F470853

General Info

Members Datasets Scaffolds Average Seq Length
630 246 630 493

Family's Representative Sequence

Representative Sequence 3300035116|Ga0373945_0015129|Ga0373945_0015129_626_2203
Length 525
Sequence LLHEMNFRRADEMVRRHVATTGEPIMAENNVIAEQPKSVTENYEIVHQKSPLFYPQYERKSDLKHQTHYCPGCGHGVAHKLIAEALEELGVQDQTILVSPVGCSVFAYYYFDVGNVQVAHGRAPAAATGLKRACPDKIVIAYQGDGDLAAIGTAEIVHAANRGEKISVFFVNNAIYGMTGGQMAPTTLVGQRSTTSPWGRRPVNEGFPLHMAEMLSSLEAPVYIERVALSDNKNIMKARRAVRKALELQRAGAGFTFVEILSPCPTIWGKDPVEARKWIAEKMIPNFPLNVFRDRKVDIPNSNVPPHKTVAELVEGERKAAGGEAIPRKQHHFRDLGIKIAGFGGQGVLLLGQLLAEMGMQEGLEVSWLPSYGPEMRSGSAHCHVCLSKDRIGTPVLSRPQVLIAMTEISLRKFYSQVAPGGTIIYGRERLPEDLEITQAQVVCIPASEIADKLGSAKVANVVMMGALLEETECLSPATAMKVLEKKVKNPALLELDRKALDAGRLYIDHTVAVGAVTQADGFAQ

Samples

Sample ID Description Type Environment
1 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
2 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
3 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
4 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
5 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
20 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
31 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
32 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
33 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
34 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
35 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
36 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
37 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
38 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
39 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
40 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
41 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
42 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
43 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
44 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
45 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
46 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
47 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
48 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
49 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
50 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
51 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
52 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
53 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
54 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
55 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
56 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
57 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
58 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
59 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
60 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
61 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
62 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
63 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
64 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
65 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
66 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
67 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
68 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
69 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
70 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
72 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
73 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
74 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
75 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
77 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
78 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
79 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
80 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
81 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
82 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
83 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
84 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
85 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
86 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
87 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
88 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
89 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
90 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
91 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
92 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
93 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
94 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
95 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
96 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
97 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
98 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
99 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
100 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
101 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
102 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
103 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
104 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
105 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
106 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
161 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
162 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
163 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
164 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
165 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
166 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
167 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
168 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
169 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
170 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
171 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
172 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
173 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
174 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
175 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
176 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
177 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
178 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
179 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
180 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
181 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
182 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
183 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
184 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
185 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
186 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
187 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
188 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
189 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
190 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
191 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
192 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
193 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
194 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
195 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
196 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
197 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
198 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
199 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
200 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
201 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
202 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
203 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
204 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
205 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
206 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
207 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
208 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
209 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
210 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
211 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
212 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
213 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
214 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
215 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
216 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
217 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
218 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
219 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
220 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
221 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
222 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
223 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
224 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
225 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
226 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
227 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
228 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
229 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
230 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
231 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
232 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
233 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
234 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
235 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
236 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
237 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
238 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
239 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
240 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
241 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
242 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
243 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
244 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
245 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
246 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.68
Metatranscriptomes 0.32
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.7
Rhizosphere 97.14
Stem 0
Stem Tuber 0
Unclassified 0.16

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS1b_contig_977209 2162886011 Unclassified 2101
2 JGI24752J21851_1001586 3300001976 Bacteria 3059
3 JGI24743J22301_10000320 3300001991 Bacteria 5260
4 JGI24034J26672_10000626 3300002239 Bacteria 4538
5 JGI24751J29686_10000820 3300002459 Bacteria 7228
6 Ga0065712_10003223 3300005290 Bacteria 5823
7 Ga0065712_10017699 3300005290 Unclassified 2286
8 Ga0070658_10009911 3300005327 Bacteria 7656
9 Ga0070658_10021163 3300005327 Bacteria 5210
10 Ga0070676_10001940 3300005328 Bacteria 10516
11 Ga0070676_10018556 3300005328 Bacteria 3857
12 Ga0070683_100000013 3300005329 Bacteria 241235
13 Ga0070683_100000232 3300005329 Bacteria 38051
14 Ga0070683_100002212 3300005329 Bacteria 15398
15 Ga0070683_100009129 3300005329 Bacteria 8464
16 Ga0070683_100014899 3300005329 Bacteria 6815
17 Ga0070683_100019637 3300005329 Bacteria 6004
18 Ga0070683_100020754 3300005329 Bacteria 5851
19 Ga0070683_100038298 3300005329 Bacteria 4394
20 Ga0070683_100102183 3300005329 Bacteria 2700
21 Ga0070690_100005523 3300005330 Bacteria 7112
22 Ga0070670_100015754 3300005331 Bacteria 6490
23 Ga0070670_100019628 3300005331 Bacteria 5802
24 Ga0070677_10022092 3300005333 Bacteria 2339
25 Ga0068869_100001157 3300005334 Bacteria 15430
26 Ga0068869_100046464 3300005334 Bacteria 3131
27 Ga0070666_10100226 3300005335 Unclassified 1995
28 Ga0070680_100009850 3300005336 Bacteria 7353
29 Ga0070680_100064084 3300005336 Bacteria 3012
30 Ga0070682_100005613 3300005337 Bacteria 6993
31 Ga0068868_100001786 3300005338 Bacteria 14748
32 Ga0068868_100003783 3300005338 Archaea 10565
33 Ga0068868_100010313 3300005338 Bacteria 6759
34 Ga0068868_100014148 3300005338 Bacteria 5875
35 Ga0070660_100001797 3300005339 Bacteria 14722
36 Ga0070660_100003632 3300005339 Bacteria 10659
37 Ga0070660_100020538 3300005339 Bacteria 4855
38 Ga0070691_10021963 3300005341 Bacteria 2957
39 Ga0070687_100002133 3300005343 Bacteria 7315
40 Ga0070661_100006756 3300005344 Bacteria 7908
41 Ga0070661_100012262 3300005344 Bacteria 5993
42 Ga0070661_100032369 3300005344 Bacteria 3786
43 Ga0070661_100036026 3300005344 Bacteria 3596
44 Ga0070668_100002481 3300005347 Bacteria 13579
45 Ga0070668_100023425 3300005347 Bacteria 4670
46 Ga0070669_100015431 3300005353 Bacteria 5444
47 Ga0070675_100027019 3300005354 Bacteria 4609
48 Ga0070671_100000991 3300005355 Bacteria 20873
49 Ga0070671_100122775 3300005355 Bacteria 2186
50 Ga0070673_100063291 3300005364 Bacteria 2943
51 Ga0070673_100070373 3300005364 Unclassified 2807
52 Ga0070688_100003030 3300005365 Bacteria 8577
53 Ga0070659_100003873 3300005366 Bacteria 10660
54 Ga0070667_100003330 3300005367 Bacteria 13719
55 Ga0070667_100183630 3300005367 Unclassified 1850
56 Ga0070709_10022335 3300005434 Bacteria 3699
57 Ga0070714_100000060 3300005435 Bacteria 100913
58 Ga0070714_100023105 3300005435 Bacteria 5105
59 Ga0070714_100024698 3300005435 Bacteria 4953
60 Ga0070714_100054217 3300005435 Bacteria 3425
61 Ga0070713_100000162 3300005436 Bacteria 45425
62 Ga0070713_100002320 3300005436 Bacteria 12398
63 Ga0070713_100014596 3300005436 Bacteria 5842
64 Ga0070713_100023325 3300005436 Bacteria 4800
65 Ga0070713_100119592 3300005436 Bacteria 2308
66 Ga0070713_100151289 3300005436 Unclassified 2065
67 Ga0070710_10003631 3300005437 Bacteria 7301
68 Ga0070711_100003803 3300005439 Bacteria 8863
69 Ga0070711_100037247 3300005439 Bacteria 3263
70 Ga0070700_100060087 3300005441 Bacteria 2395
71 Ga0070663_100007746 3300005455 Bacteria 6560
72 Ga0070663_100078530 3300005455 Unclassified 2420
73 Ga0070678_100022702 3300005456 Bacteria 4165
74 Ga0070678_100117958 3300005456 Unclassified 2088
75 Ga0070662_100002730 3300005457 Bacteria 10902
76 Ga0070681_10001151 3300005458 Bacteria 22828
77 Ga0070681_10033363 3300005458 Bacteria 5168
78 Ga0068867_100007277 3300005459 Bacteria 7830
79 Ga0070685_10015501 3300005466 Bacteria 4049
80 Ga0070706_100012515 3300005467 Bacteria 7857
81 Ga0070679_100006004 3300005530 Bacteria 11299
82 Ga0070679_100065942 3300005530 Bacteria 3609
83 Ga0070684_100000151 3300005535 Bacteria 47200
84 Ga0070684_100000295 3300005535 Bacteria 34626
85 Ga0070684_100000918 3300005535 Bacteria 20912
86 Ga0070684_100001871 3300005535 Bacteria 15407
87 Ga0070684_100023840 3300005535 Bacteria 5126
88 Ga0070684_100036163 3300005535 Bacteria 4231
89 Ga0070684_100048948 3300005535 Bacteria 3668
90 Ga0070684_100081301 3300005535 Bacteria 2867
91 Ga0070684_100144857 3300005535 Unclassified 2150
92 Ga0068853_100000794 3300005539 Bacteria 21909
93 Ga0068853_100006775 3300005539 Bacteria 9128
94 Ga0068853_100009757 3300005539 Bacteria 7746
95 Ga0070686_100003107 3300005544 Bacteria 9102
96 Ga0070686_100044289 3300005544 Bacteria 2796
97 Ga0070665_100010943 3300005548 Bacteria 9176
98 Ga0070665_100014614 3300005548 Bacteria 7878
99 Ga0070665_100087148 3300005548 Bacteria 3127
100 Ga0070704_100179464 3300005549 Bacteria 1692
101 Ga0068855_100002307 3300005563 Bacteria 23584
102 Ga0068855_100004407 3300005563 Bacteria 17207
103 Ga0068855_100032325 3300005563 Bacteria 6249
104 Ga0068855_100149224 3300005563 Bacteria 2659
105 Ga0070664_100040970 3300005564 Bacteria 3907
106 Ga0068857_100000509 3300005577 Bacteria 27938
107 Ga0068857_100006523 3300005577 Bacteria 10011
108 Ga0068857_100009850 3300005577 Bacteria 8299
109 Ga0068857_100027726 3300005577 Bacteria 4995
110 Ga0068857_100047871 3300005577 Bacteria 3797
111 Ga0068854_100003053 3300005578 Bacteria 10415
112 Ga0068854_100072241 3300005578 Bacteria 2526
113 Ga0068854_100099845 3300005578 Unclassified 2174
114 Ga0068856_100002947 3300005614 Bacteria 17445
115 Ga0068856_100003955 3300005614 Bacteria 14838
116 Ga0068856_100004935 3300005614 Bacteria 13204
117 Ga0068856_100006639 3300005614 Bacteria 11335
118 Ga0068856_100007757 3300005614 Bacteria 10482
119 Ga0068856_100009363 3300005614 Bacteria 9512
120 Ga0068856_100009962 3300005614 Bacteria 9229
121 Ga0068856_100020598 3300005614 Bacteria 6407
122 Ga0070702_100058812 3300005615 Bacteria 2229
123 Ga0068852_100000004 3300005616 Bacteria 179746
124 Ga0068852_100002216 3300005616 Bacteria 13340
125 Ga0068852_100005699 3300005616 Bacteria 8935
126 Ga0068852_100013841 3300005616 Bacteria 6186
127 Ga0068852_100034185 3300005616 Bacteria 4228
128 Ga0068852_100135694 3300005616 Bacteria 2272
129 Ga0068852_100245993 3300005616 Bacteria 1711
130 Ga0068859_100002047 3300005617 Bacteria 20595
131 Ga0068864_100001014 3300005618 Bacteria 23469
132 Ga0068864_100012908 3300005618 Bacteria 6911
133 Ga0068864_100267077 3300005618 Unclassified 1593
134 Ga0068866_10003613 3300005718 Bacteria 6337
135 Ga0068866_10006041 3300005718 Bacteria 5038
136 Ga0068861_100004458 3300005719 Bacteria 9399
137 Ga0068861_100042411 3300005719 Bacteria 3410
138 Ga0068851_10014100 3300005834 Bacteria 3790
139 Ga0068851_10051141 3300005834 Bacteria 2099
140 Ga0068870_10003922 3300005840 Bacteria 6348
141 Ga0068863_100000629 3300005841 Bacteria 35768
142 Ga0068863_100010389 3300005841 Bacteria 9045
143 Ga0068863_100039701 3300005841 Bacteria 4477
144 Ga0068863_100174388 3300005841 Bacteria 2063
145 Ga0068858_100002136 3300005842 Bacteria 20028
146 Ga0068858_100012821 3300005842 Bacteria 7903
147 Ga0068858_100078478 3300005842 Unclassified 3068
148 Ga0068860_100000733 3300005843 Bacteria 37344
149 Ga0068862_100040754 3300005844 Bacteria 3948
150 Ga0068862_100084550 3300005844 Bacteria 2757
151 Ga0070717_10005985 3300006028 Bacteria 8908
152 Ga0070717_10023307 3300006028 Bacteria 4904
153 Ga0070717_10066874 3300006028 Bacteria 2989
154 Ga0070717_10103686 3300006028 Bacteria 2418
155 Ga0070717_10106331 3300006028 Bacteria 2389
156 Ga0070717_10155256 3300006028 Bacteria 1982
157 Ga0070715_10016820 3300006163 Bacteria 2757
158 Ga0070716_100000239 3300006173 Bacteria 22002
159 Ga0070716_100003763 3300006173 Bacteria 7185
160 Ga0070712_100000057 3300006175 Bacteria 56727
161 Ga0070712_100004797 3300006175 Bacteria 8363
162 Ga0070712_100006085 3300006175 Bacteria 7469
163 Ga0070712_100023766 3300006175 Bacteria 4052
164 Ga0070712_100040964 3300006175 Bacteria 3177
165 Ga0097621_100000590 3300006237 Bacteria 25555
166 Ga0097621_100000655 3300006237 Bacteria 24396
167 Ga0097621_100002052 3300006237 Bacteria 13789
168 Ga0097621_100050999 3300006237 Bacteria 3366
169 Ga0068871_100004701 3300006358 Bacteria 9547
170 Ga0068871_100008135 3300006358 Bacteria 7530
171 Ga0075434_100006250 3300006871 Bacteria 10909
172 Ga0068865_100002522 3300006881 Bacteria 10842
173 Ga0068865_100005956 3300006881 Bacteria 7425
174 Ga0075436_100005126 3300006914 Bacteria 9018
175 Ga0075436_100029764 3300006914 Bacteria 3755
176 Ga0097620_100002047 3300006931 Bacteria 20595
177 Ga0075435_100036831 3300007076 Bacteria 3891
178 Ga0105240_10000471 3300009093 Bacteria 74388
179 Ga0105240_10000788 3300009093 Bacteria 57440
180 Ga0105240_10004821 3300009093 Bacteria 20330
181 Ga0105240_10008484 3300009093 Bacteria 14696
182 Ga0105240_10008539 3300009093 Bacteria 14638
183 Ga0105240_10022446 3300009093 Bacteria 8365
184 Ga0105240_10030386 3300009093 Bacteria 7022
185 Ga0105240_10039426 3300009093 Bacteria 6050
186 Ga0105240_10049613 3300009093 Bacteria 5297
187 Ga0105240_10052307 3300009093 Bacteria 5136
188 Ga0105240_10056186 3300009093 Bacteria 4926
189 Ga0105245_10001076 3300009098 Bacteria 24743
190 Ga0105245_10002051 3300009098 Bacteria 18267
191 Ga0105245_10002635 3300009098 Bacteria 16148
192 Ga0105245_10029969 3300009098 Bacteria 4811
193 Ga0105245_10067329 3300009098 Bacteria 3243
194 Ga0105247_10002244 3300009101 Bacteria 13297
195 Ga0105243_10011240 3300009148 Bacteria 6772
196 Ga0105241_10000173 3300009174 Bacteria 47531
197 Ga0105241_10000697 3300009174 Bacteria 25355
198 Ga0105241_10005272 3300009174 Bacteria 9548
199 Ga0105241_10009050 3300009174 Bacteria 7325
200 Ga0105241_10022319 3300009174 Bacteria 4688
201 Ga0105241_10042275 3300009174 Unclassified 3447
202 Ga0105241_10066102 3300009174 Bacteria 2796
203 Ga0105241_10074747 3300009174 Bacteria 2639
204 Ga0105242_10004716 3300009176 Bacteria 10554
205 Ga0105242_10033611 3300009176 Bacteria 4108
206 Ga0105248_10023606 3300009177 Bacteria 6833
207 Ga0105248_10068134 3300009177 Bacteria 3996
208 Ga0105248_10077774 3300009177 Bacteria 3730
209 Ga0105248_10281723 3300009177 Bacteria 1871
210 Ga0105237_10003673 3300009545 Bacteria 18079
211 Ga0105237_10054638 3300009545 Bacteria 4002
212 Ga0105237_10088178 3300009545 Bacteria 3092
213 Ga0105238_10001940 3300009551 Bacteria 20803
214 Ga0105238_10002721 3300009551 Bacteria 17603
215 Ga0105238_10004120 3300009551 Bacteria 14429
216 Ga0105238_10004462 3300009551 Bacteria 13871
217 Ga0105238_10015439 3300009551 Bacteria 7728
218 Ga0105238_10030707 3300009551 Bacteria 5469
219 Ga0105238_10039762 3300009551 Bacteria 4769
220 Ga0105238_10145991 3300009551 Bacteria 2342
221 Ga0105249_10001008 3300009553 Bacteria 24927
222 Ga0105249_10049912 3300009553 Bacteria 3816
223 Ga0105239_10000496 3300010375 Bacteria 57020
224 Ga0105239_10005441 3300010375 Bacteria 14938
225 Ga0105239_10008702 3300010375 Bacteria 11492
226 Ga0105239_10025864 3300010375 Bacteria 6464
227 Ga0105239_10052149 3300010375 Bacteria 4485
228 Ga0105239_10094252 3300010375 Bacteria 3306
229 Ga0105239_10284765 3300010375 Unclassified 1861
230 Ga0105246_10000227 3300011119 Bacteria 28714
231 Ga0105246_10003044 3300011119 Bacteria 10176
232 Ga0157373_10001459 3300013100 Bacteria 18084
233 Ga0157373_10010375 3300013100 Bacteria 6858
234 Ga0157373_10052906 3300013100 Bacteria 2888
235 Ga0157371_10005422 3300013102 Bacteria 10765
236 Ga0157371_10061194 3300013102 Bacteria 2669
237 Ga0157370_10000016 3300013104 Bacteria 179999
238 Ga0157370_10013716 3300013104 Bacteria 8331
239 Ga0157369_10000287 3300013105 Bacteria 67638
240 Ga0157369_10001929 3300013105 Bacteria 25003
241 Ga0157369_10008094 3300013105 Bacteria 12054
242 Ga0157369_10013448 3300013105 Bacteria 9249
243 Ga0157369_10027807 3300013105 Bacteria 6265
244 Ga0157369_10035628 3300013105 Bacteria 5454
245 Ga0157369_10049764 3300013105 Bacteria 4541
246 Ga0157369_10050913 3300013105 Bacteria 4483
247 Ga0157369_10076314 3300013105 Bacteria 3592
248 Ga0157374_10004725 3300013296 Bacteria 11423
249 Ga0157374_10006358 3300013296 Bacteria 10023
250 Ga0157374_10027055 3300013296 Bacteria 5168
251 Ga0157374_10049561 3300013296 Unclassified 3901
252 Ga0157374_10119027 3300013296 Bacteria 2547
253 Ga0157374_10293982 3300013296 Bacteria 1606
254 Ga0157378_10000256 3300013297 Bacteria 52148
255 Ga0157378_10002892 3300013297 Bacteria 15289
256 Ga0157378_10008074 3300013297 Bacteria 9185
257 Ga0157378_10016107 3300013297 Bacteria 6546
258 Ga0157378_10021508 3300013297 Bacteria 5673
259 Ga0157378_10037231 3300013297 Bacteria 4308
260 Ga0157378_10107060 3300013297 Unclassified 2558
261 Ga0163162_10004024 3300013306 Bacteria 14109
262 Ga0163162_10019175 3300013306 Bacteria 6708
263 Ga0163162_10056233 3300013306 Unclassified 3963
264 Ga0163162_10071143 3300013306 Unclassified 3531
265 Ga0157372_10001533 3300013307 Bacteria 25124
266 Ga0157372_10002345 3300013307 Bacteria 20483
267 Ga0157372_10003981 3300013307 Bacteria 15866
268 Ga0157372_10009817 3300013307 Bacteria 10182
269 Ga0157372_10013140 3300013307 Bacteria 8833
270 Ga0157372_10013600 3300013307 Bacteria 8699
271 Ga0157372_10017181 3300013307 Bacteria 7767
272 Ga0157372_10031547 3300013307 Bacteria 5802
273 Ga0157372_10033808 3300013307 Bacteria 5618
274 Ga0157372_10048853 3300013307 Bacteria 4703
275 Ga0157372_10062985 3300013307 Bacteria 4157
276 Ga0157375_10002161 3300013308 Bacteria 16997
277 Ga0157375_10004378 3300013308 Bacteria 12265
278 Ga0157375_10035489 3300013308 Bacteria 4760
279 Ga0157375_10224344 3300013308 Unclassified 2038
280 Ga0163163_10002031 3300014325 Bacteria 17111
281 Ga0163163_10002997 3300014325 Bacteria 14285
282 Ga0163163_10003532 3300014325 Bacteria 13281
283 Ga0163163_10005991 3300014325 Bacteria 10574
284 Ga0163163_10009980 3300014325 Bacteria 8513
285 Ga0163163_10010003 3300014325 Bacteria 8504
286 Ga0163163_10022862 3300014325 Bacteria 5927
287 Ga0163163_10024622 3300014325 Bacteria 5730
288 Ga0163163_10099947 3300014325 Bacteria 2923
289 Ga0157380_10038101 3300014326 Bacteria 3731
290 Ga0182008_10007647 3300014497 Bacteria 5956
291 Ga0157377_10002004 3300014745 Bacteria 8926
292 Ga0157379_10012846 3300014968 Bacteria 7323
293 Ga0157379_10013641 3300014968 Bacteria 7121
294 Ga0157379_10043938 3300014968 Bacteria 3990
295 Ga0157379_10149201 3300014968 Unclassified 2109
296 Ga0157379_10181467 3300014968 Unclassified 1902
297 Ga0157376_10001554 3300014969 Bacteria 15159
298 Ga0157376_10017982 3300014969 Bacteria 5408
299 Ga0157376_10067002 3300014969 Bacteria 3036
300 Ga0157376_10070767 3300014969 Bacteria 2962
301 Ga0182006_1025547 3300015261 Unclassified 2425
302 Ga0163161_10009379 3300017792 Bacteria 6775
303 Ga0207682_10003281 3300025893 Bacteria 7075
304 Ga0207710_10004491 3300025900 Bacteria 6079
305 Ga0207688_10013571 3300025901 Bacteria 4429
306 Ga0207647_10004356 3300025904 Bacteria 10496
307 Ga0207647_10010779 3300025904 Bacteria 6435
308 Ga0207685_10004799 3300025905 Bacteria 3487
309 Ga0207699_10006944 3300025906 Bacteria 5513
310 Ga0207699_10056790 3300025906 Bacteria 2335
311 Ga0207699_10063074 3300025906 Bacteria 2237
312 Ga0207645_10001057 3300025907 Bacteria 22820
313 Ga0207643_10003212 3300025908 Bacteria 8806
314 Ga0207705_10116984 3300025909 Bacteria 1974
315 Ga0207684_10039919 3300025910 Bacteria 3979
316 Ga0207654_10000061 3300025911 Bacteria 73179
317 Ga0207654_10000555 3300025911 Bacteria 21187
318 Ga0207654_10005558 3300025911 Bacteria 6376
319 Ga0207654_10043895 3300025911 Unclassified 2536
320 Ga0207654_10053682 3300025911 Bacteria 2327
321 Ga0207707_10005979 3300025912 Bacteria 10647
322 Ga0207695_10000050 3300025913 Bacteria 405727
323 Ga0207695_10000499 3300025913 Bacteria 83531
324 Ga0207695_10000995 3300025913 Bacteria 50150
325 Ga0207695_10001740 3300025913 Bacteria 34580
326 Ga0207695_10015681 3300025913 Bacteria 8913
327 Ga0207695_10018719 3300025913 Bacteria 7996
328 Ga0207695_10047737 3300025913 Bacteria 4528
329 Ga0207695_10084911 3300025913 Bacteria 3195
330 Ga0207695_10087510 3300025913 Bacteria 3138
331 Ga0207695_10131626 3300025913 Bacteria 2459
332 Ga0207671_10000232 3300025914 Bacteria 84103
333 Ga0207671_10004067 3300025914 Bacteria 14170
334 Ga0207671_10025734 3300025914 Unclassified 4417
335 Ga0207671_10029761 3300025914 Bacteria 4076
336 Ga0207671_10071171 3300025914 Bacteria 2594
337 Ga0207693_10000004 3300025915 Bacteria 193261
338 Ga0207693_10000119 3300025915 Bacteria 69804
339 Ga0207693_10033843 3300025915 Bacteria 4031
340 Ga0207693_10043453 3300025915 Bacteria 3535
341 Ga0207693_10061788 3300025915 Bacteria 2934
342 Ga0207663_10028454 3300025916 Bacteria 3272
343 Ga0207663_10036175 3300025916 Bacteria 2969
344 Ga0207662_10004364 3300025918 Bacteria 7426
345 Ga0207657_10000449 3300025919 Bacteria 43787
346 Ga0207657_10001912 3300025919 Bacteria 22493
347 Ga0207657_10020386 3300025919 Bacteria 6265
348 Ga0207649_10007580 3300025920 Bacteria 5900
349 Ga0207649_10059501 3300025920 Bacteria 2397
350 Ga0207652_10016697 3300025921 Bacteria 5999
351 Ga0207694_10001017 3300025924 Bacteria 24441
352 Ga0207694_10001309 3300025924 Bacteria 21414
353 Ga0207694_10001368 3300025924 Bacteria 21003
354 Ga0207694_10008190 3300025924 Bacteria 7900
355 Ga0207694_10166531 3300025924 Unclassified 1783
356 Ga0207650_10000059 3300025925 Bacteria 151427
357 Ga0207650_10009928 3300025925 Bacteria 6513
358 Ga0207687_10001070 3300025927 Bacteria 18559
359 Ga0207687_10011730 3300025927 Bacteria 5733
360 Ga0207687_10020023 3300025927 Bacteria 4437
361 Ga0207700_10001036 3300025928 Bacteria 16037
362 Ga0207700_10001921 3300025928 Bacteria 11818
363 Ga0207700_10010487 3300025928 Bacteria 5851
364 Ga0207700_10028770 3300025928 Unclassified 3913
365 Ga0207700_10052459 3300025928 Bacteria 3049
366 Ga0207700_10071638 3300025928 Bacteria 2669
367 Ga0207664_10000017 3300025929 Bacteria 230967
368 Ga0207664_10004022 3300025929 Bacteria 9913
369 Ga0207664_10061235 3300025929 Bacteria 3002
370 Ga0207644_10003363 3300025931 Bacteria 10321
371 Ga0207644_10065182 3300025931 Bacteria 2648
372 Ga0207706_10000296 3300025933 Bacteria 54072
373 Ga0207706_10002647 3300025933 Bacteria 17447
374 Ga0207706_10002800 3300025933 Bacteria 16943
375 Ga0207706_10028718 3300025933 Bacteria 4965
376 Ga0207670_10032222 3300025936 Bacteria 3368
377 Ga0207665_10000850 3300025939 Bacteria 20643
378 Ga0207665_10005931 3300025939 Bacteria 8131
379 Ga0207665_10075360 3300025939 Bacteria 2311
380 Ga0207691_10008005 3300025940 Bacteria 10162
381 Ga0207691_10010827 3300025940 Bacteria 8755
382 Ga0207711_10007155 3300025941 Bacteria 9353
383 Ga0207711_10106826 3300025941 Bacteria 2484
384 Ga0207711_10127620 3300025941 Bacteria 2277
385 Ga0207689_10001098 3300025942 Bacteria 26082
386 Ga0207689_10002443 3300025942 Bacteria 17311
387 Ga0207689_10015609 3300025942 Bacteria 6432
388 Ga0207689_10042690 3300025942 Bacteria 3749
389 Ga0207689_10118872 3300025942 Unclassified 2174
390 Ga0207661_10000018 3300025944 Bacteria 242506
391 Ga0207661_10000973 3300025944 Bacteria 18869
392 Ga0207661_10005192 3300025944 Bacteria 9155
393 Ga0207661_10075252 3300025944 Bacteria 2770
394 Ga0207679_10000427 3300025945 Bacteria 29877
395 Ga0207667_10000079 3300025949 Bacteria 163341
396 Ga0207667_10003425 3300025949 Bacteria 19576
397 Ga0207667_10004532 3300025949 Bacteria 17022
398 Ga0207667_10005908 3300025949 Bacteria 14907
399 Ga0207667_10010675 3300025949 Bacteria 10720
400 Ga0207667_10075911 3300025949 Bacteria 3488
401 Ga0207651_10021589 3300025960 Bacteria 3917
402 Ga0207668_10073726 3300025972 Bacteria 2447
403 Ga0207640_10005736 3300025981 Bacteria 6764
404 Ga0207658_10011318 3300025986 Bacteria 6073
405 Ga0207658_10105711 3300025986 Unclassified 2214
406 Ga0207677_10000753 3300026023 Bacteria 18654
407 Ga0207677_10002017 3300026023 Archaea 10713
408 Ga0207677_10056856 3300026023 Unclassified 2683
409 Ga0207677_10086007 3300026023 Bacteria 2271
410 Ga0207703_10005407 3300026035 Bacteria 10278
411 Ga0207703_10089252 3300026035 Unclassified 2589
412 Ga0207639_10001235 3300026041 Bacteria 17308
413 Ga0207639_10079213 3300026041 Bacteria 2596
414 Ga0207678_10000476 3300026067 Bacteria 36336
415 Ga0207678_10009033 3300026067 Bacteria 8774
416 Ga0207678_10018482 3300026067 Bacteria 6121
417 Ga0207702_10001914 3300026078 Bacteria 20340
418 Ga0207702_10003459 3300026078 Bacteria 14395
419 Ga0207702_10004521 3300026078 Bacteria 12333
420 Ga0207702_10017670 3300026078 Bacteria 5901
421 Ga0207702_10034300 3300026078 Bacteria 4241
422 Ga0207641_10000025 3300026088 Bacteria 247727
423 Ga0207641_10001373 3300026088 Bacteria 24051
424 Ga0207641_10156844 3300026088 Bacteria 2066
425 Ga0207648_10000151 3300026089 Bacteria 69912
426 Ga0207648_10001734 3300026089 Bacteria 23872
427 Ga0207676_10000252 3300026095 Bacteria 46432
428 Ga0207676_10018067 3300026095 Bacteria 5121
429 Ga0207676_10021276 3300026095 Bacteria 4758
430 Ga0207674_10000162 3300026116 Bacteria 79631
431 Ga0207674_10002086 3300026116 Bacteria 25296
432 Ga0207674_10002450 3300026116 Bacteria 23436
433 Ga0207674_10030309 3300026116 Bacteria 5689
434 Ga0207674_10123495 3300026116 Bacteria 2555
435 Ga0207675_100002440 3300026118 Bacteria 18416
436 Ga0207675_100061753 3300026118 Bacteria 3498
437 Ga0207683_10000225 3300026121 Bacteria 49694
438 Ga0207683_10000815 3300026121 Bacteria 28504
439 Ga0207683_10092583 3300026121 Bacteria 2693
440 Ga0207698_10000008 3300026142 Bacteria 281991
441 Ga0207698_10001996 3300026142 Bacteria 12015
442 Ga0207698_10010263 3300026142 Bacteria 6006
443 Ga0207698_10014569 3300026142 Bacteria 5233
444 Ga0207698_10037301 3300026142 Unclassified 3578
445 Ga0207698_10119256 3300026142 Unclassified 2229
446 Ga0268266_10012912 3300028379 Bacteria 7206
447 Ga0268266_10042253 3300028379 Bacteria 3893
448 Ga0268266_10206104 3300028379 Unclassified 1802
449 Ga0268265_10060216 3300028380 Bacteria 2909
450 Ga0268265_10119820 3300028380 Bacteria 2166
451 Ga0268264_10002830 3300028381 Bacteria 15137
452 Ga0268264_10020253 3300028381 Bacteria 5436
453 Ga0265318_10028358 3300028577 Bacteria 2190
454 Ga0265323_10005508 3300028653 Bacteria 5378
455 Ga0265336_10002621 3300028666 Bacteria 7317
456 Ga0265338_10001846 3300028800 Bacteria 33258
457 Ga0265338_10003121 3300028800 Bacteria 23686
458 Ga0265338_10004949 3300028800 Bacteria 17660
459 Ga0265338_10015022 3300028800 Bacteria 8550
460 Ga0265338_10020744 3300028800 Bacteria 6891
461 Ga0265338_10027470 3300028800 Bacteria 5710
462 Ga0265338_10034714 3300028800 Bacteria 4867
463 Ga0265338_10066064 3300028800 Unclassified 3133
464 Ga0265338_10122483 3300028800 Unclassified 2069
465 Ga0265760_10000861 3300031090 Bacteria 8780
466 Ga0265760_10004210 3300031090 Bacteria 4139
467 Ga0265330_10003771 3300031235 Bacteria 7824
468 Ga0265330_10004657 3300031235 Bacteria 6928
469 Ga0265330_10018157 3300031235 Bacteria 3234
470 Ga0265330_10018354 3300031235 Bacteria 3213
471 Ga0265330_10020443 3300031235 Bacteria 3024
472 Ga0265332_10042852 3300031238 Bacteria 1955
473 Ga0265328_10007374 3300031239 Bacteria 4587
474 Ga0265328_10008353 3300031239 Bacteria 4276
475 Ga0265328_10012594 3300031239 Bacteria 3363
476 Ga0265325_10000515 3300031241 Bacteria 28005
477 Ga0265325_10000731 3300031241 Bacteria 23769
478 Ga0265325_10002504 3300031241 Bacteria 12376
479 Ga0265325_10003635 3300031241 Bacteria 10007
480 Ga0265325_10004243 3300031241 Bacteria 9098
481 Ga0265325_10004445 3300031241 Bacteria 8866
482 Ga0265325_10038175 3300031241 Unclassified 2535
483 Ga0265325_10041963 3300031241 Bacteria 2395
484 Ga0265325_10043186 3300031241 Bacteria 2353
485 Ga0265340_10037917 3300031247 Bacteria 2386
486 Ga0265339_10000081 3300031249 Bacteria 82039
487 Ga0265339_10002003 3300031249 Bacteria 14962
488 Ga0265339_10002593 3300031249 Bacteria 12899
489 Ga0265339_10007929 3300031249 Bacteria 6811
490 Ga0265339_10011078 3300031249 Bacteria 5568
491 Ga0265339_10013890 3300031249 Bacteria 4872
492 Ga0265331_10017523 3300031250 Bacteria 3732
493 Ga0265327_10010465 3300031251 Bacteria 6518
494 Ga0265316_10003282 3300031344 Bacteria 16413
495 Ga0265316_10003316 3300031344 Bacteria 16317
496 Ga0265316_10007178 3300031344 Bacteria 10527
497 Ga0265316_10007229 3300031344 Bacteria 10488
498 Ga0265316_10008207 3300031344 Bacteria 9718
499 Ga0265316_10011579 3300031344 Bacteria 7944
500 Ga0265316_10024239 3300031344 Bacteria 5090
501 Ga0265316_10046167 3300031344 Bacteria 3453
502 Ga0265316_10068924 3300031344 Bacteria 2730
503 Ga0265316_10114137 3300031344 Archaea 2044
504 Ga0265316_10116207 3300031344 Bacteria 2022
505 Ga0307408_100189380 3300031548 Bacteria 1656
506 Ga0265313_10002161 3300031595 Bacteria 17461
507 Ga0265313_10004842 3300031595 Bacteria 10119
508 Ga0265313_10008448 3300031595 Bacteria 6832
509 Ga0265314_10000090 3300031711 Bacteria 137914
510 Ga0265314_10002820 3300031711 Bacteria 17337
511 Ga0265314_10007441 3300031711 Bacteria 9496
512 Ga0265314_10026234 3300031711 Bacteria 4380
513 Ga0265314_10032304 3300031711 Bacteria 3851
514 Ga0265342_10000636 3300031712 Bacteria 36784
515 Ga0265342_10001787 3300031712 Bacteria 19563
516 Ga0265342_10003419 3300031712 Bacteria 13047
517 Ga0265342_10007514 3300031712 Bacteria 7972
518 Ga0265342_10023647 3300031712 Bacteria 3886
519 Ga0265342_10058158 3300031712 Unclassified 2286
520 Ga0265342_10072531 3300031712 Bacteria 2004
521 Ga0316577_10028488 3300031733 Unclassified 3116
522 Ga0307410_10035766 3300031852 Bacteria 3229
523 Ga0307406_10039104 3300031901 Bacteria 2941
524 Ga0307409_100058095 3300031995 Bacteria 3002
525 Ga0307409_100107255 3300031995 Bacteria 2333
526 Ga0307416_100049892 3300032002 Bacteria 3331
527 Ga0307416_100150706 3300032002 Bacteria 2132
528 Ga0307411_10006972 3300032005 Bacteria 5707
529 Ga0373923_0012610 3300035111 Bacteria 3130
530 Ga0373945_0015129 3300035116 Bacteria 2593
531 Ga0373954_0000162 3300035118 Bacteria 23887
532 Ga0373956_0016373 3300035119 Bacteria 3114
533 Ga0373943_0002013 3300035170 Bacteria 9208
534 Ga0373955_0002394 3300035172 Bacteria 8173
535 Ga0373955_0017111 3300035172 Bacteria 3581
536 Ga0373935_0008498 3300035692 Bacteria 6145
537 Ga0373927_0000085 3300035695 Bacteria 70359
538 Ga0373933_0004916 3300035724 Bacteria 7295
539 Ga0373947_0000284 3300035725 Bacteria 28729
540 Ga0373937_0002199 3300036401 Bacteria 16293
541 Ga0373925_0001042 3300037068 Bacteria 25115
542 Ga0373925_0012318 3300037068 Bacteria 6190
543 Ga0373925_0020863 3300037068 Bacteria 4775
544 Ga0395898_0077493 3300037466 Bacteria 3209
545 Ga0436360_0329430 3300039438 Bacteria 2582
546 Ga0436363_0413793 3300039450 Bacteria 1861
547 Ga0451577_0000215 3300042876 Bacteria 120190
548 Ga0451577_0021028 3300042876 Bacteria 5979
549 Ga0451577_0294750 3300042876 Bacteria 1470
550 Ga0466964_0045141 3300044706 Unclassified 1793
551 Ga0453684_0000545 3300044712 Bacteria 142482
552 Ga0466967_0002817 3300045976 Bacteria 11027
553 Ga0466967_0062520 3300045976 Bacteria 3305
554 Ga0466967_0105981 3300045976 Bacteria 2576
555 Ga0495603_0081666 3300046455 Bacteria 1894
556 Ga0495629_0017404 3300046459 Bacteria 5151
557 Ga0495651_0033477 3300046462 Bacteria 4008
558 Ga0495653_0056892 3300046463 Bacteria 2980
559 Ga0495580_0000160 3300046472 Bacteria 49438
560 Ga0495580_0000655 3300046472 Bacteria 29380
561 Ga0495580_0000677 3300046472 Bacteria 28998
562 Ga0495580_0006848 3300046472 Bacteria 9226
563 Ga0495580_0007106 3300046472 Bacteria 9020
564 Ga0495580_0007730 3300046472 Bacteria 8616
565 Ga0495580_0009186 3300046472 Bacteria 7792
566 Ga0495580_0009824 3300046472 Bacteria 7505
567 Ga0495580_0014305 3300046472 Bacteria 6020
568 Ga0495582_0002595 3300046473 Bacteria 10050
569 Ga0495639_0060155 3300046475 Bacteria 1740
570 Ga0495662_0027305 3300046476 Bacteria 2758
571 Ga0495664_0015658 3300046477 Bacteria 4313
572 Ga0495664_0064904 3300046477 Bacteria 2176
573 Ga0495594_0029683 3300046499 Bacteria 2956
574 Ga0495608_0012320 3300046511 Bacteria 5939
575 Ga0495608_0128412 3300046511 Bacteria 1623
576 Ga0495652_0123299 3300046529 Bacteria 2063
577 Ga0495665_0037110 3300046531 Bacteria 2601
578 Ga0495586_0086069 3300046535 Bacteria 1732
579 Ga0495587_0008835 3300046536 Bacteria 6466
580 Ga0495587_0028552 3300046536 Unclassified 3392
581 Ga0495645_0003859 3300046543 Bacteria 10202
582 Ga0495645_0050596 3300046543 Bacteria 3025
583 Ga0495645_0071248 3300046543 Bacteria 2507
584 Ga0495667_0032247 3300046559 Bacteria 3513
585 Ga0495635_0011851 3300046663 Bacteria 6112
586 Ga0495657_0128017 3300046675 Bacteria 1593
587 Ga0495599_0017065 3300046678 Bacteria 4511
588 Ga0495623_0030648 3300046679 Bacteria 3460
589 Ga0495669_0012245 3300046684 Bacteria 3648
590 Ga0495669_0019659 3300046684 Unclassified 2917
591 Ga0495613_0024181 3300046689 Unclassified 4527
592 Ga0495581_0004594 3300047315 Bacteria 7978
593 Ga0495604_0001581 3300047317 Bacteria 18770
594 Ga0495604_0023327 3300047317 Bacteria 4936
595 Ga0495674_0053028 3300047319 Bacteria 3567
596 Ga0495674_0126475 3300047319 Bacteria 2156
597 Ga0495674_0127607 3300047319 Bacteria 2145
598 Ga0495674_0176779 3300047319 Bacteria 1779
599 Ga0495675_0001667 3300047444 Bacteria 13305
600 Ga0495675_0029172 3300047444 Bacteria 3518
601 Ga0495675_0079581 3300047444 Unclassified 2064
602 Ga0495684_0003377 3300047471 Bacteria 12533
603 Ga0495684_0049718 3300047471 Bacteria 3203
604 Ga0495684_0108016 3300047471 Unclassified 2102
605 Ga0495602_0003442 3300048088 Bacteria 16370
606 Ga0495602_0006533 3300048088 Bacteria 12225
607 Ga0495602_0044680 3300048088 Bacteria 4016
608 Ga0495602_0123488 3300048088 Bacteria 2079
609 Ga0496100_0114174 3300048903 Unclassified 1881
610 Ga0496102_0010317 3300048905 Bacteria 8034
611 Ga0496103_0145549 3300048906 Bacteria 1517
612 Ga0496105_0066361 3300048908 Unclassified 2979
613 Ga0496107_0095015 3300048910 Bacteria 2181
614 Ga0496107_0271182 3300048910 Bacteria 1263
615 Ga0496108_0000210 3300048911 Bacteria 53448
616 Ga0496109_0000228 3300048912 Bacteria 54849
617 Ga0496110_0009065 3300048913 Bacteria 8031
618 Ga0496112_0000048 3300048915 Bacteria 84789
619 Ga0496112_0041047 3300048915 Bacteria 4526
620 Ga0496112_0141323 3300048915 Unclassified 2376
621 Ga0496113_0001188 3300048916 Bacteria 14242
622 Ga0496113_0039793 3300048916 Unclassified 3461
623 Ga0496115_0007893 3300048918 Bacteria 7851
624 Ga0496115_0119300 3300048918 Unclassified 2170
625 Ga0496115_0135945 3300048918 Bacteria 2027
626 nmdc:mga0n895_1227_c1 3300050512 Bacteria 18920
627 nmdc:mga08x19_37115_c1 3300050514 Bacteria 3091
628 nmdc:mga08x19_4193_c1 3300050514 Bacteria 8541
629 Ga0495619_0010522 3300053085 Bacteria 5821
630 Ga0501082_0000009 3300060353 Bacteria 123279

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048910 Ga0496107_0271182 Ga0496107_0271182_72_1253 390
2 3300025942 Ga0207689_10118872 Ga0207689_101188722 404
3 3300028800 Ga0265338_10020744 Ga0265338_100207444 409
4 3300013308 Ga0157375_10004378 Ga0157375_1000437810 422
5 3300028577 Ga0265318_10028358 Ga0265318_100283582 423
6 3300028800 Ga0265338_10034714 Ga0265338_100347142 423
7 3300031235 Ga0265330_10004657 Ga0265330_100046574 423
8 3300031238 Ga0265332_10042852 Ga0265332_100428522 423
9 3300031241 Ga0265325_10004243 Ga0265325_100042435 423
10 3300031595 Ga0265313_10002161 Ga0265313_100021614 423
11 3300031712 Ga0265342_10001787 Ga0265342_100017875 423
12 3300009553 Ga0105249_10049912 Ga0105249_100499122 424
13 3300042876 Ga0451577_0294750 Ga0451577_0294750_25_1356 432
14 3300031344 Ga0265316_10116207 Ga0265316_101162072 435
15 3300031251 Ga0265327_10010465 Ga0265327_100104653 439
16 3300031241 Ga0265325_10004445 Ga0265325_100044454 440
17 3300047319 Ga0495674_0176779 Ga0495674_0176779_253_1740 441
18 3300028800 Ga0265338_10015022 Ga0265338_100150225 443
19 3300031711 Ga0265314_10000090 Ga0265314_1000009075 443
20 3300005329 Ga0070683_100000013 Ga0070683_100000013135 445
21 3300005535 Ga0070684_100000151 Ga0070684_10000015122 445
22 3300025944 Ga0207661_10000018 Ga0207661_10000018135 445
23 3300028653 Ga0265323_10005508 Ga0265323_100055083 445
24 3300006028 Ga0070717_10066874 Ga0070717_100668742 447
25 3300046543 Ga0495645_0071248 Ga0495645_0071248_569_2014 449
26 3300005535 Ga0070684_100081301 Ga0070684_1000813012 450
27 3300014325 Ga0163163_10099947 Ga0163163_100999471 450
28 3300014969 Ga0157376_10017982 Ga0157376_100179824 450
29 3300025941 Ga0207711_10127620 Ga0207711_101276202 450
30 3300046472 Ga0495580_0000160 Ga0495580_0000160_29671_31122 450
31 3300047471 Ga0495684_0003377 Ga0495684_0003377_2583_4034 450
32 3300048088 Ga0495602_0006533 Ga0495602_0006533_7814_9265 450
33 3300014325 Ga0163163_10003532 Ga0163163_100035327 453
34 3300060353 Ga0501082_0000009 Ga0501082_0000009_101025_102458 453
35 3300031344 Ga0265316_10003316 Ga0265316_1000331617 455
36 3300014969 Ga0157376_10067002 Ga0157376_100670023 456
37 3300005548 Ga0070665_100087148 Ga0070665_1000871483 457
38 3300013105 Ga0157369_10076314 Ga0157369_100763142 457
39 3300028800 Ga0265338_10001846 Ga0265338_1000184624 457
40 3300031239 Ga0265328_10007374 Ga0265328_100073742 457
41 3300031249 Ga0265339_10002593 Ga0265339_100025937 457
42 3300031344 Ga0265316_10007178 Ga0265316_100071789 457
43 3300031711 Ga0265314_10002820 Ga0265314_1000282010 457
44 3300031712 Ga0265342_10023647 Ga0265342_100236472 457
45 3300031344 Ga0265316_10114137 Ga0265316_101141372 459
46 3300047319 Ga0495674_0126475 Ga0495674_0126475_549_2015 459
47 3300047471 Ga0495684_0049718 Ga0495684_0049718_1266_2732 459
48 3300005329 Ga0070683_100019637 Ga0070683_1000196373 460
49 3300009093 Ga0105240_10000788 Ga0105240_1000078819 460
50 3300025913 Ga0207695_10018719 Ga0207695_100187197 460
51 3300025944 Ga0207661_10075252 Ga0207661_100752522 460
52 3300005436 Ga0070713_100002320 Ga0070713_1000023202 462
53 3300009093 Ga0105240_10022446 Ga0105240_100224463 462
54 3300009093 Ga0105240_10039426 Ga0105240_100394266 462
55 3300009177 Ga0105248_10023606 Ga0105248_100236062 462
56 3300009545 Ga0105237_10054638 Ga0105237_100546383 462
57 3300025913 Ga0207695_10087510 Ga0207695_100875102 462
58 3300025914 Ga0207671_10029761 Ga0207671_100297613 462
59 3300025928 Ga0207700_10001921 Ga0207700_100019219 462
60 3300005549 Ga0070704_100179464 Ga0070704_1001794641 464
61 3300031733 Ga0316577_10028488 Ga0316577_100284882 464
62 3300031344 Ga0265316_10068924 Ga0265316_100689242 465
63 3300039450 Ga0436363_0413793 Ga0436363_0413793_222_1676 466
64 3300031712 Ga0265342_10003419 Ga0265342_100034196 467
65 3300046462 Ga0495651_0033477 Ga0495651_0033477_2375_3826 467
66 3300046463 Ga0495653_0056892 Ga0495653_0056892_1166_2617 467
67 3300046476 Ga0495662_0027305 Ga0495662_0027305_80_1531 467
68 3300046477 Ga0495664_0064904 Ga0495664_0064904_271_1722 467
69 3300046511 Ga0495608_0128412 Ga0495608_0128412_52_1503 467
70 3300046529 Ga0495652_0123299 Ga0495652_0123299_189_1640 467
71 3300046559 Ga0495667_0032247 Ga0495667_0032247_909_2360 467
72 3300046663 Ga0495635_0011851 Ga0495635_0011851_1657_3108 467
73 3300046678 Ga0495599_0017065 Ga0495599_0017065_2670_4121 467
74 3300047317 Ga0495604_0023327 Ga0495604_0023327_684_2135 467
75 3300047444 Ga0495675_0029172 Ga0495675_0029172_1957_3408 467
76 3300013307 Ga0157372_10048853 Ga0157372_100488534 468
77 3300031712 Ga0265342_10058158 Ga0265342_100581582 468
78 3300046472 Ga0495580_0014305 Ga0495580_0014305_1713_3164 469
79 3300046543 Ga0495645_0003859 Ga0495645_0003859_7075_8526 469
80 3300047444 Ga0495675_0079581 Ga0495675_0079581_146_1720 469
81 3300047471 Ga0495684_0108016 Ga0495684_0108016_339_1790 469
82 3300005329 Ga0070683_100002212 Ga0070683_10000221212 470
83 3300005535 Ga0070684_100000918 Ga0070684_10000091821 470
84 3300005563 Ga0068855_100032325 Ga0068855_1000323257 470
85 3300009174 Ga0105241_10042275 Ga0105241_100422753 470
86 3300010375 Ga0105239_10052149 Ga0105239_100521492 470
87 3300013297 Ga0157378_10037231 Ga0157378_100372313 470
88 3300013308 Ga0157375_10224344 Ga0157375_102243442 470
89 3300014968 Ga0157379_10181467 Ga0157379_101814671 470
90 3300025944 Ga0207661_10005192 Ga0207661_100051925 470
91 3300031239 Ga0265328_10012594 Ga0265328_100125943 470
92 3300031241 Ga0265325_10041963 Ga0265325_100419631 470
93 3300031249 Ga0265339_10000081 Ga0265339_1000008149 470
94 3300031712 Ga0265342_10000636 Ga0265342_1000063612 470
95 3300048918 Ga0496115_0119300 Ga0496115_0119300_555_2006 470
96 3300009098 Ga0105245_10067329 Ga0105245_100673292 471
97 3300028666 Ga0265336_10002621 Ga0265336_100026214 471
98 3300005355 Ga0070671_100122775 Ga0070671_1001227752 472
99 3300005364 Ga0070673_100070373 Ga0070673_1000703732 472
100 3300005535 Ga0070684_100048948 Ga0070684_1000489483 472
101 3300005539 Ga0068853_100009757 Ga0068853_1000097576 472
102 3300005548 Ga0070665_100010943 Ga0070665_1000109438 472
103 3300005577 Ga0068857_100000509 Ga0068857_1000005099 472
104 3300005614 Ga0068856_100009363 Ga0068856_1000093638 472
105 3300005616 Ga0068852_100034185 Ga0068852_1000341852 472
106 3300006237 Ga0097621_100002052 Ga0097621_1000020524 472
107 3300009093 Ga0105240_10008539 Ga0105240_100085394 472
108 3300009174 Ga0105241_10000173 Ga0105241_1000017326 472
109 3300009174 Ga0105241_10074747 Ga0105241_100747472 472
110 3300009177 Ga0105248_10281723 Ga0105248_102817232 472
111 3300009551 Ga0105238_10001940 Ga0105238_100019408 472
112 3300010375 Ga0105239_10000496 Ga0105239_1000049624 472
113 3300013105 Ga0157369_10013448 Ga0157369_100134483 472
114 3300013105 Ga0157369_10050913 Ga0157369_100509134 472
115 3300013296 Ga0157374_10004725 Ga0157374_100047253 472
116 3300013296 Ga0157374_10006358 Ga0157374_100063588 472
117 3300013297 Ga0157378_10021508 Ga0157378_100215082 472
118 3300014968 Ga0157379_10149201 Ga0157379_101492012 472
119 3300014969 Ga0157376_10070767 Ga0157376_100707672 472
120 3300025911 Ga0207654_10000061 Ga0207654_1000006124 472
121 3300025913 Ga0207695_10000499 Ga0207695_1000049926 472
122 3300025924 Ga0207694_10001368 Ga0207694_1000136811 472
123 3300025931 Ga0207644_10065182 Ga0207644_100651822 472
124 3300025940 Ga0207691_10010827 Ga0207691_100108273 472
125 3300025941 Ga0207711_10106826 Ga0207711_101068262 472
126 3300026041 Ga0207639_10079213 Ga0207639_100792132 472
127 3300026067 Ga0207678_10018482 Ga0207678_100184823 472
128 3300026078 Ga0207702_10017670 Ga0207702_100176704 472
129 3300026116 Ga0207674_10002086 Ga0207674_100020869 472
130 3300026121 Ga0207683_10000815 Ga0207683_1000081514 472
131 3300028379 Ga0268266_10042253 Ga0268266_100422533 472
132 3300031235 Ga0265330_10018354 Ga0265330_100183543 472
133 3300031249 Ga0265339_10007929 Ga0265339_100079294 472
134 3300046459 Ga0495629_0017404 Ga0495629_0017404_3463_4923 472
135 3300046536 Ga0495587_0028552 Ga0495587_0028552_190_1653 472
136 3300046689 Ga0495613_0024181 Ga0495613_0024181_1220_2683 472
137 3300048088 Ga0495602_0044680 Ga0495602_0044680_1919_3379 472
138 3300005327 Ga0070658_10021163 Ga0070658_100211633 473
139 3300005328 Ga0070676_10001940 Ga0070676_100019408 473
140 3300005329 Ga0070683_100020754 Ga0070683_1000207544 473
141 3300005344 Ga0070661_100036026 Ga0070661_1000360263 473
142 3300005455 Ga0070663_100078530 Ga0070663_1000785302 473
143 3300005456 Ga0070678_100022702 Ga0070678_1000227023 473
144 3300005535 Ga0070684_100036163 Ga0070684_1000361635 473
145 3300005539 Ga0068853_100006775 Ga0068853_1000067758 473
146 3300005563 Ga0068855_100004407 Ga0068855_1000044076 473
147 3300005578 Ga0068854_100072241 Ga0068854_1000722412 473
148 3300005578 Ga0068854_100099845 Ga0068854_1000998452 473
149 3300005614 Ga0068856_100004935 Ga0068856_1000049353 473
150 3300005614 Ga0068856_100007757 Ga0068856_1000077578 473
151 3300005614 Ga0068856_100020598 Ga0068856_1000205986 473
152 3300005616 Ga0068852_100000004 Ga0068852_1000000045 473
153 3300005616 Ga0068852_100245993 Ga0068852_1002459932 473
154 3300005842 Ga0068858_100078478 Ga0068858_1000784782 473
155 3300006881 Ga0068865_100002522 Ga0068865_1000025227 473
156 3300009093 Ga0105240_10004821 Ga0105240_100048214 473
157 3300009093 Ga0105240_10008484 Ga0105240_100084845 473
158 3300009174 Ga0105241_10022319 Ga0105241_100223192 473
159 3300009551 Ga0105238_10030707 Ga0105238_100307072 473
160 3300009551 Ga0105238_10145991 Ga0105238_101459912 473
161 3300010375 Ga0105239_10025864 Ga0105239_100258645 473
162 3300013100 Ga0157373_10052906 Ga0157373_100529062 473
163 3300013104 Ga0157370_10000016 Ga0157370_100000165 473
164 3300013105 Ga0157369_10000287 Ga0157369_100002875 473
165 3300013105 Ga0157369_10027807 Ga0157369_100278073 473
166 3300013105 Ga0157369_10049764 Ga0157369_100497642 473
167 3300013296 Ga0157374_10293982 Ga0157374_102939822 473
168 3300013307 Ga0157372_10002345 Ga0157372_1000234514 473
169 3300013307 Ga0157372_10003981 Ga0157372_1000398113 473
170 3300013307 Ga0157372_10033808 Ga0157372_100338084 473
171 3300025904 Ga0207647_10004356 Ga0207647_1000435612 473
172 3300025909 Ga0207705_10116984 Ga0207705_101169842 473
173 3300025913 Ga0207695_10000050 Ga0207695_10000050355 473
174 3300025920 Ga0207649_10059501 Ga0207649_100595012 473
175 3300025933 Ga0207706_10002647 Ga0207706_1000264710 473
176 3300025942 Ga0207689_10015609 Ga0207689_100156093 473
177 3300025949 Ga0207667_10004532 Ga0207667_100045326 473
178 3300025949 Ga0207667_10005908 Ga0207667_100059084 473
179 3300025960 Ga0207651_10021589 Ga0207651_100215892 473
180 3300025986 Ga0207658_10105711 Ga0207658_101057112 473
181 3300026142 Ga0207698_10000008 Ga0207698_100000085 473
182 3300026142 Ga0207698_10010263 Ga0207698_100102634 473
183 3300026142 Ga0207698_10119256 Ga0207698_101192562 473
184 3300028379 Ga0268266_10206104 Ga0268266_102061042 473
185 3300048906 Ga0496103_0145549 Ga0496103_0145549_36_1457 473
186 3300005329 Ga0070683_100000232 Ga0070683_10000023220 474
187 3300005329 Ga0070683_100102183 Ga0070683_1001021832 474
188 3300005331 Ga0070670_100015754 Ga0070670_1000157545 474
189 3300005334 Ga0068869_100001157 Ga0068869_1000011572 474
190 3300005338 Ga0068868_100001786 Ga0068868_10000178612 474
191 3300005344 Ga0070661_100006756 Ga0070661_1000067568 474
192 3300005344 Ga0070661_100032369 Ga0070661_1000323691 474
193 3300005355 Ga0070671_100000991 Ga0070671_10000099113 474
194 3300005367 Ga0070667_100003330 Ga0070667_1000033303 474
195 3300005535 Ga0070684_100000295 Ga0070684_10000029513 474
196 3300005539 Ga0068853_100000794 Ga0068853_10000079412 474
197 3300005577 Ga0068857_100009850 Ga0068857_1000098505 474
198 3300005614 Ga0068856_100003955 Ga0068856_1000039553 474
199 3300005614 Ga0068856_100006639 Ga0068856_1000066394 474
200 3300005616 Ga0068852_100002216 Ga0068852_1000022166 474
201 3300005617 Ga0068859_100002047 Ga0068859_1000020475 474
202 3300005618 Ga0068864_100001014 Ga0068864_1000010144 474
203 3300005841 Ga0068863_100000629 Ga0068863_10000062923 474
204 3300005842 Ga0068858_100002136 Ga0068858_10000213611 474
205 3300005843 Ga0068860_100000733 Ga0068860_10000073328 474
206 3300006237 Ga0097621_100000590 Ga0097621_1000005904 474
207 3300006358 Ga0068871_100008135 Ga0068871_1000081352 474
208 3300006931 Ga0097620_100002047 Ga0097620_1000020475 474
209 3300009093 Ga0105240_10000471 Ga0105240_1000047118 474
210 3300009093 Ga0105240_10052307 Ga0105240_100523074 474
211 3300009098 Ga0105245_10002635 Ga0105245_100026353 474
212 3300009101 Ga0105247_10002244 Ga0105247_100022443 474
213 3300009174 Ga0105241_10000697 Ga0105241_100006973 474
214 3300009174 Ga0105241_10005272 Ga0105241_100052723 474
215 3300009545 Ga0105237_10003673 Ga0105237_1000367312 474
216 3300009551 Ga0105238_10004120 Ga0105238_1000412011 474
217 3300009551 Ga0105238_10004462 Ga0105238_100044628 474
218 3300010375 Ga0105239_10005441 Ga0105239_100054413 474
219 3300010375 Ga0105239_10008702 Ga0105239_100087027 474
220 3300011119 Ga0105246_10000227 Ga0105246_1000022711 474
221 3300013105 Ga0157369_10008094 Ga0157369_100080947 474
222 3300013297 Ga0157378_10002892 Ga0157378_100028922 474
223 3300013297 Ga0157378_10008074 Ga0157378_100080743 474
224 3300013306 Ga0163162_10004024 Ga0163162_1000402411 474
225 3300013307 Ga0157372_10013140 Ga0157372_100131404 474
226 3300013307 Ga0157372_10062985 Ga0157372_100629852 474
227 3300013308 Ga0157375_10002161 Ga0157375_100021614 474
228 3300014325 Ga0163163_10002031 Ga0163163_100020313 474
229 3300014968 Ga0157379_10012846 Ga0157379_100128464 474
230 3300014969 Ga0157376_10001554 Ga0157376_100015543 474
231 3300025911 Ga0207654_10000555 Ga0207654_1000055512 474
232 3300025911 Ga0207654_10005558 Ga0207654_100055585 474
233 3300025913 Ga0207695_10001740 Ga0207695_100017405 474
234 3300025913 Ga0207695_10015681 Ga0207695_100156817 474
235 3300025914 Ga0207671_10000232 Ga0207671_1000023258 474
236 3300025914 Ga0207671_10004067 Ga0207671_100040676 474
237 3300025924 Ga0207694_10001017 Ga0207694_100010172 474
238 3300025924 Ga0207694_10001309 Ga0207694_1000130912 474
239 3300025924 Ga0207694_10166531 Ga0207694_101665312 474
240 3300025925 Ga0207650_10009928 Ga0207650_100099285 474
241 3300025927 Ga0207687_10001070 Ga0207687_100010705 474
242 3300025929 Ga0207664_10061235 Ga0207664_100612352 474
243 3300025931 Ga0207644_10003363 Ga0207644_100033634 474
244 3300025942 Ga0207689_10001098 Ga0207689_100010984 474
245 3300025949 Ga0207667_10010675 Ga0207667_100106757 474
246 3300025986 Ga0207658_10011318 Ga0207658_100113182 474
247 3300026023 Ga0207677_10000753 Ga0207677_1000075311 474
248 3300026035 Ga0207703_10005407 Ga0207703_100054078 474
249 3300026041 Ga0207639_10001235 Ga0207639_100012358 474
250 3300026078 Ga0207702_10003459 Ga0207702_1000345914 474
251 3300026078 Ga0207702_10004521 Ga0207702_100045218 474
252 3300026088 Ga0207641_10001373 Ga0207641_100013738 474
253 3300026095 Ga0207676_10021276 Ga0207676_100212763 474
254 3300026116 Ga0207674_10002450 Ga0207674_100024504 474
255 3300026142 Ga0207698_10001996 Ga0207698_100019967 474
256 3300028381 Ga0268264_10002830 Ga0268264_100028308 474
257 3300028800 Ga0265338_10004949 Ga0265338_100049492 474
258 3300028800 Ga0265338_10027470 Ga0265338_100274704 474
259 3300031711 Ga0265314_10032304 Ga0265314_100323042 474
260 3300035172 Ga0373955_0017111 Ga0373955_0017111_914_2464 474
261 3300037466 Ga0395898_0077493 Ga0395898_0077493_836_2302 474
262 3300025929 Ga0207664_10004022 Ga0207664_100040223 475
263 3300031235 Ga0265330_10003771 Ga0265330_100037712 475
264 3300031235 Ga0265330_10020443 Ga0265330_100204432 475
265 3300031241 Ga0265325_10000731 Ga0265325_100007317 475
266 3300031249 Ga0265339_10002003 Ga0265339_100020038 475
267 3300031344 Ga0265316_10003282 Ga0265316_1000328213 475
268 3300031344 Ga0265316_10007229 Ga0265316_100072298 475
269 3300031595 Ga0265313_10008448 Ga0265313_100084484 475
270 3300031712 Ga0265342_10007514 Ga0265342_100075144 475
271 3300005327 Ga0070658_10009911 Ga0070658_100099116 476
272 3300005336 Ga0070680_100009850 Ga0070680_1000098504 476
273 3300005339 Ga0070660_100001797 Ga0070660_1000017975 476
274 3300005458 Ga0070681_10001151 Ga0070681_100011513 476
275 3300005530 Ga0070679_100006004 Ga0070679_1000060048 476
276 3300005563 Ga0068855_100002307 Ga0068855_1000023078 476
277 3300005577 Ga0068857_100047871 Ga0068857_1000478713 476
278 3300005616 Ga0068852_100005699 Ga0068852_1000056994 476
279 3300009093 Ga0105240_10049613 Ga0105240_100496133 476
280 3300009551 Ga0105238_10002721 Ga0105238_100027215 476
281 3300013102 Ga0157371_10061194 Ga0157371_100611942 476
282 3300013104 Ga0157370_10013716 Ga0157370_100137167 476
283 3300013307 Ga0157372_10001533 Ga0157372_1000153314 476
284 3300025912 Ga0207707_10005979 Ga0207707_100059792 476
285 3300025913 Ga0207695_10000995 Ga0207695_100009958 476
286 3300025919 Ga0207657_10000449 Ga0207657_1000044920 476
287 3300025921 Ga0207652_10016697 Ga0207652_100166974 476
288 3300025924 Ga0207694_10008190 Ga0207694_100081903 476
289 3300025949 Ga0207667_10000079 Ga0207667_1000007914 476
290 3300026116 Ga0207674_10123495 Ga0207674_101234952 476
291 3300026142 Ga0207698_10037301 Ga0207698_100373014 476
292 3300046684 Ga0495669_0019659 Ga0495669_0019659_1123_2562 476
293 3300031241 Ga0265325_10003635 Ga0265325_100036357 477
294 3300031344 Ga0265316_10011579 Ga0265316_100115794 477
295 3300031712 Ga0265342_10072531 Ga0265342_100725312 477
296 3300045976 Ga0466967_0062520 Ga0466967_0062520_705_2180 477
297 3300013307 Ga0157372_10013600 Ga0157372_100136004 478
298 3300031235 Ga0265330_10018157 Ga0265330_100181572 478
299 3300031241 Ga0265325_10043186 Ga0265325_100431862 478
300 3300031247 Ga0265340_10037917 Ga0265340_100379171 478
301 3300031344 Ga0265316_10008207 Ga0265316_100082075 478
302 3300005329 Ga0070683_100014899 Ga0070683_1000148991 480
303 3300005436 Ga0070713_100151289 Ga0070713_1001512892 480
304 3300005535 Ga0070684_100144857 Ga0070684_1001448572 480
305 3300005618 Ga0068864_100012908 Ga0068864_1000129087 480
306 3300005841 Ga0068863_100039701 Ga0068863_1000397013 480
307 3300009177 Ga0105248_10077774 Ga0105248_100777742 480
308 3300014325 Ga0163163_10005991 Ga0163163_100059913 480
309 3300014325 Ga0163163_10024622 Ga0163163_100246224 480
310 3300025911 Ga0207654_10053682 Ga0207654_100536822 480
311 3300026095 Ga0207676_10018067 Ga0207676_100180674 480
312 3300046475 Ga0495639_0060155 Ga0495639_0060155_60_1511 480
313 3300046531 Ga0495665_0037110 Ga0495665_0037110_397_1848 480
314 3300047315 Ga0495581_0004594 Ga0495581_0004594_2320_3771 480
315 3300048915 Ga0496112_0041047 Ga0496112_0041047_1830_3281 480
316 3300053085 Ga0495619_0010522 Ga0495619_0010522_576_2027 480
317 3300013105 Ga0157369_10001929 Ga0157369_1000192911 481
318 3300031241 Ga0265325_10000515 Ga0265325_100005157 481
319 3300031250 Ga0265331_10017523 Ga0265331_100175233 481
320 3300031344 Ga0265316_10046167 Ga0265316_100461672 481
321 3300031548 Ga0307408_100189380 Ga0307408_1001893801 481
322 3300031595 Ga0265313_10004842 Ga0265313_100048424 481
323 3300031852 Ga0307410_10035766 Ga0307410_100357662 481
324 3300031901 Ga0307406_10039104 Ga0307406_100391042 481
325 3300031995 Ga0307409_100058095 Ga0307409_1000580953 481
326 3300031995 Ga0307409_100107255 Ga0307409_1001072552 481
327 3300032002 Ga0307416_100049892 Ga0307416_1000498923 481
328 3300032002 Ga0307416_100150706 Ga0307416_1001507061 481
329 3300032005 Ga0307411_10006972 Ga0307411_100069723 481
330 3300042876 Ga0451577_0021028 Ga0451577_0021028_4390_5841 481
331 3300028800 Ga0265338_10122483 Ga0265338_101224832 482
332 3300031241 Ga0265325_10038175 Ga0265325_100381752 482
333 3300035118 Ga0373954_0000162 Ga0373954_0000162_3194_4663 482
334 3300035119 Ga0373956_0016373 Ga0373956_0016373_726_2195 482
335 3300035172 Ga0373955_0002394 Ga0373955_0002394_5508_6977 482
336 3300035724 Ga0373933_0004916 Ga0373933_0004916_4852_6321 482
337 3300036401 Ga0373937_0002199 Ga0373937_0002199_6954_8423 482
338 3300046511 Ga0495608_0012320 Ga0495608_0012320_1376_2845 482
339 3300046536 Ga0495587_0008835 Ga0495587_0008835_1889_3358 482
340 3300046679 Ga0495623_0030648 Ga0495623_0030648_1956_3425 482
341 3300047317 Ga0495604_0001581 Ga0495604_0001581_3320_4789 482
342 3300048088 Ga0495602_0003442 Ga0495602_0003442_12613_14082 482
343 3300042876 Ga0451577_0000215 Ga0451577_0000215_86869_88341 484
344 3300044712 Ga0453684_0000545 Ga0453684_0000545_133207_134679 484
345 3300045976 Ga0466967_0002817 Ga0466967_0002817_1634_3100 485
346 3300005436 Ga0070713_100023325 Ga0070713_1000233252 487
347 3300005616 Ga0068852_100135694 Ga0068852_1001356942 487
348 3300006028 Ga0070717_10023307 Ga0070717_100233072 487
349 3300009545 Ga0105237_10088178 Ga0105237_100881782 487
350 3300009551 Ga0105238_10039762 Ga0105238_100397622 487
351 3300014325 Ga0163163_10010003 Ga0163163_100100032 487
352 3300025913 Ga0207695_10131626 Ga0207695_101316262 487
353 3300025914 Ga0207671_10071171 Ga0207671_100711712 487
354 3300025928 Ga0207700_10071638 Ga0207700_100716382 487
355 3300046455 Ga0495603_0081666 Ga0495603_0081666_151_1638 487
356 3300046499 Ga0495594_0029683 Ga0495594_0029683_1231_2718 487
357 3300046535 Ga0495586_0086069 Ga0495586_0086069_69_1556 487
358 3300046675 Ga0495657_0128017 Ga0495657_0128017_38_1525 487
359 3300046684 Ga0495669_0012245 Ga0495669_0012245_1079_2566 487
360 3300047319 Ga0495674_0127607 Ga0495674_0127607_291_1778 487
361 3300047444 Ga0495675_0001667 Ga0495675_0001667_6342_7829 487
362 3300031711 Ga0265314_10007441 Ga0265314_100074414 491
363 3300005338 Ga0068868_100003783 Ga0068868_1000037833 493
364 3300005434 Ga0070709_10022335 Ga0070709_100223354 493
365 3300005841 Ga0068863_100174388 Ga0068863_1001743882 493
366 3300006237 Ga0097621_100000655 Ga0097621_10000065512 493
367 3300006237 Ga0097621_100050999 Ga0097621_1000509992 493
368 3300013297 Ga0157378_10000256 Ga0157378_1000025610 493
369 3300013306 Ga0163162_10056233 Ga0163162_100562334 493
370 3300026023 Ga0207677_10002017 Ga0207677_100020173 493
371 3300006914 Ga0075436_100029764 Ga0075436_1000297643 494
372 3300007076 Ga0075435_100036831 Ga0075435_1000368312 494
373 3300025906 Ga0207699_10006944 Ga0207699_100069442 494
374 3300050514 nmdc:mga08x19_4193_c1 nmdc:mga08x19_4193_c1_6343_7842 494
375 3300005435 Ga0070714_100024698 Ga0070714_1000246982 495
376 3300005614 Ga0068856_100009962 Ga0068856_1000099627 495
377 3300006914 Ga0075436_100005126 Ga0075436_1000051269 495
378 3300009093 Ga0105240_10056186 Ga0105240_100561865 495
379 3300013307 Ga0157372_10009817 Ga0157372_1000981710 495
380 3300013307 Ga0157372_10031547 Ga0157372_100315474 495
381 3300025913 Ga0207695_10084911 Ga0207695_100849112 495
382 3300026078 Ga0207702_10001914 Ga0207702_100019147 495
383 3300031711 Ga0265314_10026234 Ga0265314_100262344 495
384 3300050514 nmdc:mga08x19_37115_c1 nmdc:mga08x19_37115_c1_1338_2840 495
385 3300026088 Ga0207641_10156844 Ga0207641_101568442 496
386 3300031344 Ga0265316_10024239 Ga0265316_100242394 496
387 3300005435 Ga0070714_100054217 Ga0070714_1000542172 497
388 3300005436 Ga0070713_100014596 Ga0070713_1000145964 497
389 3300014325 Ga0163163_10022862 Ga0163163_100228625 497
390 3300025906 Ga0207699_10056790 Ga0207699_100567902 497
391 3300025928 Ga0207700_10010487 Ga0207700_100104872 497
392 3300031090 Ga0265760_10000861 Ga0265760_100008616 497
393 3300044706 Ga0466964_0045141 Ga0466964_0045141_243_1739 497
394 3300046472 Ga0495580_0000677 Ga0495580_0000677_27247_28743 497
395 3300046472 Ga0495580_0009186 Ga0495580_0009186_5482_6987 497
396 3300005436 Ga0070713_100000162 Ga0070713_10000016244 498
397 3300005436 Ga0070713_100119592 Ga0070713_1001195922 498
398 3300005563 Ga0068855_100149224 Ga0068855_1001492242 498
399 3300005844 Ga0068862_100084550 Ga0068862_1000845502 498
400 3300006028 Ga0070717_10106331 Ga0070717_101063312 498
401 3300006028 Ga0070717_10155256 Ga0070717_101552561 498
402 3300006163 Ga0070715_10016820 Ga0070715_100168202 498
403 3300006173 Ga0070716_100003763 Ga0070716_1000037632 498
404 3300006175 Ga0070712_100006085 Ga0070712_1000060858 498
405 3300009098 Ga0105245_10002051 Ga0105245_1000205112 498
406 3300025906 Ga0207699_10063074 Ga0207699_100630741 498
407 3300025915 Ga0207693_10000119 Ga0207693_1000011965 498
408 3300025928 Ga0207700_10028770 Ga0207700_100287702 498
409 3300025939 Ga0207665_10005931 Ga0207665_100059313 498
410 3300025939 Ga0207665_10075360 Ga0207665_100753601 498
411 3300031090 Ga0265760_10004210 Ga0265760_100042103 498
412 3300046472 Ga0495580_0007106 Ga0495580_0007106_3130_4638 498
413 3300005435 Ga0070714_100023105 Ga0070714_1000231055 499
414 3300005439 Ga0070711_100003803 Ga0070711_10000380311 499
415 3300005467 Ga0070706_100012515 Ga0070706_1000125155 499
416 3300006028 Ga0070717_10005985 Ga0070717_100059857 499
417 3300006028 Ga0070717_10103686 Ga0070717_101036862 499
418 3300006175 Ga0070712_100000057 Ga0070712_10000005732 499
419 3300006175 Ga0070712_100040964 Ga0070712_1000409643 499
420 3300014497 Ga0182008_10007647 Ga0182008_100076472 499
421 3300025905 Ga0207685_10004799 Ga0207685_100047992 499
422 3300025910 Ga0207684_10039919 Ga0207684_100399192 499
423 3300025915 Ga0207693_10000004 Ga0207693_10000004150 499
424 3300025915 Ga0207693_10043453 Ga0207693_100434532 499
425 3300025928 Ga0207700_10001036 Ga0207700_1000103616 499
426 3300025928 Ga0207700_10052459 Ga0207700_100524592 499
427 3300028380 Ga0268265_10119820 Ga0268265_101198201 499
428 3300031241 Ga0265325_10002504 Ga0265325_100025048 499
429 3300035692 Ga0373935_0008498 Ga0373935_0008498_2708_4210 499
430 3300037068 Ga0373925_0020863 Ga0373925_0020863_1360_2862 499
431 3300045976 Ga0466967_0105981 Ga0466967_0105981_1050_2561 499
432 3300046472 Ga0495580_0009824 Ga0495580_0009824_2669_4186 499
433 3300046543 Ga0495645_0050596 Ga0495645_0050596_274_1776 499
434 3300047319 Ga0495674_0053028 Ga0495674_0053028_768_2270 499
435 3300048088 Ga0495602_0123488 Ga0495602_0123488_512_2023 499
436 3300048918 Ga0496115_0007893 Ga0496115_0007893_1088_2590 499
437 3300001976 JGI24752J21851_1001586 JGI24752J21851_10015862 500
438 3300001991 JGI24743J22301_10000320 JGI24743J22301_100003204 500
439 3300002239 JGI24034J26672_10000626 JGI24034J26672_100006264 500
440 3300002459 JGI24751J29686_10000820 JGI24751J29686_100008206 500
441 3300005328 Ga0070676_10018556 Ga0070676_100185562 500
442 3300005329 Ga0070683_100009129 Ga0070683_1000091296 500
443 3300005333 Ga0070677_10022092 Ga0070677_100220922 500
444 3300005337 Ga0070682_100005613 Ga0070682_1000056136 500
445 3300005339 Ga0070660_100003632 Ga0070660_1000036327 500
446 3300005343 Ga0070687_100002133 Ga0070687_1000021336 500
447 3300005347 Ga0070668_100023425 Ga0070668_1000234253 500
448 3300005354 Ga0070675_100027019 Ga0070675_1000270193 500
449 3300005364 Ga0070673_100063291 Ga0070673_1000632911 500
450 3300005365 Ga0070688_100003030 Ga0070688_1000030306 500
451 3300005366 Ga0070659_100003873 Ga0070659_1000038737 500
452 3300005437 Ga0070710_10003631 Ga0070710_100036316 500
453 3300005441 Ga0070700_100060087 Ga0070700_1000600872 500
454 3300005466 Ga0070685_10015501 Ga0070685_100155011 500
455 3300005530 Ga0070679_100065942 Ga0070679_1000659422 500
456 3300005535 Ga0070684_100001871 Ga0070684_1000018718 500
457 3300005544 Ga0070686_100003107 Ga0070686_1000031075 500
458 3300005544 Ga0070686_100044289 Ga0070686_1000442892 500
459 3300005577 Ga0068857_100006523 Ga0068857_1000065237 500
460 3300005615 Ga0070702_100058812 Ga0070702_1000588122 500
461 3300005616 Ga0068852_100013841 Ga0068852_1000138414 500
462 3300005718 Ga0068866_10003613 Ga0068866_100036136 500
463 3300005719 Ga0068861_100004458 Ga0068861_1000044584 500
464 3300005834 Ga0068851_10051141 Ga0068851_100511412 500
465 3300005840 Ga0068870_10003922 Ga0068870_100039225 500
466 3300005841 Ga0068863_100010389 Ga0068863_1000103895 500
467 3300006173 Ga0070716_100000239 Ga0070716_10000023912 500
468 3300006175 Ga0070712_100004797 Ga0070712_1000047972 500
469 3300006175 Ga0070712_100023766 Ga0070712_1000237662 500
470 3300006871 Ga0075434_100006250 Ga0075434_1000062505 500
471 3300006881 Ga0068865_100005956 Ga0068865_1000059566 500
472 3300009098 Ga0105245_10029969 Ga0105245_100299694 500
473 3300009174 Ga0105241_10066102 Ga0105241_100661022 500
474 3300013100 Ga0157373_10001459 Ga0157373_100014599 500
475 3300013297 Ga0157378_10016107 Ga0157378_100161076 500
476 3300017792 Ga0163161_10009379 Ga0163161_100093794 500
477 3300025893 Ga0207682_10003281 Ga0207682_100032813 500
478 3300025900 Ga0207710_10004491 Ga0207710_100044913 500
479 3300025901 Ga0207688_10013571 Ga0207688_100135712 500
480 3300025904 Ga0207647_10010779 Ga0207647_100107791 500
481 3300025907 Ga0207645_10001057 Ga0207645_1000105710 500
482 3300025908 Ga0207643_10003212 Ga0207643_100032126 500
483 3300025914 Ga0207671_10025734 Ga0207671_100257342 500
484 3300025915 Ga0207693_10033843 Ga0207693_100338432 500
485 3300025915 Ga0207693_10061788 Ga0207693_100617882 500
486 3300025916 Ga0207663_10036175 Ga0207663_100361752 500
487 3300025918 Ga0207662_10004364 Ga0207662_100043647 500
488 3300025925 Ga0207650_10000059 Ga0207650_100000596 500
489 3300025927 Ga0207687_10020023 Ga0207687_100200233 500
490 3300025933 Ga0207706_10002800 Ga0207706_100028006 500
491 3300025936 Ga0207670_10032222 Ga0207670_100322221 500
492 3300025939 Ga0207665_10000850 Ga0207665_100008508 500
493 3300025940 Ga0207691_10008005 Ga0207691_100080056 500
494 3300025941 Ga0207711_10007155 Ga0207711_100071554 500
495 3300025942 Ga0207689_10002443 Ga0207689_100024436 500
496 3300025944 Ga0207661_10000973 Ga0207661_1000097310 500
497 3300025945 Ga0207679_10000427 Ga0207679_1000042710 500
498 3300025949 Ga0207667_10075911 Ga0207667_100759113 500
499 3300026067 Ga0207678_10009033 Ga0207678_100090335 500
500 3300026088 Ga0207641_10000025 Ga0207641_100000258 500
501 3300026089 Ga0207648_10000151 Ga0207648_1000015119 500
502 3300026095 Ga0207676_10000252 Ga0207676_100002523 500
503 3300026116 Ga0207674_10000162 Ga0207674_1000016256 500
504 3300026118 Ga0207675_100002440 Ga0207675_10000244011 500
505 3300026121 Ga0207683_10000225 Ga0207683_1000022512 500
506 3300026142 Ga0207698_10014569 Ga0207698_100145693 500
507 3300028379 Ga0268266_10012912 Ga0268266_100129126 500
508 3300028381 Ga0268264_10020253 Ga0268264_100202531 500
509 3300031239 Ga0265328_10008353 Ga0265328_100083532 500
510 3300031249 Ga0265339_10011078 Ga0265339_100110783 500
511 3300039438 Ga0436360_0329430 Ga0436360_0329430_582_2090 500
512 3300048905 Ga0496102_0010317 Ga0496102_0010317_6272_7774 500
513 3300050512 nmdc:mga0n895_1227_c1 nmdc:mga0n895_1227_c1_13420_14928 500
514 3300005290 Ga0065712_10017699 Ga0065712_100176992 501
515 3300005564 Ga0070664_100040970 Ga0070664_1000409702 501
516 3300009093 Ga0105240_10030386 Ga0105240_100303867 501
517 3300009551 Ga0105238_10015439 Ga0105238_100154397 501
518 3300010375 Ga0105239_10284765 Ga0105239_102847651 501
519 3300013296 Ga0157374_10049561 Ga0157374_100495612 501
520 3300013296 Ga0157374_10119027 Ga0157374_101190272 501
521 3300013297 Ga0157378_10107060 Ga0157378_101070602 501
522 3300013306 Ga0163162_10071143 Ga0163162_100711432 501
523 3300014325 Ga0163163_10002997 Ga0163163_100029979 501
524 3300015261 Ga0182006_1025547 Ga0182006_10255472 501
525 3300025911 Ga0207654_10043895 Ga0207654_100438952 501
526 3300025919 Ga0207657_10020386 Ga0207657_100203862 501
527 3300025933 Ga0207706_10028718 Ga0207706_100287183 501
528 3300026023 Ga0207677_10056856 Ga0207677_100568562 501
529 3300046472 Ga0495580_0007730 Ga0495580_0007730_6432_7955 501
530 3300048903 Ga0496100_0114174 Ga0496100_0114174_57_1580 501
531 3300048908 Ga0496105_0066361 Ga0496105_0066361_1163_2686 501
532 3300048910 Ga0496107_0095015 Ga0496107_0095015_331_1854 501
533 3300048915 Ga0496112_0141323 Ga0496112_0141323_383_1906 501
534 3300048916 Ga0496113_0039793 Ga0496113_0039793_1354_2877 501
535 3300005330 Ga0070690_100005523 Ga0070690_1000055236 502
536 3300005331 Ga0070670_100019628 Ga0070670_1000196281 502
537 3300005338 Ga0068868_100010313 Ga0068868_1000103136 502
538 3300009098 Ga0105245_10001076 Ga0105245_100010769 502
539 3300009174 Ga0105241_10009050 Ga0105241_100090506 502
540 3300009176 Ga0105242_10033611 Ga0105242_100336111 502
541 3300010375 Ga0105239_10094252 Ga0105239_100942522 502
542 3300011119 Ga0105246_10003044 Ga0105246_100030445 502
543 3300013100 Ga0157373_10010375 Ga0157373_100103755 502
544 3300013105 Ga0157369_10035628 Ga0157369_100356286 502
545 3300013308 Ga0157375_10035489 Ga0157375_100354892 502
546 3300014325 Ga0163163_10009980 Ga0163163_100099807 502
547 3300014326 Ga0157380_10038101 Ga0157380_100381014 502
548 3300014745 Ga0157377_10002004 Ga0157377_100020046 502
549 3300014968 Ga0157379_10043938 Ga0157379_100439384 502
550 3300028800 Ga0265338_10066064 Ga0265338_100660642 502
551 3300035116 Ga0373945_0015129 Ga0373945_0015129_626_2203 502
552 3300037068 Ga0373925_0012318 Ga0373925_0012318_482_2059 502
553 3300046472 Ga0495580_0000655 Ga0495580_0000655_5771_7348 502
554 3300046473 Ga0495582_0002595 Ga0495582_0002595_775_2352 502
555 3300048911 Ga0496108_0000210 Ga0496108_0000210_31779_33299 502
556 3300048912 Ga0496109_0000228 Ga0496109_0000228_11764_13284 502
557 3300048913 Ga0496110_0009065 Ga0496110_0009065_3415_4935 502
558 3300048915 Ga0496112_0000048 Ga0496112_0000048_11473_12993 502
559 3300048916 Ga0496113_0001188 Ga0496113_0001188_1179_2699 502
560 3300048918 Ga0496115_0135945 Ga0496115_0135945_96_1616 502
561 3300005435 Ga0070714_100000060 Ga0070714_10000006036 503
562 3300005439 Ga0070711_100037247 Ga0070711_1000372472 503
563 3300025916 Ga0207663_10028454 Ga0207663_100284542 503
564 3300025929 Ga0207664_10000017 Ga0207664_10000017152 503
565 3300035111 Ga0373923_0012610 Ga0373923_0012610_1235_2749 503
566 3300035170 Ga0373943_0002013 Ga0373943_0002013_5239_6753 503
567 3300035695 Ga0373927_0000085 Ga0373927_0000085_52894_54408 503
568 3300035725 Ga0373947_0000284 Ga0373947_0000284_10173_11687 503
569 3300037068 Ga0373925_0001042 Ga0373925_0001042_9102_10616 503
570 3300046477 Ga0495664_0015658 Ga0495664_0015658_1409_2923 503
571 3300028800 Ga0265338_10003121 Ga0265338_1000312112 504
572 3300031249 Ga0265339_10013890 Ga0265339_100138903 504
573 3300046472 Ga0495580_0006848 Ga0495580_0006848_46_1581 508
574 2162886011 MRS1b_contig_977209 MRS1b_0457.00001700 511
575 3300005290 Ga0065712_10003223 Ga0065712_100032233 511
576 3300005329 Ga0070683_100038298 Ga0070683_1000382981 511
577 3300005334 Ga0068869_100046464 Ga0068869_1000464642 511
578 3300005335 Ga0070666_10100226 Ga0070666_101002261 511
579 3300005336 Ga0070680_100064084 Ga0070680_1000640842 511
580 3300005338 Ga0068868_100014148 Ga0068868_1000141482 511
581 3300005339 Ga0070660_100020538 Ga0070660_1000205382 511
582 3300005341 Ga0070691_10021963 Ga0070691_100219632 511
583 3300005344 Ga0070661_100012262 Ga0070661_1000122622 511
584 3300005347 Ga0070668_100002481 Ga0070668_1000024816 511
585 3300005353 Ga0070669_100015431 Ga0070669_1000154312 511
586 3300005367 Ga0070667_100183630 Ga0070667_1001836301 511
587 3300005455 Ga0070663_100007746 Ga0070663_1000077464 511
588 3300005456 Ga0070678_100117958 Ga0070678_1001179582 511
589 3300005457 Ga0070662_100002730 Ga0070662_1000027304 511
590 3300005458 Ga0070681_10033363 Ga0070681_100333632 511
591 3300005459 Ga0068867_100007277 Ga0068867_1000072772 511
592 3300005535 Ga0070684_100023840 Ga0070684_1000238405 511
593 3300005548 Ga0070665_100014614 Ga0070665_1000146148 511
594 3300005577 Ga0068857_100027726 Ga0068857_1000277264 511
595 3300005578 Ga0068854_100003053 Ga0068854_1000030538 511
596 3300005614 Ga0068856_100002947 Ga0068856_10000294715 511
597 3300005618 Ga0068864_100267077 Ga0068864_1002670771 511
598 3300005718 Ga0068866_10006041 Ga0068866_100060415 511
599 3300005719 Ga0068861_100042411 Ga0068861_1000424114 511
600 3300005834 Ga0068851_10014100 Ga0068851_100141002 511
601 3300005842 Ga0068858_100012821 Ga0068858_1000128212 511
602 3300005844 Ga0068862_100040754 Ga0068862_1000407544 511
603 3300006358 Ga0068871_100004701 Ga0068871_1000047016 511
604 3300009148 Ga0105243_10011240 Ga0105243_100112404 511
605 3300009176 Ga0105242_10004716 Ga0105242_100047164 511
606 3300009177 Ga0105248_10068134 Ga0105248_100681342 511
607 3300009553 Ga0105249_10001008 Ga0105249_1000100813 511
608 3300013102 Ga0157371_10005422 Ga0157371_100054225 511
609 3300013296 Ga0157374_10027055 Ga0157374_100270553 511
610 3300013306 Ga0163162_10019175 Ga0163162_100191752 511
611 3300013307 Ga0157372_10017181 Ga0157372_100171813 511
612 3300014968 Ga0157379_10013641 Ga0157379_100136415 511
613 3300025913 Ga0207695_10047737 Ga0207695_100477372 511
614 3300025919 Ga0207657_10001912 Ga0207657_100019125 511
615 3300025920 Ga0207649_10007580 Ga0207649_100075802 511
616 3300025927 Ga0207687_10011730 Ga0207687_100117302 511
617 3300025933 Ga0207706_10000296 Ga0207706_1000029615 511
618 3300025942 Ga0207689_10042690 Ga0207689_100426902 511
619 3300025949 Ga0207667_10003425 Ga0207667_1000342515 511
620 3300025972 Ga0207668_10073726 Ga0207668_100737262 511
621 3300025981 Ga0207640_10005736 Ga0207640_100057365 511
622 3300026023 Ga0207677_10086007 Ga0207677_100860072 511
623 3300026035 Ga0207703_10089252 Ga0207703_100892522 511
624 3300026067 Ga0207678_10000476 Ga0207678_100004766 511
625 3300026078 Ga0207702_10034300 Ga0207702_100343001 511
626 3300026089 Ga0207648_10001734 Ga0207648_1000173413 511
627 3300026116 Ga0207674_10030309 Ga0207674_100303095 511
628 3300026118 Ga0207675_100061753 Ga0207675_1000617534 511
629 3300026121 Ga0207683_10092583 Ga0207683_100925832 511
630 3300028380 Ga0268265_10060216 Ga0268265_100602162 511

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01558

POR

Pyruvate ferredoxin/flavodoxin oxidoreductase

344

506

0.94

PF02775

TPP_enzyme_C

Thiamine pyrophosphate enzyme, C-terminal TPP binding domain

100

260

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
3on3-assembly2.cif.gz_A the crystal structure of keto/oxoacid ferredoxin oxidoreductase, gamma subunit from geobacter sulfurreducens pca 0.901 322 496
3on3-assembly3.cif.gz_B the crystal structure of keto/oxoacid ferredoxin oxidoreductase, gamma subunit from geobacter sulfurreducens pca 0.8966 321 496
3g2e-assembly1.cif.gz_D structure of putative oorc subunit of 2-oxoglutarate:acceptor oxidoreductase from campylobacter jejuni 0.8907 321 495
6n2o-assembly1.cif.gz_C 2-oxoglutarate:ferredoxin oxidoreductase from magnetococcus marinus with 2-oxoglutarate, coenzyme a and succinyl-coa bound 0.8903 319 496
3on3-assembly2.cif.gz_A the crystal structure of keto/oxoacid ferredoxin oxidoreductase, gamma subunit from geobacter sulfurreducens pca 0.8859 322 496
ID Description Score Start End Superfamily
3on3A00 Alpha Beta;3-Layer(aba) Sandwich;Pyruvate-ferredoxin Oxidoreductase; domain 3;Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.8958 322 496 3.40.920.10
af_Q57957_74_243_3.40.50.970 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains 0.8937 113 268 3.40.50.970
3on3A00 Alpha Beta;3-Layer(aba) Sandwich;Pyruvate-ferredoxin Oxidoreductase; domain 3;Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.8806 322 496 3.40.920.10
3g2eC00 Alpha Beta;3-Layer(aba) Sandwich;Pyruvate-ferredoxin Oxidoreductase; domain 3;Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.879 321 495 3.40.920.10
af_Q2FZ05_1_182_3.40.920.10 Alpha Beta;3-Layer(aba) Sandwich;Pyruvate-ferredoxin Oxidoreductase; domain 3;Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.8782 319 497 3.40.920.10
ID Description Score Start End GO Terms
AF-A0A3N5KBG3-F1-model_v4 2-oxoglutarate oxidoreductase 0.9666 34 281 GO:0016625
GO:0030976
GO:0044281
GO:0046872
GO:0051536
AF-A0A380RD73-F1-model_v4 2-oxoglutarate ferredoxin oxidoreductase subunit beta 0.9653 32 280 GO:0016625
GO:0030976
AF-A0A354YV83-F1-model_v4 2-oxoglutarate oxidoreductase 0.9646 31 284 GO:0016625
GO:0030976
AF-A0A1F3B1I6-F1-model_v4 2-oxoglutarate oxidoreductase 0.9645 114 282 GO:0016625
GO:0030976
AF-X1J9Y8-F1-model_v4 Thiamine pyrophosphate enzyme TPP-binding domain-containing protein 0.9635 92 282 GO:0016625
GO:0030976

Feature Viewer

pLDDT pTM Quality
83.96 0.62 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map