F471077

General Info

Members Datasets Scaffolds Average Seq Length
633 268 1266 226

Family's Representative Sequence

Representative Sequence 3300013100|Ga0157373_10418774|Ga0157373_104187742
Length 264
Sequence MSETTLVPPAGLEFDAPHVPGLLRATWLVARKDLAIEFRTRSAFFSAVVFALLALAIFYYAWDPTAVTATDLAPGVLWVIFTFSGLLGLHRSFGVEMSDRAIDGLLASPASREAIFLGKALANLIFVAAVQLVAIPALVLFYNLPLTSIAGPLIAIAALAAIGXXXVGTLFSAMAVNTRLAELLLPMLALPFFVPIVTAAAQATAKLLSGRPVVEISAWLKLLVAFDLVFVVACTVAFPFTVEDELVTATATERVRDVSGIVPS

Samples

Sample ID Description Type Environment
1 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
30 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
31 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
32 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
33 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
34 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
35 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
36 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
37 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
38 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
39 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
40 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
41 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
42 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
43 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
44 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
45 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
46 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
47 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
48 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
49 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
50 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
51 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
52 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
53 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
54 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
55 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
56 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
57 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
58 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
59 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
60 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
61 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
62 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
63 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
64 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
65 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
66 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
67 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
69 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
70 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
71 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
73 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
74 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
76 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
78 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
79 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
80 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
81 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
82 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
83 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
84 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
85 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
86 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
87 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
88 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
89 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
90 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
91 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
92 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
93 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
94 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
95 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
96 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
97 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
98 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
99 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
100 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
101 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
153 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
154 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
155 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
156 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
157 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
158 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
159 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
160 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
161 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
162 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
163 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
164 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
165 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
166 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
167 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
168 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
169 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
170 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
171 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
172 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
173 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
174 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
175 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
176 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
177 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
178 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
179 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
180 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
181 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
182 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
183 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
184 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
185 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
186 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
187 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
188 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
189 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
190 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
191 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
192 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
193 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
194 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
195 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
196 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
197 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
198 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
199 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
200 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
201 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
202 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
203 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
204 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
205 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
206 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
207 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
208 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
209 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
210 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
211 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
212 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
213 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
214 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
215 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
216 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
217 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
218 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
219 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
220 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
221 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
222 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
223 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
224 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
225 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
226 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
227 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
228 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
229 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
230 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
231 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
232 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
233 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
234 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
235 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
236 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
237 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
238 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
239 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
240 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
241 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
242 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
243 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
244 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
245 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
246 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
247 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
248 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
249 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
250 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
251 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
252 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
253 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
254 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
255 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
256 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
257 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
258 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
259 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
260 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
261 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
262 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
263 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
264 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
265 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
266 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
267 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
268 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.68
Metatranscriptomes 0.32
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.58
Rhizosphere 97.79
Stem 0
Stem Tuber 0
Unclassified 15.64

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157373_10418774 3300013100 Unclassified 961
2 MBSR1b_contig_4672892 2162886012 Bacteria 3150
3 Ga0065712_10082566 3300005290 Bacteria 2906
4 Ga0065715_10093395 3300005293 Bacteria 4701
5 Ga0070658_10001684 3300005327 Bacteria 18659
6 Ga0070658_10005474 3300005327 Bacteria 10300
7 Ga0070658_10118904 3300005327 Bacteria 2195
8 Ga0070658_10128251 3300005327 Bacteria 2113
9 Ga0070683_100006630 3300005329 Bacteria 9721
10 Ga0070683_100015822 3300005329 Bacteria 6633
11 Ga0070683_100021358 3300005329 Bacteria 5778
12 Ga0070683_100023805 3300005329 Bacteria 5481
13 Ga0070683_100029411 3300005329 Bacteria 4973
14 Ga0070683_100037963 3300005329 Bacteria 4412
15 Ga0070683_100045724 3300005329 Bacteria 4041
16 Ga0070683_100091934 3300005329 Bacteria 2850
17 Ga0070683_100130762 3300005329 Unclassified 2376
18 Ga0070683_100178090 3300005329 Bacteria 2018
19 Ga0070683_100188530 3300005329 Bacteria 1958
20 Ga0070683_100252583 3300005329 Unclassified 1677
21 Ga0070690_100014309 3300005330 Bacteria 4707
22 Ga0070690_100028789 3300005330 Bacteria 3442
23 Ga0070690_100102149 3300005330 Bacteria 1902
24 Ga0070690_100126557 3300005330 Unclassified 1721
25 Ga0070670_100088295 3300005331 Bacteria 2665
26 Ga0070677_10152472 3300005333 Bacteria 1077
27 Ga0068869_100135235 3300005334 Unclassified 1898
28 Ga0070680_100000187 3300005336 Bacteria 40138
29 Ga0070680_100000740 3300005336 Bacteria 22791
30 Ga0070680_100002251 3300005336 Bacteria 14251
31 Ga0070680_100010964 3300005336 Bacteria 7007
32 Ga0070680_100054279 3300005336 Bacteria 3272
33 Ga0070680_100210191 3300005336 Bacteria 1642
34 Ga0070680_100225977 3300005336 Unclassified 1580
35 Ga0070682_100089269 3300005337 Bacteria 2013
36 Ga0070682_100173712 3300005337 Unclassified 1499
37 Ga0068868_100013966 3300005338 Bacteria 5908
38 Ga0068868_100056027 3300005338 Bacteria 3112
39 Ga0068868_100559362 3300005338 Bacteria 1009
40 Ga0070660_100016690 3300005339 Bacteria 5336
41 Ga0070660_100080282 3300005339 Bacteria 2559
42 Ga0070660_100438343 3300005339 Bacteria 1083
43 Ga0070689_100056549 3300005340 Unclassified 3042
44 Ga0070691_10004179 3300005341 Bacteria 6559
45 Ga0070691_10010004 3300005341 Unclassified 4321
46 Ga0070691_10037141 3300005341 Bacteria 2298
47 Ga0070687_100022622 3300005343 Unclassified 2975
48 Ga0070661_100007670 3300005344 Bacteria 7451
49 Ga0070661_100049184 3300005344 Bacteria 3087
50 Ga0070661_100057094 3300005344 Bacteria 2861
51 Ga0070692_10148848 3300005345 Unclassified 1331
52 Ga0070668_100268726 3300005347 Unclassified 1421
53 Ga0070669_100034397 3300005353 Bacteria 3669
54 Ga0070669_100463277 3300005353 Bacteria 1046
55 Ga0070675_100024357 3300005354 Bacteria 4847
56 Ga0070675_100525993 3300005354 Unclassified 1067
57 Ga0070671_100014627 3300005355 Bacteria 6344
58 Ga0070671_100037473 3300005355 Bacteria 4021
59 Ga0070671_100052254 3300005355 Bacteria 3398
60 Ga0070674_100289519 3300005356 Bacteria 1301
61 Ga0070673_100068503 3300005364 Unclassified 2842
62 Ga0070688_100005628 3300005365 Bacteria 6612
63 Ga0070688_100090788 3300005365 Unclassified 1995
64 Ga0070659_100165992 3300005366 Bacteria 1807
65 Ga0070659_100242241 3300005366 Bacteria 1493
66 Ga0070667_100082900 3300005367 Unclassified 2746
67 Ga0070667_100246733 3300005367 Bacteria 1596
68 Ga0070667_100792639 3300005367 Unclassified 879
69 Ga0070709_10503685 3300005434 Bacteria 920
70 Ga0070714_100145189 3300005435 Bacteria 2133
71 Ga0070713_100012772 3300005436 Bacteria 6173
72 Ga0070701_10055034 3300005438 Bacteria 2077
73 Ga0070711_100047808 3300005439 Bacteria 2922
74 Ga0070711_100139992 3300005439 Bacteria 1813
75 Ga0070694_100063519 3300005444 Bacteria 2525
76 Ga0070694_100068455 3300005444 Bacteria 2440
77 Ga0070694_100214476 3300005444 Bacteria 1441
78 Ga0070708_100000089 3300005445 Bacteria 59378
79 Ga0070708_100004987 3300005445 Bacteria 10492
80 Ga0070708_100053005 3300005445 Bacteria 3598
81 Ga0070663_100064728 3300005455 Bacteria 2643
82 Ga0070678_100541771 3300005456 Unclassified 1032
83 Ga0070662_100296759 3300005457 Unclassified 1312
84 Ga0070681_10005730 3300005458 Bacteria 12008
85 Ga0070681_10006463 3300005458 Bacteria 11408
86 Ga0070681_10016025 3300005458 Bacteria 7473
87 Ga0070681_10034983 3300005458 Bacteria 5045
88 Ga0070681_10067660 3300005458 Bacteria 3539
89 Ga0070681_10174531 3300005458 Bacteria 2071
90 Ga0070681_10291638 3300005458 Bacteria 1541
91 Ga0070681_10483622 3300005458 Bacteria 1151
92 Ga0070685_10070273 3300005466 Unclassified 2072
93 Ga0070706_100525910 3300005467 Bacteria 1100
94 Ga0070707_100021715 3300005468 Bacteria 6067
95 Ga0070707_100038876 3300005468 Bacteria 4546
96 Ga0070707_100057738 3300005468 Bacteria 3723
97 Ga0070707_100265640 3300005468 Bacteria 1669
98 Ga0070698_100167902 3300005471 Bacteria 2136
99 Ga0070698_100366715 3300005471 Bacteria 1372
100 Ga0070698_100829293 3300005471 Bacteria 869
101 Ga0070699_100072998 3300005518 Bacteria 2985
102 Ga0070699_100084762 3300005518 Bacteria 2765
103 Ga0070679_100001679 3300005530 Bacteria 19948
104 Ga0070679_100002452 3300005530 Bacteria 16819
105 Ga0070679_100003788 3300005530 Bacteria 13877
106 Ga0070679_100005794 3300005530 Bacteria 11467
107 Ga0070679_100016947 3300005530 Bacteria 7042
108 Ga0070679_100033701 3300005530 Bacteria 5071
109 Ga0070679_100065523 3300005530 Bacteria 3621
110 Ga0070679_100089657 3300005530 Bacteria 3062
111 Ga0070679_100111942 3300005530 Bacteria 2716
112 Ga0070679_100170635 3300005530 Bacteria 2148
113 Ga0070679_100171017 3300005530 Unclassified 2146
114 Ga0070679_100508197 3300005530 Unclassified 1149
115 Ga0070679_100508437 3300005530 Unclassified 1149
116 Ga0070684_100000778 3300005535 Bacteria 22137
117 Ga0070684_100008531 3300005535 Bacteria 8018
118 Ga0070684_100028726 3300005535 Bacteria 4705
119 Ga0070684_100043276 3300005535 Bacteria 3888
120 Ga0070684_100046228 3300005535 Bacteria 3771
121 Ga0070684_100069207 3300005535 Bacteria 3104
122 Ga0070684_100170208 3300005535 Bacteria 1978
123 Ga0070684_100207883 3300005535 Bacteria 1784
124 Ga0070684_100341923 3300005535 Bacteria 1376
125 Ga0070697_100138475 3300005536 Bacteria 2045
126 Ga0070672_100075885 3300005543 Bacteria 2684
127 Ga0070695_100436880 3300005545 Unclassified 1000
128 Ga0070696_100002712 3300005546 Bacteria 11748
129 Ga0070696_100041503 3300005546 Bacteria 3179
130 Ga0070696_100100787 3300005546 Bacteria 2069
131 Ga0070696_100180670 3300005546 Bacteria 1565
132 Ga0070693_100000716 3300005547 Bacteria 14629
133 Ga0070693_100379996 3300005547 Bacteria 974
134 Ga0070693_100476915 3300005547 Bacteria 881
135 Ga0070693_100482831 3300005547 Bacteria 876
136 Ga0070704_100025997 3300005549 Bacteria 3861
137 Ga0070704_100123009 3300005549 Unclassified 1997
138 Ga0070704_100267075 3300005549 Bacteria 1412
139 Ga0070704_100667037 3300005549 Bacteria 919
140 Ga0068855_100021185 3300005563 Bacteria 7793
141 Ga0068855_100258194 3300005563 Bacteria 1942
142 Ga0068855_100332298 3300005563 Bacteria 1677
143 Ga0068855_100515950 3300005563 Bacteria 1297
144 Ga0068855_100548618 3300005563 Bacteria 1251
145 Ga0070664_100092703 3300005564 Bacteria 2616
146 Ga0070664_100297289 3300005564 Bacteria 1458
147 Ga0070664_100798296 3300005564 Unclassified 882
148 Ga0068857_100073137 3300005577 Bacteria 3054
149 Ga0068857_100459257 3300005577 Bacteria 1191
150 Ga0068854_100315787 3300005578 Bacteria 1268
151 Ga0068854_100393084 3300005578 Bacteria 1145
152 Ga0068854_100420183 3300005578 Unclassified 1110
153 Ga0068856_100054366 3300005614 Bacteria 3949
154 Ga0068856_100214180 3300005614 Bacteria 1942
155 Ga0068856_100248575 3300005614 Unclassified 1793
156 Ga0068856_100257352 3300005614 Bacteria 1761
157 Ga0068856_100483823 3300005614 Bacteria 1259
158 Ga0068856_100704776 3300005614 Bacteria 1030
159 Ga0070702_100179772 3300005615 Bacteria 1383
160 Ga0068852_100005679 3300005616 Bacteria 8948
161 Ga0068852_100035272 3300005616 Unclassified 4171
162 Ga0068852_100104535 3300005616 Bacteria 2563
163 Ga0068859_100085745 3300005617 Unclassified 3195
164 Ga0068859_100086502 3300005617 Unclassified 3181
165 Ga0068859_100132360 3300005617 Bacteria 2566
166 Ga0068859_100191537 3300005617 Bacteria 2129
167 Ga0068864_100098422 3300005618 Unclassified 2591
168 Ga0068870_10073588 3300005840 Bacteria 1869
169 Ga0068870_10338599 3300005840 Unclassified 961
170 Ga0068860_100315861 3300005843 Unclassified 1533
171 Ga0068862_100179745 3300005844 Bacteria 1898
172 Ga0081455_10041058 3300005937 Bacteria 4074
173 Ga0070716_100081146 3300006173 Bacteria 1936
174 Ga0070716_100184270 3300006173 Bacteria 1374
175 Ga0097621_100215972 3300006237 Bacteria 1669
176 Ga0097621_100334787 3300006237 Bacteria 1343
177 Ga0075428_100664478 3300006844 Unclassified 1111
178 Ga0075434_100033783 3300006871 Bacteria 5049
179 Ga0075436_100104820 3300006914 Bacteria 1971
180 Ga0075436_100496457 3300006914 Bacteria 892
181 Ga0097620_100085740 3300006931 Unclassified 3195
182 Ga0097620_100086508 3300006931 Unclassified 3181
183 Ga0097620_100132352 3300006931 Bacteria 2566
184 Ga0097620_100191511 3300006931 Bacteria 2129
185 Ga0075435_100156648 3300007076 Bacteria 1917
186 Ga0075435_100187457 3300007076 Unclassified 1750
187 Ga0105240_10002404 3300009093 Bacteria 30105
188 Ga0105240_10007054 3300009093 Bacteria 16382
189 Ga0105240_10035417 3300009093 Bacteria 6433
190 Ga0105240_10039700 3300009093 Bacteria 6025
191 Ga0105240_10109606 3300009093 Bacteria 3343
192 Ga0105240_10114766 3300009093 Unclassified 3253
193 Ga0105240_10290028 3300009093 Unclassified 1876
194 Ga0111539_10704607 3300009094 Unclassified 1175
195 Ga0105245_10155871 3300009098 Bacteria 2163
196 Ga0105245_10864373 3300009098 Unclassified 945
197 Ga0114129_10067730 3300009147 Bacteria 4978
198 Ga0105243_10110796 3300009148 Bacteria 2296
199 Ga0105241_10002439 3300009174 Bacteria 13950
200 Ga0105241_10206830 3300009174 Bacteria 1643
201 Ga0105241_10570182 3300009174 Bacteria 1019
202 Ga0105242_10172514 3300009176 Unclassified 1902
203 Ga0105248_10219449 3300009177 Unclassified 2141
204 Ga0105248_11163791 3300009177 Unclassified 872
205 Ga0105237_10043671 3300009545 Bacteria 4514
206 Ga0105237_10908706 3300009545 Bacteria 887
207 Ga0105238_10056905 3300009551 Unclassified 3922
208 Ga0105238_10103026 3300009551 Bacteria 2836
209 Ga0105238_10424973 3300009551 Bacteria 1324
210 Ga0105238_10831037 3300009551 Bacteria 940
211 Ga0105249_11495754 3300009553 Bacteria 747
212 Ga0105239_10088619 3300010375 Bacteria 3412
213 Ga0105239_10604538 3300010375 Bacteria 1251
214 Ga0105246_10154882 3300011119 Bacteria 1739
215 Ga0105246_10300626 3300011119 Unclassified 1295
216 Ga0105246_10622876 3300011119 Unclassified 935
217 Ga0105246_10903564 3300011119 Bacteria 792
218 Ga0157373_10060511 3300013100 Bacteria 2683
219 Ga0157373_10208247 3300013100 Bacteria 1379
220 Ga0157371_10082313 3300013102 Bacteria 2279
221 Ga0157371_10161941 3300013102 Bacteria 1598
222 Ga0157370_10000540 3300013104 Bacteria 47409
223 Ga0157370_10003694 3300013104 Bacteria 17883
224 Ga0157370_10004399 3300013104 Bacteria 16165
225 Ga0157370_10040372 3300013104 Bacteria 4505
226 Ga0157370_10125431 3300013104 Bacteria 2396
227 Ga0157370_10209269 3300013104 Bacteria 1808
228 Ga0157370_10307768 3300013104 Bacteria 1462
229 Ga0157369_10002739 3300013105 Bacteria 21042
230 Ga0157369_10015801 3300013105 Bacteria 8503
231 Ga0157369_10083959 3300013105 Bacteria 3405
232 Ga0157369_10151149 3300013105 Bacteria 2454
233 Ga0157369_10214724 3300013105 Bacteria 2015
234 Ga0157369_10384223 3300013105 Bacteria 1457
235 Ga0157369_11183013 3300013105 Unclassified 780
236 Ga0157374_10185267 3300013296 Bacteria 2035
237 Ga0157378_10026888 3300013297 Bacteria 5074
238 Ga0157378_10356705 3300013297 Unclassified 1430
239 Ga0157378_11330383 3300013297 Unclassified 760
240 Ga0163162_10069273 3300013306 Bacteria 3579
241 Ga0163162_10468854 3300013306 Unclassified 1391
242 Ga0157372_10001743 3300013307 Bacteria 23591
243 Ga0157372_10003651 3300013307 Bacteria 16548
244 Ga0157372_10007923 3300013307 Bacteria 11293
245 Ga0157372_10009451 3300013307 Bacteria 10373
246 Ga0157372_10041502 3300013307 Bacteria 5088
247 Ga0157372_10080645 3300013307 Bacteria 3683
248 Ga0157372_10103477 3300013307 Bacteria 3254
249 Ga0157372_10104797 3300013307 Bacteria 3234
250 Ga0157372_10199573 3300013307 Bacteria 2317
251 Ga0157372_10214939 3300013307 Bacteria 2228
252 Ga0157372_10253381 3300013307 Bacteria 2043
253 Ga0157372_10369537 3300013307 Unclassified 1671
254 Ga0157372_10448099 3300013307 Unclassified 1504
255 Ga0157372_10876762 3300013307 Unclassified 1042
256 Ga0157375_10029480 3300013308 Bacteria 5162
257 Ga0157375_10084945 3300013308 Unclassified 3215
258 Ga0157375_10119586 3300013308 Bacteria 2742
259 Ga0157375_10157166 3300013308 Unclassified 2413
260 Ga0157375_10234100 3300013308 Bacteria 1996
261 Ga0157380_10393769 3300014326 Bacteria 1312
262 Ga0157380_10737438 3300014326 Bacteria 995
263 Ga0157377_10058658 3300014745 Bacteria 2192
264 Ga0157377_10140413 3300014745 Bacteria 1484
265 Ga0157379_10572962 3300014968 Bacteria 1052
266 Ga0157376_10056588 3300014969 Bacteria 3277
267 Ga0197907_10335094 3300020069 Bacteria 1282
268 Ga0206353_11787594 3300020082 Bacteria 1440
269 Ga0213876_10026623 3300021384 Bacteria 3050
270 Ga0207682_10146308 3300025893 Bacteria 1063
271 Ga0207642_10056912 3300025899 Bacteria 1796
272 Ga0207688_10163360 3300025901 Bacteria 1321
273 Ga0207680_10054574 3300025903 Unclassified 2405
274 Ga0207699_10261714 3300025906 Bacteria 1196
275 Ga0207645_10056374 3300025907 Bacteria 2508
276 Ga0207645_10349702 3300025907 Bacteria 989
277 Ga0207643_10052595 3300025908 Bacteria 2313
278 Ga0207705_10003698 3300025909 Bacteria 11640
279 Ga0207705_10014773 3300025909 Bacteria 5614
280 Ga0207705_10184728 3300025909 Bacteria 1575
281 Ga0207684_10451994 3300025910 Bacteria 1103
282 Ga0207654_10017982 3300025911 Bacteria 3705
283 Ga0207707_10002022 3300025912 Bacteria 18412
284 Ga0207707_10011617 3300025912 Bacteria 7665
285 Ga0207707_10018744 3300025912 Bacteria 6034
286 Ga0207707_10037243 3300025912 Bacteria 4250
287 Ga0207707_10093867 3300025912 Bacteria 2621
288 Ga0207707_10131280 3300025912 Bacteria 2191
289 Ga0207707_10198967 3300025912 Bacteria 1747
290 Ga0207695_10001840 3300025913 Bacteria 33282
291 Ga0207695_10002822 3300025913 Bacteria 25243
292 Ga0207695_10009902 3300025913 Bacteria 11713
293 Ga0207695_10014926 3300025913 Bacteria 9168
294 Ga0207695_10025723 3300025913 Bacteria 6584
295 Ga0207695_10044047 3300025913 Unclassified 4750
296 Ga0207695_10096842 3300025913 Bacteria 2952
297 Ga0207695_10133735 3300025913 Unclassified 2435
298 Ga0207671_10045989 3300025914 Bacteria 3228
299 Ga0207663_10029987 3300025916 Bacteria 3203
300 Ga0207663_10307051 3300025916 Bacteria 1187
301 Ga0207660_10000071 3300025917 Bacteria 52971
302 Ga0207660_10009685 3300025917 Bacteria 6235
303 Ga0207660_10011949 3300025917 Bacteria 5668
304 Ga0207660_10075828 3300025917 Bacteria 2458
305 Ga0207660_10109902 3300025917 Bacteria 2073
306 Ga0207660_10116611 3300025917 Bacteria 2017
307 Ga0207660_10503591 3300025917 Bacteria 983
308 Ga0207662_10006600 3300025918 Bacteria 6266
309 Ga0207657_10001748 3300025919 Bacteria 23427
310 Ga0207657_10002151 3300025919 Bacteria 21361
311 Ga0207657_10040525 3300025919 Bacteria 4126
312 Ga0207657_10106432 3300025919 Bacteria 2321
313 Ga0207657_10116166 3300025919 Bacteria 2205
314 Ga0207657_10366525 3300025919 Bacteria 1135
315 Ga0207649_10089241 3300025920 Bacteria 2015
316 Ga0207652_10009562 3300025921 Bacteria 7797
317 Ga0207652_10012829 3300025921 Bacteria 6775
318 Ga0207652_10023518 3300025921 Bacteria 5105
319 Ga0207652_10043502 3300025921 Bacteria 3824
320 Ga0207652_10044813 3300025921 Bacteria 3769
321 Ga0207652_10049713 3300025921 Bacteria 3590
322 Ga0207652_10086227 3300025921 Bacteria 2753
323 Ga0207652_10139699 3300025921 Bacteria 2165
324 Ga0207652_10186696 3300025921 Bacteria 1864
325 Ga0207652_10200744 3300025921 Bacteria 1794
326 Ga0207652_10263202 3300025921 Bacteria 1556
327 Ga0207646_10043630 3300025922 Bacteria 4026
328 Ga0207646_10053295 3300025922 Bacteria 3618
329 Ga0207694_10076618 3300025924 Bacteria 2619
330 Ga0207694_10344769 3300025924 Bacteria 1232
331 Ga0207694_10548625 3300025924 Unclassified 970
332 Ga0207659_10065029 3300025926 Unclassified 2642
333 Ga0207659_10071449 3300025926 Bacteria 2534
334 Ga0207687_10719203 3300025927 Unclassified 848
335 Ga0207687_10755258 3300025927 Bacteria 828
336 Ga0207700_10089487 3300025928 Bacteria 2427
337 Ga0207664_10047944 3300025929 Bacteria 3358
338 Ga0207644_10026125 3300025931 Unclassified 4022
339 Ga0207644_10062127 3300025931 Bacteria 2708
340 Ga0207644_10425154 3300025931 Bacteria 1089
341 Ga0207690_10007736 3300025932 Bacteria 6377
342 Ga0207690_10018034 3300025932 Bacteria 4323
343 Ga0207690_10128083 3300025932 Bacteria 1854
344 Ga0207690_10208460 3300025932 Bacteria 1488
345 Ga0207686_10082259 3300025934 Bacteria 2104
346 Ga0207686_10200625 3300025934 Bacteria 1428
347 Ga0207686_10413521 3300025934 Bacteria 1030
348 Ga0207709_10240990 3300025935 Bacteria 1315
349 Ga0207670_10134305 3300025936 Unclassified 1817
350 Ga0207704_10070882 3300025938 Bacteria 2209
351 Ga0207704_10076585 3300025938 Bacteria 2144
352 Ga0207665_10176622 3300025939 Archaea 1545
353 Ga0207691_10014209 3300025940 Bacteria 7595
354 Ga0207691_10016949 3300025940 Bacteria 6913
355 Ga0207691_10137936 3300025940 Bacteria 2150
356 Ga0207711_10690198 3300025941 Unclassified 952
357 Ga0207661_10000568 3300025944 Bacteria 23560
358 Ga0207661_10003126 3300025944 Bacteria 11472
359 Ga0207661_10027246 3300025944 Bacteria 4364
360 Ga0207661_10027612 3300025944 Bacteria 4337
361 Ga0207661_10069121 3300025944 Bacteria 2878
362 Ga0207661_10098774 3300025944 Bacteria 2447
363 Ga0207661_10101491 3300025944 Bacteria 2417
364 Ga0207661_10306640 3300025944 Bacteria 1424
365 Ga0207661_10399948 3300025944 Bacteria 1245
366 Ga0207679_10084762 3300025945 Bacteria 2433
367 Ga0207679_10199559 3300025945 Bacteria 1670
368 Ga0207667_10035104 3300025949 Bacteria 5381
369 Ga0207667_10046369 3300025949 Bacteria 4602
370 Ga0207667_10148329 3300025949 Bacteria 2414
371 Ga0207667_10269677 3300025949 Bacteria 1740
372 Ga0207667_10645184 3300025949 Bacteria 1065
373 Ga0207667_10947140 3300025949 Bacteria 851
374 Ga0207651_10025149 3300025960 Bacteria 3697
375 Ga0207668_10076501 3300025972 Bacteria 2410
376 Ga0207668_10164258 3300025972 Unclassified 1734
377 Ga0207640_10005661 3300025981 Bacteria 6808
378 Ga0207640_10077926 3300025981 Bacteria 2254
379 Ga0207640_10402720 3300025981 Unclassified 1115
380 Ga0207658_10035986 3300025986 Unclassified 3549
381 Ga0207658_10049289 3300025986 Unclassified 3094
382 Ga0207658_10076242 3300025986 Bacteria 2554
383 Ga0207658_10441408 3300025986 Bacteria 1151
384 Ga0207677_10091726 3300026023 Bacteria 2210
385 Ga0207703_10210003 3300026035 Bacteria 1735
386 Ga0207703_10252347 3300026035 Unclassified 1591
387 Ga0207639_10043929 3300026041 Bacteria 3358
388 Ga0207678_10001464 3300026067 Bacteria 21663
389 Ga0207678_10312601 3300026067 Bacteria 1351
390 Ga0207702_10029611 3300026078 Bacteria 4557
391 Ga0207702_10071173 3300026078 Bacteria 2994
392 Ga0207702_10383544 3300026078 Bacteria 1352
393 Ga0207702_10457222 3300026078 Bacteria 1239
394 Ga0207702_10653156 3300026078 Unclassified 1034
395 Ga0207676_10256433 3300026095 Bacteria 1577
396 Ga0207674_10011008 3300026116 Bacteria 10173
397 Ga0207674_10066327 3300026116 Bacteria 3636
398 Ga0207674_10157834 3300026116 Bacteria 2223
399 Ga0207674_10258040 3300026116 Bacteria 1690
400 Ga0207674_10554171 3300026116 Unclassified 1110
401 Ga0207698_10018181 3300026142 Bacteria 4784
402 Ga0207698_10640372 3300026142 Bacteria 1052
403 Ga0268265_10033891 3300028380 Bacteria 3717
404 Ga0268265_10199146 3300028380 Bacteria 1736
405 Ga0268264_10151295 3300028381 Bacteria 2081
406 Ga0307408_100034305 3300031548 Bacteria 3554
407 Ga0307408_100092958 3300031548 Bacteria 2281
408 Ga0307408_100539281 3300031548 Unclassified 1028
409 Ga0307405_10010758 3300031731 Bacteria 4757
410 Ga0307405_10018526 3300031731 Bacteria 3843
411 Ga0307405_10254324 3300031731 Bacteria 1309
412 Ga0307413_10001849 3300031824 Bacteria 8336
413 Ga0307413_10011843 3300031824 Bacteria 4310
414 Ga0307413_10024956 3300031824 Bacteria 3267
415 Ga0307413_10064531 3300031824 Unclassified 2276
416 Ga0307413_10172726 3300031824 Bacteria 1532
417 Ga0307413_10189768 3300031824 Bacteria 1474
418 Ga0307410_10000503 3300031852 Bacteria 15891
419 Ga0307410_10012594 3300031852 Bacteria 4898
420 Ga0307410_10047362 3300031852 Bacteria 2873
421 Ga0307410_10165596 3300031852 Bacteria 1661
422 Ga0307410_10266664 3300031852 Bacteria 1338
423 Ga0307410_10388473 3300031852 Unclassified 1125
424 Ga0307406_10004847 3300031901 Bacteria 7329
425 Ga0307406_10021374 3300031901 Bacteria 3826
426 Ga0307406_10077990 3300031901 Bacteria 2193
427 Ga0307406_10134098 3300031901 Bacteria 1743
428 Ga0307406_10427797 3300031901 Bacteria 1056
429 Ga0307407_10001318 3300031903 Bacteria 8877
430 Ga0307407_10006738 3300031903 Bacteria 5140
431 Ga0307407_10020398 3300031903 Bacteria 3395
432 Ga0307407_10073887 3300031903 Bacteria 2039
433 Ga0307407_10094472 3300031903 Unclassified 1841
434 Ga0307407_10263039 3300031903 Bacteria 1187
435 Ga0307407_10538400 3300031903 Unclassified 861
436 Ga0307412_10013368 3300031911 Bacteria 4811
437 Ga0307412_10027137 3300031911 Bacteria 3567
438 Ga0307412_10193637 3300031911 Bacteria 1539
439 Ga0307412_10430668 3300031911 Bacteria 1081
440 Ga0307412_10660468 3300031911 Bacteria 893
441 Ga0307409_100013992 3300031995 Bacteria 5194
442 Ga0307409_100071539 3300031995 Bacteria 2758
443 Ga0307409_100193344 3300031995 Bacteria 1813
444 Ga0307409_100212014 3300031995 Bacteria 1741
445 Ga0307409_100560623 3300031995 Bacteria 1123
446 Ga0307416_100002176 3300032002 Bacteria 11111
447 Ga0307416_100003596 3300032002 Bacteria 9145
448 Ga0307416_100012696 3300032002 Bacteria 5688
449 Ga0307416_100058707 3300032002 Bacteria 3121
450 Ga0307416_100170483 3300032002 Bacteria 2025
451 Ga0307416_100223354 3300032002 Unclassified 1809
452 Ga0307416_100287224 3300032002 Bacteria 1626
453 Ga0307416_100444887 3300032002 Unclassified 1347
454 Ga0307416_100686939 3300032002 Bacteria 1111
455 Ga0307416_100844306 3300032002 Unclassified 1014
456 Ga0307416_101142057 3300032002 Bacteria 884
457 Ga0307414_10017852 3300032004 Bacteria 4352
458 Ga0307414_10018267 3300032004 Bacteria 4311
459 Ga0307414_10040187 3300032004 Bacteria 3157
460 Ga0307411_10037145 3300032005 Bacteria 3059
461 Ga0307411_10048558 3300032005 Bacteria 2751
462 Ga0307415_100002530 3300032126 Bacteria 9139
463 Ga0307415_100014380 3300032126 Bacteria 4652
464 Ga0307415_100026149 3300032126 Bacteria 3677
465 Ga0307415_100404202 3300032126 Archaea 1167
466 Ga0373959_0003753 3300034820 Unclassified 2431
467 Ga0373929_0084512 3300035085 Unclassified 778
468 Ga0373934_0000064 3300035086 Bacteria 36073
469 Ga0373934_0007666 3300035086 Bacteria 4009
470 Ga0373923_0019296 3300035111 Bacteria 2638
471 Ga0373923_0048442 3300035111 Bacteria 1774
472 Ga0373941_0002720 3300035115 Unclassified 3922
473 Ga0373953_0001938 3300035117 Bacteria 6153
474 Ga0373956_0000381 3300035119 Bacteria 18142
475 Ga0373956_0022153 3300035119 Bacteria 2716
476 Ga0373956_0067800 3300035119 Bacteria 1625
477 Ga0373957_0031354 3300035120 Bacteria 1953
478 Ga0373957_0123513 3300035120 Bacteria 1049
479 Ga0373955_0000995 3300035172 Bacteria 12012
480 Ga0373955_0005959 3300035172 Bacteria 5522
481 Ga0373961_0025819 3300035241 Bacteria 1601
482 Ga0373924_0042853 3300035410 Bacteria 1857
483 Ga0373931_0022133 3300035691 Bacteria 3196
484 Ga0373933_0001064 3300035724 Bacteria 16565
485 Ga0373933_0024556 3300035724 Bacteria 3450
486 Ga0373947_0016511 3300035725 Bacteria 4243
487 Ga0373947_0097201 3300035725 Bacteria 1845
488 Ga0373937_0000558 3300036401 Bacteria 33042
489 Ga0373937_0018717 3300036401 Bacteria 6189
490 Ga0373937_0051886 3300036401 Bacteria 3759
491 Ga0373937_0115090 3300036401 Bacteria 2504
492 Ga0373925_0054882 3300037068 Bacteria 2981
493 Ga0373925_0095161 3300037068 Bacteria 2281
494 Ga0395899_0106317 3300037312 Bacteria 2021
495 Ga0395898_0126652 3300037466 Bacteria 2447
496 Ga0395905_0004795 3300037471 Bacteria 13972
497 Ga0395901_0005991 3300038443 Bacteria 12311
498 Ga0436365_0041325 3300039437 Bacteria 5371
499 Ga0436365_0931492 3300039437 Bacteria 11326
500 Ga0451853_1717090 3300041512 Unclassified 1370
501 Ga0439462_0086906 3300042015 Bacteria 856
502 Ga0466966_0040865 3300044684 Bacteria 2982
503 Ga0466966_0045515 3300044684 Bacteria 2805
504 Ga0466963_0276235 3300044694 Unclassified 1181
505 Ga0466957_0279630 3300044842 Bacteria 1117
506 Ga0466958_0084438 3300045836 Bacteria 1958
507 Ga0466958_0359280 3300045836 Bacteria 938
508 Ga0466967_0027120 3300045976 Bacteria 4760
509 Ga0495592_0000897 3300046454 Bacteria 20636
510 Ga0495592_0059623 3300046454 Bacteria 2810
511 Ga0495629_0023944 3300046459 Bacteria 4348
512 Ga0495629_0062333 3300046459 Bacteria 2605
513 Ga0495638_0290598 3300046460 Unclassified 884
514 Ga0495651_0000171 3300046462 Bacteria 47887
515 Ga0495651_0102124 3300046462 Bacteria 2133
516 Ga0495653_0000065 3300046463 Bacteria 92073
517 Ga0495580_0022995 3300046472 Bacteria 4584
518 Ga0495582_0019649 3300046473 Bacteria 3694
519 Ga0495582_0081482 3300046473 Bacteria 1797
520 Ga0495662_0192426 3300046476 Bacteria 1006
521 Ga0495664_0013060 3300046477 Bacteria 4709
522 Ga0495664_0154740 3300046477 Bacteria 1391
523 Ga0495594_0005649 3300046499 Bacteria 6432
524 Ga0495594_0244070 3300046499 Bacteria 1023
525 Ga0495596_0117237 3300046500 Unclassified 1034
526 Ga0495608_0002630 3300046511 Bacteria 12898
527 Ga0495608_0070939 3300046511 Bacteria 2273
528 Ga0495618_0085422 3300046514 Bacteria 2017
529 Ga0495628_0010298 3300046516 Bacteria 7948
530 Ga0495628_0038398 3300046516 Bacteria 3833
531 Ga0495628_0077325 3300046516 Bacteria 2589
532 Ga0495630_0003226 3300046517 Bacteria 11356
533 Ga0495630_0007885 3300046517 Bacteria 7635
534 Ga0495630_0038958 3300046517 Bacteria 3555
535 Ga0495666_0023106 3300046526 Bacteria 3076
536 Ga0495666_0130026 3300046526 Bacteria 1177
537 Ga0495652_0001144 3300046529 Bacteria 29882
538 Ga0495652_0043468 3300046529 Bacteria 3869
539 Ga0495665_0035766 3300046531 Bacteria 2652
540 Ga0495665_0047420 3300046531 Bacteria 2279
541 Ga0495586_0037632 3300046535 Bacteria 2598
542 Ga0495586_0042921 3300046535 Bacteria 2435
543 Ga0495586_0050475 3300046535 Bacteria 2251
544 Ga0495586_0138016 3300046535 Bacteria 1367
545 Ga0495587_0000721 3300046536 Bacteria 22088
546 Ga0495587_0001658 3300046536 Bacteria 14860
547 Ga0495587_0001702 3300046536 Bacteria 14688
548 Ga0495645_0000127 3300046543 Bacteria 51432
549 Ga0495645_0000616 3300046543 Bacteria 24563
550 Ga0495645_0000737 3300046543 Bacteria 22347
551 Ga0495667_0001871 3300046559 Bacteria 13968
552 Ga0495667_0003111 3300046559 Bacteria 11129
553 Ga0495667_0026907 3300046559 Bacteria 3876
554 Ga0495667_0117156 3300046559 Bacteria 1720
555 Ga0495635_0000248 3300046663 Bacteria 34264
556 Ga0495588_0009726 3300046674 Bacteria 4457
557 Ga0495657_0002731 3300046675 Bacteria 14738
558 Ga0495599_0003594 3300046678 Bacteria 9093
559 Ga0495599_0004132 3300046678 Bacteria 8573
560 Ga0495623_0000399 3300046679 Bacteria 28720
561 Ga0495646_0074190 3300046680 Bacteria 1997
562 Ga0495646_0091400 3300046680 Bacteria 1756
563 Ga0495647_0071208 3300046681 Bacteria 1392
564 Ga0495658_0361922 3300046683 Bacteria 922
565 Ga0495613_0085543 3300046689 Bacteria 2288
566 Ga0495600_0002017 3300046809 Bacteria 11422
567 Ga0495581_0010734 3300047315 Bacteria 5297
568 Ga0495581_0141367 3300047315 Bacteria 1404
569 Ga0495604_0000579 3300047317 Bacteria 32066
570 Ga0495604_0197966 3300047317 Bacteria 1396
571 Ga0495604_0369625 3300047317 Bacteria 949
572 Ga0495674_0003646 3300047319 Bacteria 14993
573 Ga0495674_0097179 3300047319 Bacteria 2509
574 Ga0495674_0250710 3300047319 Bacteria 1457
575 Ga0495672_0005150 3300047320 Bacteria 10430
576 Ga0495680_0002958 3300047322 Bacteria 17006
577 Ga0495680_0245353 3300047322 Bacteria 1271
578 Ga0495675_0000773 3300047444 Bacteria 19900
579 Ga0495675_0072066 3300047444 Bacteria 2180
580 Ga0495684_0000049 3300047471 Bacteria 87765
581 Ga0495684_0030857 3300047471 Bacteria 4114
582 Ga0495684_0234372 3300047471 Bacteria 1341
583 Ga0495593_0036210 3300047673 Bacteria 2677
584 Ga0495593_0123894 3300047673 Bacteria 1314
585 Ga0495602_0023387 3300048088 Bacteria 6022
586 Ga0495602_0033360 3300048088 Bacteria 4830
587 Ga0496100_0188683 3300048903 Bacteria 1495
588 Ga0496101_0237795 3300048904 Bacteria 1417
589 Ga0496104_0581735 3300048907 Bacteria 1030
590 Ga0496105_0104039 3300048908 Bacteria 2345
591 Ga0496106_0163619 3300048909 Bacteria 1760
592 Ga0496107_0036151 3300048910 Bacteria 3543
593 Ga0496108_0164690 3300048911 Bacteria 1917
594 Ga0496112_0014840 3300048915 Bacteria 7246
595 Ga0496112_0209941 3300048915 Bacteria 1905
596 Ga0496115_0278337 3300048918 Unclassified 1374
597 Ga0501032_0209436 3300049569 Bacteria 1271
598 Ga0501032_0337707 3300049569 Unclassified 971
599 Ga0501033_0009285 3300049570 Bacteria 7577
600 Ga0501034_0175496 3300049571 Bacteria 2109
601 Ga0501036_0008351 3300049572 Bacteria 8486
602 Ga0501037_0282084 3300049573 Bacteria 1157
603 Ga0501043_0130805 3300049579 Bacteria 1967
604 Ga0501043_0617623 3300049579 Bacteria 799
605 Ga0501047_0014525 3300049581 Bacteria 7490
606 Ga0501047_0119343 3300049581 Bacteria 2519
607 Ga0501047_0193584 3300049581 Bacteria 1896
608 Ga0501070_0659329 3300049586 Bacteria 830
609 Ga0501202_009468 3300049652 Unclassified 1792
610 Ga0501233_004323 3300049668 Bacteria 2598
611 Ga0501235_005288 3300049669 Unclassified 2808
612 Ga0501251_020900 3300049681 Unclassified 869
613 Ga0501259_003055 3300049688 Unclassified 2682
614 Ga0501225_0004285 3300049705 Bacteria 4264
615 Ga0501234_002527 3300049707 Unclassified 2879
616 Ga0501083_0372205 3300049744 Unclassified 929
617 Ga0501263_000169 3300049760 Unclassified 3892
618 Ga0501035_0073884 3300049822 Bacteria 3017
619 Ga0501035_0087228 3300049822 Bacteria 2750
620 Ga0501044_0118431 3300049823 Bacteria 2651
621 Ga0501044_0131094 3300049823 Bacteria 2501
622 nmdc:mga05p37_201104_c1 3300050507 Bacteria 2413
623 nmdc:mga0n895_13980_c1 3300050512 Bacteria 7270
624 nmdc:mga0rr50_141142_c1 3300050513 Bacteria 1938
625 nmdc:mga08x19_359444_c1 3300050514 Unclassified 1017
626 nmdc:mga08x19_5485_c1 3300050514 Bacteria 7503
627 nmdc:mga0a205_60926_c1 3300050515 Bacteria 3645
628 Ga0495601_0006363 3300053077 Bacteria 6905
629 Ga0495601_0225256 3300053077 Unclassified 1225
630 Ga0495595_0076278 3300053084 Bacteria 1591
631 Ga0495595_0132511 3300053084 Bacteria 1219
632 Ga0495619_0002387 3300053085 Bacteria 12330
633 Ga0495619_0108611 3300053085 Bacteria 1894
634 Ga0157373_10418774
635 MBSR1b_contig_4672892
636 Ga0065712_10082566
637 Ga0065715_10093395
638 Ga0070658_10001684
639 Ga0070658_10005474
640 Ga0070658_10118904
641 Ga0070658_10128251
642 Ga0070683_100006630
643 Ga0070683_100015822
644 Ga0070683_100021358
645 Ga0070683_100023805
646 Ga0070683_100029411
647 Ga0070683_100037963
648 Ga0070683_100045724
649 Ga0070683_100091934
650 Ga0070683_100130762
651 Ga0070683_100178090
652 Ga0070683_100188530
653 Ga0070683_100252583
654 Ga0070690_100014309
655 Ga0070690_100028789
656 Ga0070690_100102149
657 Ga0070690_100126557
658 Ga0070670_100088295
659 Ga0070677_10152472
660 Ga0068869_100135235
661 Ga0070680_100000187
662 Ga0070680_100000740
663 Ga0070680_100002251
664 Ga0070680_100010964
665 Ga0070680_100054279
666 Ga0070680_100210191
667 Ga0070680_100225977
668 Ga0070682_100089269
669 Ga0070682_100173712
670 Ga0068868_100013966
671 Ga0068868_100056027
672 Ga0068868_100559362
673 Ga0070660_100016690
674 Ga0070660_100080282
675 Ga0070660_100438343
676 Ga0070689_100056549
677 Ga0070691_10004179
678 Ga0070691_10010004
679 Ga0070691_10037141
680 Ga0070687_100022622
681 Ga0070661_100007670
682 Ga0070661_100049184
683 Ga0070661_100057094
684 Ga0070692_10148848
685 Ga0070668_100268726
686 Ga0070669_100034397
687 Ga0070669_100463277
688 Ga0070675_100024357
689 Ga0070675_100525993
690 Ga0070671_100014627
691 Ga0070671_100037473
692 Ga0070671_100052254
693 Ga0070674_100289519
694 Ga0070673_100068503
695 Ga0070688_100005628
696 Ga0070688_100090788
697 Ga0070659_100165992
698 Ga0070659_100242241
699 Ga0070667_100082900
700 Ga0070667_100246733
701 Ga0070667_100792639
702 Ga0070709_10503685
703 Ga0070714_100145189
704 Ga0070713_100012772
705 Ga0070701_10055034
706 Ga0070711_100047808
707 Ga0070711_100139992
708 Ga0070694_100063519
709 Ga0070694_100068455
710 Ga0070694_100214476
711 Ga0070708_100000089
712 Ga0070708_100004987
713 Ga0070708_100053005
714 Ga0070663_100064728
715 Ga0070678_100541771
716 Ga0070662_100296759
717 Ga0070681_10005730
718 Ga0070681_10006463
719 Ga0070681_10016025
720 Ga0070681_10034983
721 Ga0070681_10067660
722 Ga0070681_10174531
723 Ga0070681_10291638
724 Ga0070681_10483622
725 Ga0070685_10070273
726 Ga0070706_100525910
727 Ga0070707_100021715
728 Ga0070707_100038876
729 Ga0070707_100057738
730 Ga0070707_100265640
731 Ga0070698_100167902
732 Ga0070698_100366715
733 Ga0070698_100829293
734 Ga0070699_100072998
735 Ga0070699_100084762
736 Ga0070679_100001679
737 Ga0070679_100002452
738 Ga0070679_100003788
739 Ga0070679_100005794
740 Ga0070679_100016947
741 Ga0070679_100033701
742 Ga0070679_100065523
743 Ga0070679_100089657
744 Ga0070679_100111942
745 Ga0070679_100170635
746 Ga0070679_100171017
747 Ga0070679_100508197
748 Ga0070679_100508437
749 Ga0070684_100000778
750 Ga0070684_100008531
751 Ga0070684_100028726
752 Ga0070684_100043276
753 Ga0070684_100046228
754 Ga0070684_100069207
755 Ga0070684_100170208
756 Ga0070684_100207883
757 Ga0070684_100341923
758 Ga0070697_100138475
759 Ga0070672_100075885
760 Ga0070695_100436880
761 Ga0070696_100002712
762 Ga0070696_100041503
763 Ga0070696_100100787
764 Ga0070696_100180670
765 Ga0070693_100000716
766 Ga0070693_100379996
767 Ga0070693_100476915
768 Ga0070693_100482831
769 Ga0070704_100025997
770 Ga0070704_100123009
771 Ga0070704_100267075
772 Ga0070704_100667037
773 Ga0068855_100021185
774 Ga0068855_100258194
775 Ga0068855_100332298
776 Ga0068855_100515950
777 Ga0068855_100548618
778 Ga0070664_100092703
779 Ga0070664_100297289
780 Ga0070664_100798296
781 Ga0068857_100073137
782 Ga0068857_100459257
783 Ga0068854_100315787
784 Ga0068854_100393084
785 Ga0068854_100420183
786 Ga0068856_100054366
787 Ga0068856_100214180
788 Ga0068856_100248575
789 Ga0068856_100257352
790 Ga0068856_100483823
791 Ga0068856_100704776
792 Ga0070702_100179772
793 Ga0068852_100005679
794 Ga0068852_100035272
795 Ga0068852_100104535
796 Ga0068859_100085745
797 Ga0068859_100086502
798 Ga0068859_100132360
799 Ga0068859_100191537
800 Ga0068864_100098422
801 Ga0068870_10073588
802 Ga0068870_10338599
803 Ga0068860_100315861
804 Ga0068862_100179745
805 Ga0081455_10041058
806 Ga0070716_100081146
807 Ga0070716_100184270
808 Ga0097621_100215972
809 Ga0097621_100334787
810 Ga0075428_100664478
811 Ga0075434_100033783
812 Ga0075436_100104820
813 Ga0075436_100496457
814 Ga0097620_100085740
815 Ga0097620_100086508
816 Ga0097620_100132352
817 Ga0097620_100191511
818 Ga0075435_100156648
819 Ga0075435_100187457
820 Ga0105240_10002404
821 Ga0105240_10007054
822 Ga0105240_10035417
823 Ga0105240_10039700
824 Ga0105240_10109606
825 Ga0105240_10114766
826 Ga0105240_10290028
827 Ga0111539_10704607
828 Ga0105245_10155871
829 Ga0105245_10864373
830 Ga0114129_10067730
831 Ga0105243_10110796
832 Ga0105241_10002439
833 Ga0105241_10206830
834 Ga0105241_10570182
835 Ga0105242_10172514
836 Ga0105248_10219449
837 Ga0105248_11163791
838 Ga0105237_10043671
839 Ga0105237_10908706
840 Ga0105238_10056905
841 Ga0105238_10103026
842 Ga0105238_10424973
843 Ga0105238_10831037
844 Ga0105249_11495754
845 Ga0105239_10088619
846 Ga0105239_10604538
847 Ga0105246_10154882
848 Ga0105246_10300626
849 Ga0105246_10622876
850 Ga0105246_10903564
851 Ga0157373_10060511
852 Ga0157373_10208247
853 Ga0157371_10082313
854 Ga0157371_10161941
855 Ga0157370_10000540
856 Ga0157370_10003694
857 Ga0157370_10004399
858 Ga0157370_10040372
859 Ga0157370_10125431
860 Ga0157370_10209269
861 Ga0157370_10307768
862 Ga0157369_10002739
863 Ga0157369_10015801
864 Ga0157369_10083959
865 Ga0157369_10151149
866 Ga0157369_10214724
867 Ga0157369_10384223
868 Ga0157369_11183013
869 Ga0157374_10185267
870 Ga0157378_10026888
871 Ga0157378_10356705
872 Ga0157378_11330383
873 Ga0163162_10069273
874 Ga0163162_10468854
875 Ga0157372_10001743
876 Ga0157372_10003651
877 Ga0157372_10007923
878 Ga0157372_10009451
879 Ga0157372_10041502
880 Ga0157372_10080645
881 Ga0157372_10103477
882 Ga0157372_10104797
883 Ga0157372_10199573
884 Ga0157372_10214939
885 Ga0157372_10253381
886 Ga0157372_10369537
887 Ga0157372_10448099
888 Ga0157372_10876762
889 Ga0157375_10029480
890 Ga0157375_10084945
891 Ga0157375_10119586
892 Ga0157375_10157166
893 Ga0157375_10234100
894 Ga0157380_10393769
895 Ga0157380_10737438
896 Ga0157377_10058658
897 Ga0157377_10140413
898 Ga0157379_10572962
899 Ga0157376_10056588
900 Ga0197907_10335094
901 Ga0206353_11787594
902 Ga0213876_10026623
903 Ga0207682_10146308
904 Ga0207642_10056912
905 Ga0207688_10163360
906 Ga0207680_10054574
907 Ga0207699_10261714
908 Ga0207645_10056374
909 Ga0207645_10349702
910 Ga0207643_10052595
911 Ga0207705_10003698
912 Ga0207705_10014773
913 Ga0207705_10184728
914 Ga0207684_10451994
915 Ga0207654_10017982
916 Ga0207707_10002022
917 Ga0207707_10011617
918 Ga0207707_10018744
919 Ga0207707_10037243
920 Ga0207707_10093867
921 Ga0207707_10131280
922 Ga0207707_10198967
923 Ga0207695_10001840
924 Ga0207695_10002822
925 Ga0207695_10009902
926 Ga0207695_10014926
927 Ga0207695_10025723
928 Ga0207695_10044047
929 Ga0207695_10096842
930 Ga0207695_10133735
931 Ga0207671_10045989
932 Ga0207663_10029987
933 Ga0207663_10307051
934 Ga0207660_10000071
935 Ga0207660_10009685
936 Ga0207660_10011949
937 Ga0207660_10075828
938 Ga0207660_10109902
939 Ga0207660_10116611
940 Ga0207660_10503591
941 Ga0207662_10006600
942 Ga0207657_10001748
943 Ga0207657_10002151
944 Ga0207657_10040525
945 Ga0207657_10106432
946 Ga0207657_10116166
947 Ga0207657_10366525
948 Ga0207649_10089241
949 Ga0207652_10009562
950 Ga0207652_10012829
951 Ga0207652_10023518
952 Ga0207652_10043502
953 Ga0207652_10044813
954 Ga0207652_10049713
955 Ga0207652_10086227
956 Ga0207652_10139699
957 Ga0207652_10186696
958 Ga0207652_10200744
959 Ga0207652_10263202
960 Ga0207646_10043630
961 Ga0207646_10053295
962 Ga0207694_10076618
963 Ga0207694_10344769
964 Ga0207694_10548625
965 Ga0207659_10065029
966 Ga0207659_10071449
967 Ga0207687_10719203
968 Ga0207687_10755258
969 Ga0207700_10089487
970 Ga0207664_10047944
971 Ga0207644_10026125
972 Ga0207644_10062127
973 Ga0207644_10425154
974 Ga0207690_10007736
975 Ga0207690_10018034
976 Ga0207690_10128083
977 Ga0207690_10208460
978 Ga0207686_10082259
979 Ga0207686_10200625
980 Ga0207686_10413521
981 Ga0207709_10240990
982 Ga0207670_10134305
983 Ga0207704_10070882
984 Ga0207704_10076585
985 Ga0207665_10176622
986 Ga0207691_10014209
987 Ga0207691_10016949
988 Ga0207691_10137936
989 Ga0207711_10690198
990 Ga0207661_10000568
991 Ga0207661_10003126
992 Ga0207661_10027246
993 Ga0207661_10027612
994 Ga0207661_10069121
995 Ga0207661_10098774
996 Ga0207661_10101491
997 Ga0207661_10306640
998 Ga0207661_10399948
999 Ga0207679_10084762
1000 Ga0207679_10199559
1001 Ga0207667_10035104
1002 Ga0207667_10046369
1003 Ga0207667_10148329
1004 Ga0207667_10269677
1005 Ga0207667_10645184
1006 Ga0207667_10947140
1007 Ga0207651_10025149
1008 Ga0207668_10076501
1009 Ga0207668_10164258
1010 Ga0207640_10005661
1011 Ga0207640_10077926
1012 Ga0207640_10402720
1013 Ga0207658_10035986
1014 Ga0207658_10049289
1015 Ga0207658_10076242
1016 Ga0207658_10441408
1017 Ga0207677_10091726
1018 Ga0207703_10210003
1019 Ga0207703_10252347
1020 Ga0207639_10043929
1021 Ga0207678_10001464
1022 Ga0207678_10312601
1023 Ga0207702_10029611
1024 Ga0207702_10071173
1025 Ga0207702_10383544
1026 Ga0207702_10457222
1027 Ga0207702_10653156
1028 Ga0207676_10256433
1029 Ga0207674_10011008
1030 Ga0207674_10066327
1031 Ga0207674_10157834
1032 Ga0207674_10258040
1033 Ga0207674_10554171
1034 Ga0207698_10018181
1035 Ga0207698_10640372
1036 Ga0268265_10033891
1037 Ga0268265_10199146
1038 Ga0268264_10151295
1039 Ga0307408_100034305
1040 Ga0307408_100092958
1041 Ga0307408_100539281
1042 Ga0307405_10010758
1043 Ga0307405_10018526
1044 Ga0307405_10254324
1045 Ga0307413_10001849
1046 Ga0307413_10011843
1047 Ga0307413_10024956
1048 Ga0307413_10064531
1049 Ga0307413_10172726
1050 Ga0307413_10189768
1051 Ga0307410_10000503
1052 Ga0307410_10012594
1053 Ga0307410_10047362
1054 Ga0307410_10165596
1055 Ga0307410_10266664
1056 Ga0307410_10388473
1057 Ga0307406_10004847
1058 Ga0307406_10021374
1059 Ga0307406_10077990
1060 Ga0307406_10134098
1061 Ga0307406_10427797
1062 Ga0307407_10001318
1063 Ga0307407_10006738
1064 Ga0307407_10020398
1065 Ga0307407_10073887
1066 Ga0307407_10094472
1067 Ga0307407_10263039
1068 Ga0307407_10538400
1069 Ga0307412_10013368
1070 Ga0307412_10027137
1071 Ga0307412_10193637
1072 Ga0307412_10430668
1073 Ga0307412_10660468
1074 Ga0307409_100013992
1075 Ga0307409_100071539
1076 Ga0307409_100193344
1077 Ga0307409_100212014
1078 Ga0307409_100560623
1079 Ga0307416_100002176
1080 Ga0307416_100003596
1081 Ga0307416_100012696
1082 Ga0307416_100058707
1083 Ga0307416_100170483
1084 Ga0307416_100223354
1085 Ga0307416_100287224
1086 Ga0307416_100444887
1087 Ga0307416_100686939
1088 Ga0307416_100844306
1089 Ga0307416_101142057
1090 Ga0307414_10017852
1091 Ga0307414_10018267
1092 Ga0307414_10040187
1093 Ga0307411_10037145
1094 Ga0307411_10048558
1095 Ga0307415_100002530
1096 Ga0307415_100014380
1097 Ga0307415_100026149
1098 Ga0307415_100404202
1099 Ga0373959_0003753
1100 Ga0373929_0084512
1101 Ga0373934_0000064
1102 Ga0373934_0007666
1103 Ga0373923_0019296
1104 Ga0373923_0048442
1105 Ga0373941_0002720
1106 Ga0373953_0001938
1107 Ga0373956_0000381
1108 Ga0373956_0022153
1109 Ga0373956_0067800
1110 Ga0373957_0031354
1111 Ga0373957_0123513
1112 Ga0373955_0000995
1113 Ga0373955_0005959
1114 Ga0373961_0025819
1115 Ga0373924_0042853
1116 Ga0373931_0022133
1117 Ga0373933_0001064
1118 Ga0373933_0024556
1119 Ga0373947_0016511
1120 Ga0373947_0097201
1121 Ga0373937_0000558
1122 Ga0373937_0018717
1123 Ga0373937_0051886
1124 Ga0373937_0115090
1125 Ga0373925_0054882
1126 Ga0373925_0095161
1127 Ga0395899_0106317
1128 Ga0395898_0126652
1129 Ga0395905_0004795
1130 Ga0395901_0005991
1131 Ga0436365_0041325
1132 Ga0436365_0931492
1133 Ga0451853_1717090
1134 Ga0439462_0086906
1135 Ga0466966_0040865
1136 Ga0466966_0045515
1137 Ga0466963_0276235
1138 Ga0466957_0279630
1139 Ga0466958_0084438
1140 Ga0466958_0359280
1141 Ga0466967_0027120
1142 Ga0495592_0000897
1143 Ga0495592_0059623
1144 Ga0495629_0023944
1145 Ga0495629_0062333
1146 Ga0495638_0290598
1147 Ga0495651_0000171
1148 Ga0495651_0102124
1149 Ga0495653_0000065
1150 Ga0495580_0022995
1151 Ga0495582_0019649
1152 Ga0495582_0081482
1153 Ga0495662_0192426
1154 Ga0495664_0013060
1155 Ga0495664_0154740
1156 Ga0495594_0005649
1157 Ga0495594_0244070
1158 Ga0495596_0117237
1159 Ga0495608_0002630
1160 Ga0495608_0070939
1161 Ga0495618_0085422
1162 Ga0495628_0010298
1163 Ga0495628_0038398
1164 Ga0495628_0077325
1165 Ga0495630_0003226
1166 Ga0495630_0007885
1167 Ga0495630_0038958
1168 Ga0495666_0023106
1169 Ga0495666_0130026
1170 Ga0495652_0001144
1171 Ga0495652_0043468
1172 Ga0495665_0035766
1173 Ga0495665_0047420
1174 Ga0495586_0037632
1175 Ga0495586_0042921
1176 Ga0495586_0050475
1177 Ga0495586_0138016
1178 Ga0495587_0000721
1179 Ga0495587_0001658
1180 Ga0495587_0001702
1181 Ga0495645_0000127
1182 Ga0495645_0000616
1183 Ga0495645_0000737
1184 Ga0495667_0001871
1185 Ga0495667_0003111
1186 Ga0495667_0026907
1187 Ga0495667_0117156
1188 Ga0495635_0000248
1189 Ga0495588_0009726
1190 Ga0495657_0002731
1191 Ga0495599_0003594
1192 Ga0495599_0004132
1193 Ga0495623_0000399
1194 Ga0495646_0074190
1195 Ga0495646_0091400
1196 Ga0495647_0071208
1197 Ga0495658_0361922
1198 Ga0495613_0085543
1199 Ga0495600_0002017
1200 Ga0495581_0010734
1201 Ga0495581_0141367
1202 Ga0495604_0000579
1203 Ga0495604_0197966
1204 Ga0495604_0369625
1205 Ga0495674_0003646
1206 Ga0495674_0097179
1207 Ga0495674_0250710
1208 Ga0495672_0005150
1209 Ga0495680_0002958
1210 Ga0495680_0245353
1211 Ga0495675_0000773
1212 Ga0495675_0072066
1213 Ga0495684_0000049
1214 Ga0495684_0030857
1215 Ga0495684_0234372
1216 Ga0495593_0036210
1217 Ga0495593_0123894
1218 Ga0495602_0023387
1219 Ga0495602_0033360
1220 Ga0496100_0188683
1221 Ga0496101_0237795
1222 Ga0496104_0581735
1223 Ga0496105_0104039
1224 Ga0496106_0163619
1225 Ga0496107_0036151
1226 Ga0496108_0164690
1227 Ga0496112_0014840
1228 Ga0496112_0209941
1229 Ga0496115_0278337
1230 Ga0501032_0209436
1231 Ga0501032_0337707
1232 Ga0501033_0009285
1233 Ga0501034_0175496
1234 Ga0501036_0008351
1235 Ga0501037_0282084
1236 Ga0501043_0130805
1237 Ga0501043_0617623
1238 Ga0501047_0014525
1239 Ga0501047_0119343
1240 Ga0501047_0193584
1241 Ga0501070_0659329
1242 Ga0501202_009468
1243 Ga0501233_004323
1244 Ga0501235_005288
1245 Ga0501251_020900
1246 Ga0501259_003055
1247 Ga0501225_0004285
1248 Ga0501234_002527
1249 Ga0501083_0372205
1250 Ga0501263_000169
1251 Ga0501035_0073884
1252 Ga0501035_0087228
1253 Ga0501044_0118431
1254 Ga0501044_0131094
1255 nmdc:mga05p37_201104_c1
1256 nmdc:mga0n895_13980_c1
1257 nmdc:mga0rr50_141142_c1
1258 nmdc:mga08x19_359444_c1
1259 nmdc:mga08x19_5485_c1
1260 nmdc:mga0a205_60926_c1
1261 Ga0495601_0006363
1262 Ga0495601_0225256
1263 Ga0495595_0076278
1264 Ga0495595_0132511
1265 Ga0495619_0002387
1266 Ga0495619_0108611

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03379

CcmB

CcmB protein

26

244

0.95

PF01061

ABC2_membrane

ABC-2 type transporter

24

195

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
7f02-assembly1.cif.gz_F cytochrome c-type biogenesis protein ccmabcd from e. coli 0.848 5 222
7vfj-assembly1.cif.gz_B cytochrome c-type biogenesis protein ccmabcd 0.8318 5 222
7f02-assembly1.cif.gz_F cytochrome c-type biogenesis protein ccmabcd from e. coli 0.8236 5 222
7vfj-assembly1.cif.gz_B cytochrome c-type biogenesis protein ccmabcd 0.8079 5 222
8ce1-assembly1.cif.gz_B cytochrome c maturation complex ccmabcd 0.7938 5 221
ID Description Score Start End Superfamily
af_A0A2R8QMX4_332_689_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.6799 52 215 3.40.1710.10
af_Q86P18_394_773_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.6545 52 218 3.40.1710.10
af_P90947_382_500_1.20.120.230 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Alpha-catenin/vinculin-like 0.5787 142 220 1.20.120.230
af_Q96JW4_154_338_1.10.357.20 Mainly Alpha;Orthogonal Bundle;Tetracycline Repressor; domain 2;SLC41 divalent cation transporters, integral membrane domain 0.5411 15 185 1.10.357.20
af_A0A2R8QMX4_332_689_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.5231 52 215 3.40.1710.10
ID Description Score Start End GO Terms
AF-A0A2V7LIW2-F1-model_v4 Heme ABC transporter permease 0.9743 2 223 GO:0005886
GO:0015232
GO:0017004
GO:1903607
AF-A0A2V7M770-F1-model_v4 Heme exporter protein B 0.9719 2 223 GO:0005886
GO:0015232
GO:0017004
GO:1903607
AF-A0A2G4FVT3-F1-model_v4 Heme exporter protein B 0.9699 3 223 GO:0005886
GO:0015232
GO:0017004
GO:1903607
AF-A0A6J4LHY0-F1-model_v4 Heme exporter protein B 0.9669 2 223 GO:0005886
GO:0015232
GO:0017004
GO:1903607
AF-A0A2V7PNX8-F1-model_v4 Heme exporter protein B 0.966 2 223 GO:0005886
GO:0015232
GO:0017004
GO:1903607

Map