
481 3300025933 Ga0207706_10008057 Ga0207706_1000805710 94
482 3300025934 Ga0207686_10001243 Ga0207686_1000124311 94
483 3300025934 Ga0207686_10219572 Ga0207686_102195722 94
484 3300025934 Ga0207686_11008968 Ga0207686_110089682 94
485 3300025935 Ga0207709_10021107 Ga0207709_100211071 94
486 3300025935 Ga0207709_10405880 Ga0207709_104058802 94
487 3300025936 Ga0207670_10192611 Ga0207670_101926112 94
488 3300025937 Ga0207669_10000400 Ga0207669_1000040013 94
489 3300025937 Ga0207669_10110722 Ga0207669_101107222 94
490 3300025938 Ga0207704_10000325 Ga0207704_1000032519 94
491 3300025939 Ga0207665_10008251 Ga0207665_100082513 94
492 3300025940 Ga0207691_10293078 Ga0207691_102930782 94
493 3300025942 Ga0207689_10029664 Ga0207689_100296644 94
494 3300025960 Ga0207651_10887092 Ga0207651_108870921 94
495 3300025960 Ga0207651_11768583 Ga0207651_117685832 94
496 3300025961 Ga0207712_10006113 Ga0207712_100061134 94
497 3300025961 Ga0207712_10047263 Ga0207712_100472632 94
498 3300025972 Ga0207668_10010813 Ga0207668_100108133 94
499 3300025972 Ga0207668_11307170 Ga0207668_113071702 94
500 3300025981 Ga0207640_10000582 Ga0207640_100005828 94
501 3300025986 Ga0207658_10003640 Ga0207658_100036404 94
502 3300025986 Ga0207658_10294193 Ga0207658_102941932 94
503 3300026023 Ga0207677_10009499 Ga0207677_100094995 94
504 3300026023 Ga0207677_10046075 Ga0207677_100460753 94
505 3300026035 Ga0207703_10005075 Ga0207703_100050758 94
506 3300026035 Ga0207703_10118513 Ga0207703_101185133 94
507 3300026035 Ga0207703_10206777 Ga0207703_102067772 94
508 3300026067 Ga0207678_10006722 Ga0207678_100067229 94
509 3300026075 Ga0207708_10000452 Ga0207708_1000045232 94
510 3300026075 Ga0207708_10052844 Ga0207708_100528442 94
511 3300026078 Ga0207702_10155061 Ga0207702_101550612 94
512 3300026088 Ga0207641_10008652 Ga0207641_100086529 94
513 3300026088 Ga0207641_10376915 Ga0207641_103769153 94
514 3300026088 Ga0207641_10604433 Ga0207641_106044332 94
515 3300026089 Ga0207648_10000381 Ga0207648_1000038119 94
516 3300026095 Ga0207676_12163036 Ga0207676_121630362 94
517 3300026118 Ga0207675_100000406 Ga0207675_10000040610 94
518 3300026118 Ga0207675_100177317 Ga0207675_1001773172 94
519 3300026121 Ga0207683_10001482 Ga0207683_1000148222 94
520 3300026142 Ga0207698_10107473 Ga0207698_101074733 94
521 3300026142 Ga0207698_10195168 Ga0207698_101951682 94
522 3300028379 Ga0268266_10008853 Ga0268266_100088532 94
523 3300028379 Ga0268266_10042708 Ga0268266_100427084 94
524 3300028380 Ga0268265_10011038 Ga0268265_100110385 94
525 3300028380 Ga0268265_10036750 Ga0268265_100367505 94
526 3300028380 Ga0268265_10086292 Ga0268265_100862922 94
527 3300028381 Ga0268264_10009176 Ga0268264_100091766 94
528 3300028381 Ga0268264_10047094 Ga0268264_100470942 94
529 3300031731 Ga0307405_10122475 Ga0307405_101224752 94
530 3300031824 Ga0307413_10768815 Ga0307413_107688152 94
531 3300031852 Ga0307410_10084540 Ga0307410_100845401 94
532 3300031903 Ga0307407_11175874 Ga0307407_111758742 94
533 3300031903 Ga0307407_11591261 Ga0307407_115912611 94
534 3300032002 Ga0307416_100055630 Ga0307416_1000556302 94
535 3300035170 Ga0373943_0260349 Ga0373943_0260349_509_808 94
536 3300035691 Ga0373931_0579430 Ga0373931_0579430_396_695 94
537 3300035695 Ga0373927_0499533 Ga0373927_0499533_102_401 94
538 3300037068 Ga0373925_0234864 Ga0373925_0234864_313_612 94
539 3300041459 Ga0451800_0902335 Ga0451800_0902335_224_523 94
540 3300041505 Ga0451849_0120400 Ga0451849_0120400_65_364 94
541 3300041507 Ga0451851_0602247 Ga0451851_0602247_274_573 94
542 3300041512 Ga0451853_1679459 Ga0451853_1679459_130_441 94
543 3300044658 Ga0466972_0249680 Ga0466972_0249680_344_655 94
544 3300044706 Ga0466964_0188280 Ga0466964_0188280_150_461 94
545 3300044735 Ga0466968_0080788 Ga0466968_0080788_1077_1388 94
546 3300044901 Ga0466960_0075460 Ga0466960_0075460_369_680 94
547 3300045976 Ga0466967_0002855 Ga0466967_0002855_6139_6450 94
548 3300045976 Ga0466967_0167671 Ga0466967_0167671_89_400 94
549 3300045976 Ga0466967_0502609 Ga0466967_0502609_533_844 94
550 3300046454 Ga0495592_0254995 Ga0495592_0254995_773_1072 94
551 3300046455 Ga0495603_0019675 Ga0495603_0019675_1370_1669 94
552 3300046461 Ga0495641_0013995 Ga0495641_0013995_1984_2283 94
553 3300046473 Ga0495582_0295187 Ga0495582_0295187_204_503 94
554 3300046476 Ga0495662_0040780 Ga0495662_0040780_636_935 94
555 3300046511 Ga0495608_0577260 Ga0495608_0577260_174_473 94
556 3300046531 Ga0495665_0239131 Ga0495665_0239131_317_616 94
557 3300046533 Ga0495640_0082949 Ga0495640_0082949_683_982 94
558 3300046616 Ga0495668_0843613 Ga0495668_0843613_50_349 94
559 3300046642 Ga0495634_0759659 Ga0495634_0759659_123_422 94
560 3300046674 Ga0495588_0025567 Ga0495588_0025567_775_1074 94
561 3300046683 Ga0495658_0012503 Ga0495658_0012503_1888_2187 94
562 3300046690 Ga0495624_0038399 Ga0495624_0038399_1413_1712 94
563 3300047319 Ga0495674_0038390 Ga0495674_0038390_2920_3219 94
564 3300047320 Ga0495672_0044336 Ga0495672_0044336_1062_1361 94
565 3300047320 Ga0495672_0149048 Ga0495672_0149048_206_517 94
566 3300047321 Ga0495676_0103972 Ga0495676_0103972_987_1286 94
567 3300047673 Ga0495593_0006029 Ga0495593_0006029_1062_1361 94
568 3300048903 Ga0496100_0956753 Ga0496100_0956753_178_489 94
569 3300048904 Ga0496101_0565928 Ga0496101_0565928_480_779 94
570 3300048905 Ga0496102_0019989 Ga0496102_0019989_4715_5026 94
571 3300048905 Ga0496102_0057771 Ga0496102_0057771_710_1021 94
572 3300048905 Ga0496102_0189442 Ga0496102_0189442_1551_1850 94
573 3300048906 Ga0496103_0231298 Ga0496103_0231298_619_930 94
574 3300048907 Ga0496104_0012733 Ga0496104_0012733_3294_3605 94
575 3300048908 Ga0496105_0150107 Ga0496105_0150107_94_393 94
576 3300048909 Ga0496106_0447789 Ga0496106_0447789_569_880 94
577 3300048909 Ga0496106_0448498 Ga0496106_0448498_585_884 94
578 3300048910 Ga0496107_0348733 Ga0496107_0348733_693_992 94
579 3300048910 Ga0496107_0852079 Ga0496107_0852079_51_350 94
580 3300048911 Ga0496108_0001316 Ga0496108_0001316_16109_16408 94
581 3300048911 Ga0496108_0344703 Ga0496108_0344703_539_850 94
582 3300048912 Ga0496109_0004469 Ga0496109_0004469_10093_10392 94
583 3300048912 Ga0496109_0289565 Ga0496109_0289565_1143_1442 94
584 3300048913 Ga0496110_0319327 Ga0496110_0319327_1084_1395 94
585 3300048913 Ga0496110_0619501 Ga0496110_0619501_532_843 94
586 3300048913 Ga0496110_0695185 Ga0496110_0695185_306_605 94
587 3300048914 Ga0496111_0059303 Ga0496111_0059303_1575_1886 94
588 3300048914 Ga0496111_0903860 Ga0496111_0903860_51_350 94
589 3300048915 Ga0496112_0029700 Ga0496112_0029700_2964_3263 94
590 3300048915 Ga0496112_0052846 Ga0496112_0052846_2534_2833 94
591 3300048915 Ga0496112_0243935 Ga0496112_0243935_636_947 94
592 3300048915 Ga0496112_0513168 Ga0496112_0513168_111_422 94
593 3300048915 Ga0496112_0821911 Ga0496112_0821911_461_772 94
594 3300048916 Ga0496113_0417066 Ga0496113_0417066_715_1014 94
595 3300048916 Ga0496113_0630352 Ga0496113_0630352_300_611 94
596 3300048916 Ga0496113_1497868 Ga0496113_1497868_109_420 94
597 3300048918 Ga0496115_1183967 Ga0496115_1183967_174_485 94
598 3300048921 Ga0496118_0543670 Ga0496118_0543670_37_351 94
599 3300049571 Ga0501034_0454795 Ga0501034_0454795_305_616 94
600 3300049586 Ga0501070_0025027 Ga0501070_0025027_2107_2418 94
601 3300049742 Ga0501080_0066401 Ga0501080_0066401_752_1063 94
602 3300049742 Ga0501080_1550558 Ga0501080_1550558_145_456 94
603 3300049744 Ga0501083_0221791 Ga0501083_0221791_120_431 94
604 3300050489 nmdc:mga03683_11119_c1 nmdc:mga03683_11119_c1_540_851 94
605 3300050490 nmdc:mga03n38_131534_c1 nmdc:mga03n38_131534_c1_328_639 94
606 3300050490 nmdc:mga03n38_284825_c1 nmdc:mga03n38_284825_c1_471_782 94
607 3300050490 nmdc:mga03n38_370142_c1 nmdc:mga03n38_370142_c1_203_514 94
608 3300050490 nmdc:mga03n38_55980_c1 nmdc:mga03n38_55980_c1_1073_1384 94
609 3300050490 nmdc:mga03n38_60749_c1 nmdc:mga03n38_60749_c1_434_745 94
610 3300050490 nmdc:mga03n38_71411_c1 nmdc:mga03n38_71411_c1_1267_1578 94
611 3300050491 nmdc:mga00v17_13064_c1 nmdc:mga00v17_13064_c1_846_1157 94
612 3300050491 nmdc:mga00v17_17049_c1 nmdc:mga00v17_17049_c1_2801_3112 94
613 3300050491 nmdc:mga00v17_51768_c1 nmdc:mga00v17_51768_c1_1836_2147 94
614 3300050492 nmdc:mga0yw44_101392_c1 nmdc:mga0yw44_101392_c1_638_949 94
615 3300050492 nmdc:mga0yw44_118789_c1 nmdc:mga0yw44_118789_c1_361_672 94
616 3300050493 nmdc:mga0k408_158458_c1 nmdc:mga0k408_158458_c1_537_848 94
617 3300050494 nmdc:mga06z11_197929_c1 nmdc:mga06z11_197929_c1_80_391 94
618 3300050495 nmdc:mga04h51_171451_c1 nmdc:mga04h51_171451_c1_89_400 94
619 3300050495 nmdc:mga04h51_446026_c1 nmdc:mga04h51_446026_c1_10_321 94
620 3300050495 nmdc:mga04h51_493148_c1 nmdc:mga04h51_493148_c1_186_497 94
621 3300050496 nmdc:mga07m45_107818_c1 nmdc:mga07m45_107818_c1_994_1305 94
622 3300050496 nmdc:mga07m45_1850_c1 nmdc:mga07m45_1850_c1_4720_5031 94
623 3300050496 nmdc:mga07m45_20229_c1 nmdc:mga07m45_20229_c1_410_721 94
624 3300050496 nmdc:mga07m45_2352_c1 nmdc:mga07m45_2352_c1_3292_3603 94
625 3300050496 nmdc:mga07m45_62341_c1 nmdc:mga07m45_62341_c1_28_339 94
626 3300050496 nmdc:mga07m45_97142_c1 nmdc:mga07m45_97142_c1_1153_1464 94
627 3300050509 nmdc:mga0qj67_237996_c1 nmdc:mga0qj67_237996_c1_801_1100 94
628 3300050511 nmdc:mga08y16_146701_c1 nmdc:mga08y16_146701_c1_1114_1425 94
629 3300050516 nmdc:mga0sz30_151084_c1 nmdc:mga0sz30_151084_c1_37_348 94
630 3300050516 nmdc:mga0sz30_28612_c1 nmdc:mga0sz30_28612_c1_1447_1758 94
631 3300050516 nmdc:mga0sz30_461025_c1 nmdc:mga0sz30_461025_c1_147_458 94
632 3300050516 nmdc:mga0sz30_496142_c1 nmdc:mga0sz30_496142_c1_70_381 94
633 3300053083 Ga0495655_0074573 Ga0495655_0074573_334_633 94
634 3300053085 Ga0495619_0037475 Ga0495619_0037475_964_1263 94
635 3300053096 Ga0500641_0177028 Ga0500641_0177028_188_499 94
636 3300053137 Ga0500561_0295419 Ga0500561_0295419_31_330 94
637 3300053151 Ga0500604_0139072 Ga0500604_0139072_57_368 94

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13459

Fer4_15

4Fe-4S single cluster domain

3

65

0.95

PF13370

Fer4_13

4Fe-4S single cluster domain of Ferredoxin I

5

66

0.88

Feature Viewer

pLDDT pTM Quality
66.76 0.46 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map