F470853
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 630 | 246 | 630 | 493 |
Family's Representative Sequence
| Representative Sequence | 3300035116|Ga0373945_0015129|Ga0373945_0015129_626_2203 |
| Length | 525 |
| Sequence | LLHEMNFRRADEMVRRHVATTGEPIMAENNVIAEQPKSVTENYEIVHQKSPLFYPQYERKSDLKHQTHYCPGCGHGVAHKLIAEALEELGVQDQTILVSPVGCSVFAYYYFDVGNVQVAHGRAPAAATGLKRACPDKIVIAYQGDGDLAAIGTAEIVHAANRGEKISVFFVNNAIYGMTGGQMAPTTLVGQRSTTSPWGRRPVNEGFPLHMAEMLSSLEAPVYIERVALSDNKNIMKARRAVRKALELQRAGAGFTFVEILSPCPTIWGKDPVEARKWIAEKMIPNFPLNVFRDRKVDIPNSNVPPHKTVAELVEGERKAAGGEAIPRKQHHFRDLGIKIAGFGGQGVLLLGQLLAEMGMQEGLEVSWLPSYGPEMRSGSAHCHVCLSKDRIGTPVLSRPQVLIAMTEISLRKFYSQVAPGGTIIYGRERLPEDLEITQAQVVCIPASEIADKLGSAKVANVVMMGALLEETECLSPATAMKVLEKKVKNPALLELDRKALDAGRLYIDHTVAVGAVTQADGFAQ |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886011 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 2 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 3 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 4 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 5 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 6 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 7 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 11 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 14 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 16 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 18 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 20 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 28 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 40 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 41 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 44 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 46 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 50 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 52 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 53 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 54 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 56 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 57 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 58 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 59 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 60 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 61 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 62 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 63 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 64 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 65 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 66 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 68 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 69 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 70 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 72 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 73 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 74 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 75 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 77 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 101 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 105 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 161 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 162 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 163 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 164 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 165 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 166 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 167 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 168 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 169 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 170 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 171 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 172 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 173 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 174 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 175 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 176 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 177 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 178 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 179 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 180 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 181 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 182 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 183 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 184 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 185 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 186 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 187 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 188 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 189 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 190 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 191 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 192 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 193 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 194 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 195 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 196 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 197 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 198 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 199 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 200 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 201 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 202 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 203 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 233 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 234 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 235 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 236 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 237 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 238 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 239 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 240 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 241 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 242 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 243 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 244 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 245 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.68 |
| Metatranscriptomes | 0.32 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 2.7 |
| Rhizosphere | 97.14 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.16 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | MRS1b_contig_977209 | 2162886011 | Unclassified | 2101 |
| 2 | JGI24752J21851_1001586 | 3300001976 | Bacteria | 3059 |
| 3 | JGI24743J22301_10000320 | 3300001991 | Bacteria | 5260 |
| 4 | JGI24034J26672_10000626 | 3300002239 | Bacteria | 4538 |
| 5 | JGI24751J29686_10000820 | 3300002459 | Bacteria | 7228 |
| 6 | Ga0065712_10003223 | 3300005290 | Bacteria | 5823 |
| 7 | Ga0065712_10017699 | 3300005290 | Unclassified | 2286 |
| 8 | Ga0070658_10009911 | 3300005327 | Bacteria | 7656 |
| 9 | Ga0070658_10021163 | 3300005327 | Bacteria | 5210 |
| 10 | Ga0070676_10001940 | 3300005328 | Bacteria | 10516 |
| 11 | Ga0070676_10018556 | 3300005328 | Bacteria | 3857 |
| 12 | Ga0070683_100000013 | 3300005329 | Bacteria | 241235 |
| 13 | Ga0070683_100000232 | 3300005329 | Bacteria | 38051 |
| 14 | Ga0070683_100002212 | 3300005329 | Bacteria | 15398 |
| 15 | Ga0070683_100009129 | 3300005329 | Bacteria | 8464 |
| 16 | Ga0070683_100014899 | 3300005329 | Bacteria | 6815 |
| 17 | Ga0070683_100019637 | 3300005329 | Bacteria | 6004 |
| 18 | Ga0070683_100020754 | 3300005329 | Bacteria | 5851 |
| 19 | Ga0070683_100038298 | 3300005329 | Bacteria | 4394 |
| 20 | Ga0070683_100102183 | 3300005329 | Bacteria | 2700 |
| 21 | Ga0070690_100005523 | 3300005330 | Bacteria | 7112 |
| 22 | Ga0070670_100015754 | 3300005331 | Bacteria | 6490 |
| 23 | Ga0070670_100019628 | 3300005331 | Bacteria | 5802 |
| 24 | Ga0070677_10022092 | 3300005333 | Bacteria | 2339 |
| 25 | Ga0068869_100001157 | 3300005334 | Bacteria | 15430 |
| 26 | Ga0068869_100046464 | 3300005334 | Bacteria | 3131 |
| 27 | Ga0070666_10100226 | 3300005335 | Unclassified | 1995 |
| 28 | Ga0070680_100009850 | 3300005336 | Bacteria | 7353 |
| 29 | Ga0070680_100064084 | 3300005336 | Bacteria | 3012 |
| 30 | Ga0070682_100005613 | 3300005337 | Bacteria | 6993 |
| 31 | Ga0068868_100001786 | 3300005338 | Bacteria | 14748 |
| 32 | Ga0068868_100003783 | 3300005338 | Archaea | 10565 |
| 33 | Ga0068868_100010313 | 3300005338 | Bacteria | 6759 |
| 34 | Ga0068868_100014148 | 3300005338 | Bacteria | 5875 |
| 35 | Ga0070660_100001797 | 3300005339 | Bacteria | 14722 |
| 36 | Ga0070660_100003632 | 3300005339 | Bacteria | 10659 |
| 37 | Ga0070660_100020538 | 3300005339 | Bacteria | 4855 |
| 38 | Ga0070691_10021963 | 3300005341 | Bacteria | 2957 |
| 39 | Ga0070687_100002133 | 3300005343 | Bacteria | 7315 |
| 40 | Ga0070661_100006756 | 3300005344 | Bacteria | 7908 |
| 41 | Ga0070661_100012262 | 3300005344 | Bacteria | 5993 |
| 42 | Ga0070661_100032369 | 3300005344 | Bacteria | 3786 |
| 43 | Ga0070661_100036026 | 3300005344 | Bacteria | 3596 |
| 44 | Ga0070668_100002481 | 3300005347 | Bacteria | 13579 |
| 45 | Ga0070668_100023425 | 3300005347 | Bacteria | 4670 |
| 46 | Ga0070669_100015431 | 3300005353 | Bacteria | 5444 |
| 47 | Ga0070675_100027019 | 3300005354 | Bacteria | 4609 |
| 48 | Ga0070671_100000991 | 3300005355 | Bacteria | 20873 |
| 49 | Ga0070671_100122775 | 3300005355 | Bacteria | 2186 |
| 50 | Ga0070673_100063291 | 3300005364 | Bacteria | 2943 |
| 51 | Ga0070673_100070373 | 3300005364 | Unclassified | 2807 |
| 52 | Ga0070688_100003030 | 3300005365 | Bacteria | 8577 |
| 53 | Ga0070659_100003873 | 3300005366 | Bacteria | 10660 |
| 54 | Ga0070667_100003330 | 3300005367 | Bacteria | 13719 |
| 55 | Ga0070667_100183630 | 3300005367 | Unclassified | 1850 |
| 56 | Ga0070709_10022335 | 3300005434 | Bacteria | 3699 |
| 57 | Ga0070714_100000060 | 3300005435 | Bacteria | 100913 |
| 58 | Ga0070714_100023105 | 3300005435 | Bacteria | 5105 |
| 59 | Ga0070714_100024698 | 3300005435 | Bacteria | 4953 |
| 60 | Ga0070714_100054217 | 3300005435 | Bacteria | 3425 |
| 61 | Ga0070713_100000162 | 3300005436 | Bacteria | 45425 |
| 62 | Ga0070713_100002320 | 3300005436 | Bacteria | 12398 |
| 63 | Ga0070713_100014596 | 3300005436 | Bacteria | 5842 |
| 64 | Ga0070713_100023325 | 3300005436 | Bacteria | 4800 |
| 65 | Ga0070713_100119592 | 3300005436 | Bacteria | 2308 |
| 66 | Ga0070713_100151289 | 3300005436 | Unclassified | 2065 |
| 67 | Ga0070710_10003631 | 3300005437 | Bacteria | 7301 |
| 68 | Ga0070711_100003803 | 3300005439 | Bacteria | 8863 |
| 69 | Ga0070711_100037247 | 3300005439 | Bacteria | 3263 |
| 70 | Ga0070700_100060087 | 3300005441 | Bacteria | 2395 |
| 71 | Ga0070663_100007746 | 3300005455 | Bacteria | 6560 |
| 72 | Ga0070663_100078530 | 3300005455 | Unclassified | 2420 |
| 73 | Ga0070678_100022702 | 3300005456 | Bacteria | 4165 |
| 74 | Ga0070678_100117958 | 3300005456 | Unclassified | 2088 |
| 75 | Ga0070662_100002730 | 3300005457 | Bacteria | 10902 |
| 76 | Ga0070681_10001151 | 3300005458 | Bacteria | 22828 |
| 77 | Ga0070681_10033363 | 3300005458 | Bacteria | 5168 |
| 78 | Ga0068867_100007277 | 3300005459 | Bacteria | 7830 |
| 79 | Ga0070685_10015501 | 3300005466 | Bacteria | 4049 |
| 80 | Ga0070706_100012515 | 3300005467 | Bacteria | 7857 |
| 81 | Ga0070679_100006004 | 3300005530 | Bacteria | 11299 |
| 82 | Ga0070679_100065942 | 3300005530 | Bacteria | 3609 |
| 83 | Ga0070684_100000151 | 3300005535 | Bacteria | 47200 |
| 84 | Ga0070684_100000295 | 3300005535 | Bacteria | 34626 |
| 85 | Ga0070684_100000918 | 3300005535 | Bacteria | 20912 |
| 86 | Ga0070684_100001871 | 3300005535 | Bacteria | 15407 |
| 87 | Ga0070684_100023840 | 3300005535 | Bacteria | 5126 |
| 88 | Ga0070684_100036163 | 3300005535 | Bacteria | 4231 |
| 89 | Ga0070684_100048948 | 3300005535 | Bacteria | 3668 |
| 90 | Ga0070684_100081301 | 3300005535 | Bacteria | 2867 |
| 91 | Ga0070684_100144857 | 3300005535 | Unclassified | 2150 |
| 92 | Ga0068853_100000794 | 3300005539 | Bacteria | 21909 |
| 93 | Ga0068853_100006775 | 3300005539 | Bacteria | 9128 |
| 94 | Ga0068853_100009757 | 3300005539 | Bacteria | 7746 |
| 95 | Ga0070686_100003107 | 3300005544 | Bacteria | 9102 |
| 96 | Ga0070686_100044289 | 3300005544 | Bacteria | 2796 |
| 97 | Ga0070665_100010943 | 3300005548 | Bacteria | 9176 |
| 98 | Ga0070665_100014614 | 3300005548 | Bacteria | 7878 |
| 99 | Ga0070665_100087148 | 3300005548 | Bacteria | 3127 |
| 100 | Ga0070704_100179464 | 3300005549 | Bacteria | 1692 |
| 101 | Ga0068855_100002307 | 3300005563 | Bacteria | 23584 |
| 102 | Ga0068855_100004407 | 3300005563 | Bacteria | 17207 |
| 103 | Ga0068855_100032325 | 3300005563 | Bacteria | 6249 |
| 104 | Ga0068855_100149224 | 3300005563 | Bacteria | 2659 |
| 105 | Ga0070664_100040970 | 3300005564 | Bacteria | 3907 |
| 106 | Ga0068857_100000509 | 3300005577 | Bacteria | 27938 |
| 107 | Ga0068857_100006523 | 3300005577 | Bacteria | 10011 |
| 108 | Ga0068857_100009850 | 3300005577 | Bacteria | 8299 |
| 109 | Ga0068857_100027726 | 3300005577 | Bacteria | 4995 |
| 110 | Ga0068857_100047871 | 3300005577 | Bacteria | 3797 |
| 111 | Ga0068854_100003053 | 3300005578 | Bacteria | 10415 |
| 112 | Ga0068854_100072241 | 3300005578 | Bacteria | 2526 |
| 113 | Ga0068854_100099845 | 3300005578 | Unclassified | 2174 |
| 114 | Ga0068856_100002947 | 3300005614 | Bacteria | 17445 |
| 115 | Ga0068856_100003955 | 3300005614 | Bacteria | 14838 |
| 116 | Ga0068856_100004935 | 3300005614 | Bacteria | 13204 |
| 117 | Ga0068856_100006639 | 3300005614 | Bacteria | 11335 |
| 118 | Ga0068856_100007757 | 3300005614 | Bacteria | 10482 |
| 119 | Ga0068856_100009363 | 3300005614 | Bacteria | 9512 |
| 120 | Ga0068856_100009962 | 3300005614 | Bacteria | 9229 |
| 121 | Ga0068856_100020598 | 3300005614 | Bacteria | 6407 |
| 122 | Ga0070702_100058812 | 3300005615 | Bacteria | 2229 |
| 123 | Ga0068852_100000004 | 3300005616 | Bacteria | 179746 |
| 124 | Ga0068852_100002216 | 3300005616 | Bacteria | 13340 |
| 125 | Ga0068852_100005699 | 3300005616 | Bacteria | 8935 |
| 126 | Ga0068852_100013841 | 3300005616 | Bacteria | 6186 |
| 127 | Ga0068852_100034185 | 3300005616 | Bacteria | 4228 |
| 128 | Ga0068852_100135694 | 3300005616 | Bacteria | 2272 |
| 129 | Ga0068852_100245993 | 3300005616 | Bacteria | 1711 |
| 130 | Ga0068859_100002047 | 3300005617 | Bacteria | 20595 |
| 131 | Ga0068864_100001014 | 3300005618 | Bacteria | 23469 |
| 132 | Ga0068864_100012908 | 3300005618 | Bacteria | 6911 |
| 133 | Ga0068864_100267077 | 3300005618 | Unclassified | 1593 |
| 134 | Ga0068866_10003613 | 3300005718 | Bacteria | 6337 |
| 135 | Ga0068866_10006041 | 3300005718 | Bacteria | 5038 |
| 136 | Ga0068861_100004458 | 3300005719 | Bacteria | 9399 |
| 137 | Ga0068861_100042411 | 3300005719 | Bacteria | 3410 |
| 138 | Ga0068851_10014100 | 3300005834 | Bacteria | 3790 |
| 139 | Ga0068851_10051141 | 3300005834 | Bacteria | 2099 |
| 140 | Ga0068870_10003922 | 3300005840 | Bacteria | 6348 |
| 141 | Ga0068863_100000629 | 3300005841 | Bacteria | 35768 |
| 142 | Ga0068863_100010389 | 3300005841 | Bacteria | 9045 |
| 143 | Ga0068863_100039701 | 3300005841 | Bacteria | 4477 |
| 144 | Ga0068863_100174388 | 3300005841 | Bacteria | 2063 |
| 145 | Ga0068858_100002136 | 3300005842 | Bacteria | 20028 |
| 146 | Ga0068858_100012821 | 3300005842 | Bacteria | 7903 |
| 147 | Ga0068858_100078478 | 3300005842 | Unclassified | 3068 |
| 148 | Ga0068860_100000733 | 3300005843 | Bacteria | 37344 |
| 149 | Ga0068862_100040754 | 3300005844 | Bacteria | 3948 |
| 150 | Ga0068862_100084550 | 3300005844 | Bacteria | 2757 |
| 151 | Ga0070717_10005985 | 3300006028 | Bacteria | 8908 |
| 152 | Ga0070717_10023307 | 3300006028 | Bacteria | 4904 |
| 153 | Ga0070717_10066874 | 3300006028 | Bacteria | 2989 |
| 154 | Ga0070717_10103686 | 3300006028 | Bacteria | 2418 |
| 155 | Ga0070717_10106331 | 3300006028 | Bacteria | 2389 |
| 156 | Ga0070717_10155256 | 3300006028 | Bacteria | 1982 |
| 157 | Ga0070715_10016820 | 3300006163 | Bacteria | 2757 |
| 158 | Ga0070716_100000239 | 3300006173 | Bacteria | 22002 |
| 159 | Ga0070716_100003763 | 3300006173 | Bacteria | 7185 |
| 160 | Ga0070712_100000057 | 3300006175 | Bacteria | 56727 |
| 161 | Ga0070712_100004797 | 3300006175 | Bacteria | 8363 |
| 162 | Ga0070712_100006085 | 3300006175 | Bacteria | 7469 |
| 163 | Ga0070712_100023766 | 3300006175 | Bacteria | 4052 |
| 164 | Ga0070712_100040964 | 3300006175 | Bacteria | 3177 |
| 165 | Ga0097621_100000590 | 3300006237 | Bacteria | 25555 |
| 166 | Ga0097621_100000655 | 3300006237 | Bacteria | 24396 |
| 167 | Ga0097621_100002052 | 3300006237 | Bacteria | 13789 |
| 168 | Ga0097621_100050999 | 3300006237 | Bacteria | 3366 |
| 169 | Ga0068871_100004701 | 3300006358 | Bacteria | 9547 |
| 170 | Ga0068871_100008135 | 3300006358 | Bacteria | 7530 |
| 171 | Ga0075434_100006250 | 3300006871 | Bacteria | 10909 |
| 172 | Ga0068865_100002522 | 3300006881 | Bacteria | 10842 |
| 173 | Ga0068865_100005956 | 3300006881 | Bacteria | 7425 |
| 174 | Ga0075436_100005126 | 3300006914 | Bacteria | 9018 |
| 175 | Ga0075436_100029764 | 3300006914 | Bacteria | 3755 |
| 176 | Ga0097620_100002047 | 3300006931 | Bacteria | 20595 |
| 177 | Ga0075435_100036831 | 3300007076 | Bacteria | 3891 |
| 178 | Ga0105240_10000471 | 3300009093 | Bacteria | 74388 |
| 179 | Ga0105240_10000788 | 3300009093 | Bacteria | 57440 |
| 180 | Ga0105240_10004821 | 3300009093 | Bacteria | 20330 |
| 181 | Ga0105240_10008484 | 3300009093 | Bacteria | 14696 |
| 182 | Ga0105240_10008539 | 3300009093 | Bacteria | 14638 |
| 183 | Ga0105240_10022446 | 3300009093 | Bacteria | 8365 |
| 184 | Ga0105240_10030386 | 3300009093 | Bacteria | 7022 |
| 185 | Ga0105240_10039426 | 3300009093 | Bacteria | 6050 |
| 186 | Ga0105240_10049613 | 3300009093 | Bacteria | 5297 |
| 187 | Ga0105240_10052307 | 3300009093 | Bacteria | 5136 |
| 188 | Ga0105240_10056186 | 3300009093 | Bacteria | 4926 |
| 189 | Ga0105245_10001076 | 3300009098 | Bacteria | 24743 |
| 190 | Ga0105245_10002051 | 3300009098 | Bacteria | 18267 |
| 191 | Ga0105245_10002635 | 3300009098 | Bacteria | 16148 |
| 192 | Ga0105245_10029969 | 3300009098 | Bacteria | 4811 |
| 193 | Ga0105245_10067329 | 3300009098 | Bacteria | 3243 |
| 194 | Ga0105247_10002244 | 3300009101 | Bacteria | 13297 |
| 195 | Ga0105243_10011240 | 3300009148 | Bacteria | 6772 |
| 196 | Ga0105241_10000173 | 3300009174 | Bacteria | 47531 |
| 197 | Ga0105241_10000697 | 3300009174 | Bacteria | 25355 |
| 198 | Ga0105241_10005272 | 3300009174 | Bacteria | 9548 |
| 199 | Ga0105241_10009050 | 3300009174 | Bacteria | 7325 |
| 200 | Ga0105241_10022319 | 3300009174 | Bacteria | 4688 |
| 201 | Ga0105241_10042275 | 3300009174 | Unclassified | 3447 |
| 202 | Ga0105241_10066102 | 3300009174 | Bacteria | 2796 |
| 203 | Ga0105241_10074747 | 3300009174 | Bacteria | 2639 |
| 204 | Ga0105242_10004716 | 3300009176 | Bacteria | 10554 |
| 205 | Ga0105242_10033611 | 3300009176 | Bacteria | 4108 |
| 206 | Ga0105248_10023606 | 3300009177 | Bacteria | 6833 |
| 207 | Ga0105248_10068134 | 3300009177 | Bacteria | 3996 |
| 208 | Ga0105248_10077774 | 3300009177 | Bacteria | 3730 |
| 209 | Ga0105248_10281723 | 3300009177 | Bacteria | 1871 |
| 210 | Ga0105237_10003673 | 3300009545 | Bacteria | 18079 |
| 211 | Ga0105237_10054638 | 3300009545 | Bacteria | 4002 |
| 212 | Ga0105237_10088178 | 3300009545 | Bacteria | 3092 |
| 213 | Ga0105238_10001940 | 3300009551 | Bacteria | 20803 |
| 214 | Ga0105238_10002721 | 3300009551 | Bacteria | 17603 |
| 215 | Ga0105238_10004120 | 3300009551 | Bacteria | 14429 |
| 216 | Ga0105238_10004462 | 3300009551 | Bacteria | 13871 |
| 217 | Ga0105238_10015439 | 3300009551 | Bacteria | 7728 |
| 218 | Ga0105238_10030707 | 3300009551 | Bacteria | 5469 |
| 219 | Ga0105238_10039762 | 3300009551 | Bacteria | 4769 |
| 220 | Ga0105238_10145991 | 3300009551 | Bacteria | 2342 |
| 221 | Ga0105249_10001008 | 3300009553 | Bacteria | 24927 |
| 222 | Ga0105249_10049912 | 3300009553 | Bacteria | 3816 |
| 223 | Ga0105239_10000496 | 3300010375 | Bacteria | 57020 |
| 224 | Ga0105239_10005441 | 3300010375 | Bacteria | 14938 |
| 225 | Ga0105239_10008702 | 3300010375 | Bacteria | 11492 |
| 226 | Ga0105239_10025864 | 3300010375 | Bacteria | 6464 |
| 227 | Ga0105239_10052149 | 3300010375 | Bacteria | 4485 |
| 228 | Ga0105239_10094252 | 3300010375 | Bacteria | 3306 |
| 229 | Ga0105239_10284765 | 3300010375 | Unclassified | 1861 |
| 230 | Ga0105246_10000227 | 3300011119 | Bacteria | 28714 |
| 231 | Ga0105246_10003044 | 3300011119 | Bacteria | 10176 |
| 232 | Ga0157373_10001459 | 3300013100 | Bacteria | 18084 |
| 233 | Ga0157373_10010375 | 3300013100 | Bacteria | 6858 |
| 234 | Ga0157373_10052906 | 3300013100 | Bacteria | 2888 |
| 235 | Ga0157371_10005422 | 3300013102 | Bacteria | 10765 |
| 236 | Ga0157371_10061194 | 3300013102 | Bacteria | 2669 |
| 237 | Ga0157370_10000016 | 3300013104 | Bacteria | 179999 |
| 238 | Ga0157370_10013716 | 3300013104 | Bacteria | 8331 |
| 239 | Ga0157369_10000287 | 3300013105 | Bacteria | 67638 |
| 240 | Ga0157369_10001929 | 3300013105 | Bacteria | 25003 |
| 241 | Ga0157369_10008094 | 3300013105 | Bacteria | 12054 |
| 242 | Ga0157369_10013448 | 3300013105 | Bacteria | 9249 |
| 243 | Ga0157369_10027807 | 3300013105 | Bacteria | 6265 |
| 244 | Ga0157369_10035628 | 3300013105 | Bacteria | 5454 |
| 245 | Ga0157369_10049764 | 3300013105 | Bacteria | 4541 |
| 246 | Ga0157369_10050913 | 3300013105 | Bacteria | 4483 |
| 247 | Ga0157369_10076314 | 3300013105 | Bacteria | 3592 |
| 248 | Ga0157374_10004725 | 3300013296 | Bacteria | 11423 |
| 249 | Ga0157374_10006358 | 3300013296 | Bacteria | 10023 |
| 250 | Ga0157374_10027055 | 3300013296 | Bacteria | 5168 |
| 251 | Ga0157374_10049561 | 3300013296 | Unclassified | 3901 |
| 252 | Ga0157374_10119027 | 3300013296 | Bacteria | 2547 |
| 253 | Ga0157374_10293982 | 3300013296 | Bacteria | 1606 |
| 254 | Ga0157378_10000256 | 3300013297 | Bacteria | 52148 |
| 255 | Ga0157378_10002892 | 3300013297 | Bacteria | 15289 |
| 256 | Ga0157378_10008074 | 3300013297 | Bacteria | 9185 |
| 257 | Ga0157378_10016107 | 3300013297 | Bacteria | 6546 |
| 258 | Ga0157378_10021508 | 3300013297 | Bacteria | 5673 |
| 259 | Ga0157378_10037231 | 3300013297 | Bacteria | 4308 |
| 260 | Ga0157378_10107060 | 3300013297 | Unclassified | 2558 |
| 261 | Ga0163162_10004024 | 3300013306 | Bacteria | 14109 |
| 262 | Ga0163162_10019175 | 3300013306 | Bacteria | 6708 |
| 263 | Ga0163162_10056233 | 3300013306 | Unclassified | 3963 |
| 264 | Ga0163162_10071143 | 3300013306 | Unclassified | 3531 |
| 265 | Ga0157372_10001533 | 3300013307 | Bacteria | 25124 |
| 266 | Ga0157372_10002345 | 3300013307 | Bacteria | 20483 |
| 267 | Ga0157372_10003981 | 3300013307 | Bacteria | 15866 |
| 268 | Ga0157372_10009817 | 3300013307 | Bacteria | 10182 |
| 269 | Ga0157372_10013140 | 3300013307 | Bacteria | 8833 |
| 270 | Ga0157372_10013600 | 3300013307 | Bacteria | 8699 |
| 271 | Ga0157372_10017181 | 3300013307 | Bacteria | 7767 |
| 272 | Ga0157372_10031547 | 3300013307 | Bacteria | 5802 |
| 273 | Ga0157372_10033808 | 3300013307 | Bacteria | 5618 |
| 274 | Ga0157372_10048853 | 3300013307 | Bacteria | 4703 |
| 275 | Ga0157372_10062985 | 3300013307 | Bacteria | 4157 |
| 276 | Ga0157375_10002161 | 3300013308 | Bacteria | 16997 |
| 277 | Ga0157375_10004378 | 3300013308 | Bacteria | 12265 |
| 278 | Ga0157375_10035489 | 3300013308 | Bacteria | 4760 |
| 279 | Ga0157375_10224344 | 3300013308 | Unclassified | 2038 |
| 280 | Ga0163163_10002031 | 3300014325 | Bacteria | 17111 |
| 281 | Ga0163163_10002997 | 3300014325 | Bacteria | 14285 |
| 282 | Ga0163163_10003532 | 3300014325 | Bacteria | 13281 |
| 283 | Ga0163163_10005991 | 3300014325 | Bacteria | 10574 |
| 284 | Ga0163163_10009980 | 3300014325 | Bacteria | 8513 |
| 285 | Ga0163163_10010003 | 3300014325 | Bacteria | 8504 |
| 286 | Ga0163163_10022862 | 3300014325 | Bacteria | 5927 |
| 287 | Ga0163163_10024622 | 3300014325 | Bacteria | 5730 |
| 288 | Ga0163163_10099947 | 3300014325 | Bacteria | 2923 |
| 289 | Ga0157380_10038101 | 3300014326 | Bacteria | 3731 |
| 290 | Ga0182008_10007647 | 3300014497 | Bacteria | 5956 |
| 291 | Ga0157377_10002004 | 3300014745 | Bacteria | 8926 |
| 292 | Ga0157379_10012846 | 3300014968 | Bacteria | 7323 |
| 293 | Ga0157379_10013641 | 3300014968 | Bacteria | 7121 |
| 294 | Ga0157379_10043938 | 3300014968 | Bacteria | 3990 |
| 295 | Ga0157379_10149201 | 3300014968 | Unclassified | 2109 |
| 296 | Ga0157379_10181467 | 3300014968 | Unclassified | 1902 |
| 297 | Ga0157376_10001554 | 3300014969 | Bacteria | 15159 |
| 298 | Ga0157376_10017982 | 3300014969 | Bacteria | 5408 |
| 299 | Ga0157376_10067002 | 3300014969 | Bacteria | 3036 |
| 300 | Ga0157376_10070767 | 3300014969 | Bacteria | 2962 |
| 301 | Ga0182006_1025547 | 3300015261 | Unclassified | 2425 |
| 302 | Ga0163161_10009379 | 3300017792 | Bacteria | 6775 |
| 303 | Ga0207682_10003281 | 3300025893 | Bacteria | 7075 |
| 304 | Ga0207710_10004491 | 3300025900 | Bacteria | 6079 |
| 305 | Ga0207688_10013571 | 3300025901 | Bacteria | 4429 |
| 306 | Ga0207647_10004356 | 3300025904 | Bacteria | 10496 |
| 307 | Ga0207647_10010779 | 3300025904 | Bacteria | 6435 |
| 308 | Ga0207685_10004799 | 3300025905 | Bacteria | 3487 |
| 309 | Ga0207699_10006944 | 3300025906 | Bacteria | 5513 |
| 310 | Ga0207699_10056790 | 3300025906 | Bacteria | 2335 |
| 311 | Ga0207699_10063074 | 3300025906 | Bacteria | 2237 |
| 312 | Ga0207645_10001057 | 3300025907 | Bacteria | 22820 |
| 313 | Ga0207643_10003212 | 3300025908 | Bacteria | 8806 |
| 314 | Ga0207705_10116984 | 3300025909 | Bacteria | 1974 |
| 315 | Ga0207684_10039919 | 3300025910 | Bacteria | 3979 |
| 316 | Ga0207654_10000061 | 3300025911 | Bacteria | 73179 |
| 317 | Ga0207654_10000555 | 3300025911 | Bacteria | 21187 |
| 318 | Ga0207654_10005558 | 3300025911 | Bacteria | 6376 |
| 319 | Ga0207654_10043895 | 3300025911 | Unclassified | 2536 |
| 320 | Ga0207654_10053682 | 3300025911 | Bacteria | 2327 |
| 321 | Ga0207707_10005979 | 3300025912 | Bacteria | 10647 |
| 322 | Ga0207695_10000050 | 3300025913 | Bacteria | 405727 |
| 323 | Ga0207695_10000499 | 3300025913 | Bacteria | 83531 |
| 324 | Ga0207695_10000995 | 3300025913 | Bacteria | 50150 |
| 325 | Ga0207695_10001740 | 3300025913 | Bacteria | 34580 |
| 326 | Ga0207695_10015681 | 3300025913 | Bacteria | 8913 |
| 327 | Ga0207695_10018719 | 3300025913 | Bacteria | 7996 |
| 328 | Ga0207695_10047737 | 3300025913 | Bacteria | 4528 |
| 329 | Ga0207695_10084911 | 3300025913 | Bacteria | 3195 |
| 330 | Ga0207695_10087510 | 3300025913 | Bacteria | 3138 |
| 331 | Ga0207695_10131626 | 3300025913 | Bacteria | 2459 |
| 332 | Ga0207671_10000232 | 3300025914 | Bacteria | 84103 |
| 333 | Ga0207671_10004067 | 3300025914 | Bacteria | 14170 |
| 334 | Ga0207671_10025734 | 3300025914 | Unclassified | 4417 |
| 335 | Ga0207671_10029761 | 3300025914 | Bacteria | 4076 |
| 336 | Ga0207671_10071171 | 3300025914 | Bacteria | 2594 |
| 337 | Ga0207693_10000004 | 3300025915 | Bacteria | 193261 |
| 338 | Ga0207693_10000119 | 3300025915 | Bacteria | 69804 |
| 339 | Ga0207693_10033843 | 3300025915 | Bacteria | 4031 |
| 340 | Ga0207693_10043453 | 3300025915 | Bacteria | 3535 |
| 341 | Ga0207693_10061788 | 3300025915 | Bacteria | 2934 |
| 342 | Ga0207663_10028454 | 3300025916 | Bacteria | 3272 |
| 343 | Ga0207663_10036175 | 3300025916 | Bacteria | 2969 |
| 344 | Ga0207662_10004364 | 3300025918 | Bacteria | 7426 |
| 345 | Ga0207657_10000449 | 3300025919 | Bacteria | 43787 |
| 346 | Ga0207657_10001912 | 3300025919 | Bacteria | 22493 |
| 347 | Ga0207657_10020386 | 3300025919 | Bacteria | 6265 |
| 348 | Ga0207649_10007580 | 3300025920 | Bacteria | 5900 |
| 349 | Ga0207649_10059501 | 3300025920 | Bacteria | 2397 |
| 350 | Ga0207652_10016697 | 3300025921 | Bacteria | 5999 |
| 351 | Ga0207694_10001017 | 3300025924 | Bacteria | 24441 |
| 352 | Ga0207694_10001309 | 3300025924 | Bacteria | 21414 |
| 353 | Ga0207694_10001368 | 3300025924 | Bacteria | 21003 |
| 354 | Ga0207694_10008190 | 3300025924 | Bacteria | 7900 |
| 355 | Ga0207694_10166531 | 3300025924 | Unclassified | 1783 |
| 356 | Ga0207650_10000059 | 3300025925 | Bacteria | 151427 |
| 357 | Ga0207650_10009928 | 3300025925 | Bacteria | 6513 |
| 358 | Ga0207687_10001070 | 3300025927 | Bacteria | 18559 |
| 359 | Ga0207687_10011730 | 3300025927 | Bacteria | 5733 |
| 360 | Ga0207687_10020023 | 3300025927 | Bacteria | 4437 |
| 361 | Ga0207700_10001036 | 3300025928 | Bacteria | 16037 |
| 362 | Ga0207700_10001921 | 3300025928 | Bacteria | 11818 |
| 363 | Ga0207700_10010487 | 3300025928 | Bacteria | 5851 |
| 364 | Ga0207700_10028770 | 3300025928 | Unclassified | 3913 |
| 365 | Ga0207700_10052459 | 3300025928 | Bacteria | 3049 |
| 366 | Ga0207700_10071638 | 3300025928 | Bacteria | 2669 |
| 367 | Ga0207664_10000017 | 3300025929 | Bacteria | 230967 |
| 368 | Ga0207664_10004022 | 3300025929 | Bacteria | 9913 |
| 369 | Ga0207664_10061235 | 3300025929 | Bacteria | 3002 |
| 370 | Ga0207644_10003363 | 3300025931 | Bacteria | 10321 |
| 371 | Ga0207644_10065182 | 3300025931 | Bacteria | 2648 |
| 372 | Ga0207706_10000296 | 3300025933 | Bacteria | 54072 |
| 373 | Ga0207706_10002647 | 3300025933 | Bacteria | 17447 |
| 374 | Ga0207706_10002800 | 3300025933 | Bacteria | 16943 |
| 375 | Ga0207706_10028718 | 3300025933 | Bacteria | 4965 |
| 376 | Ga0207670_10032222 | 3300025936 | Bacteria | 3368 |
| 377 | Ga0207665_10000850 | 3300025939 | Bacteria | 20643 |
| 378 | Ga0207665_10005931 | 3300025939 | Bacteria | 8131 |
| 379 | Ga0207665_10075360 | 3300025939 | Bacteria | 2311 |
| 380 | Ga0207691_10008005 | 3300025940 | Bacteria | 10162 |
| 381 | Ga0207691_10010827 | 3300025940 | Bacteria | 8755 |
| 382 | Ga0207711_10007155 | 3300025941 | Bacteria | 9353 |
| 383 | Ga0207711_10106826 | 3300025941 | Bacteria | 2484 |
| 384 | Ga0207711_10127620 | 3300025941 | Bacteria | 2277 |
| 385 | Ga0207689_10001098 | 3300025942 | Bacteria | 26082 |
| 386 | Ga0207689_10002443 | 3300025942 | Bacteria | 17311 |
| 387 | Ga0207689_10015609 | 3300025942 | Bacteria | 6432 |
| 388 | Ga0207689_10042690 | 3300025942 | Bacteria | 3749 |
| 389 | Ga0207689_10118872 | 3300025942 | Unclassified | 2174 |
| 390 | Ga0207661_10000018 | 3300025944 | Bacteria | 242506 |
| 391 | Ga0207661_10000973 | 3300025944 | Bacteria | 18869 |
| 392 | Ga0207661_10005192 | 3300025944 | Bacteria | 9155 |
| 393 | Ga0207661_10075252 | 3300025944 | Bacteria | 2770 |
| 394 | Ga0207679_10000427 | 3300025945 | Bacteria | 29877 |
| 395 | Ga0207667_10000079 | 3300025949 | Bacteria | 163341 |
| 396 | Ga0207667_10003425 | 3300025949 | Bacteria | 19576 |
| 397 | Ga0207667_10004532 | 3300025949 | Bacteria | 17022 |
| 398 | Ga0207667_10005908 | 3300025949 | Bacteria | 14907 |
| 399 | Ga0207667_10010675 | 3300025949 | Bacteria | 10720 |
| 400 | Ga0207667_10075911 | 3300025949 | Bacteria | 3488 |
| 401 | Ga0207651_10021589 | 3300025960 | Bacteria | 3917 |
| 402 | Ga0207668_10073726 | 3300025972 | Bacteria | 2447 |
| 403 | Ga0207640_10005736 | 3300025981 | Bacteria | 6764 |
| 404 | Ga0207658_10011318 | 3300025986 | Bacteria | 6073 |
| 405 | Ga0207658_10105711 | 3300025986 | Unclassified | 2214 |
| 406 | Ga0207677_10000753 | 3300026023 | Bacteria | 18654 |
| 407 | Ga0207677_10002017 | 3300026023 | Archaea | 10713 |
| 408 | Ga0207677_10056856 | 3300026023 | Unclassified | 2683 |
| 409 | Ga0207677_10086007 | 3300026023 | Bacteria | 2271 |
| 410 | Ga0207703_10005407 | 3300026035 | Bacteria | 10278 |
| 411 | Ga0207703_10089252 | 3300026035 | Unclassified | 2589 |
| 412 | Ga0207639_10001235 | 3300026041 | Bacteria | 17308 |
| 413 | Ga0207639_10079213 | 3300026041 | Bacteria | 2596 |
| 414 | Ga0207678_10000476 | 3300026067 | Bacteria | 36336 |
| 415 | Ga0207678_10009033 | 3300026067 | Bacteria | 8774 |
| 416 | Ga0207678_10018482 | 3300026067 | Bacteria | 6121 |
| 417 | Ga0207702_10001914 | 3300026078 | Bacteria | 20340 |
| 418 | Ga0207702_10003459 | 3300026078 | Bacteria | 14395 |
| 419 | Ga0207702_10004521 | 3300026078 | Bacteria | 12333 |
| 420 | Ga0207702_10017670 | 3300026078 | Bacteria | 5901 |
| 421 | Ga0207702_10034300 | 3300026078 | Bacteria | 4241 |
| 422 | Ga0207641_10000025 | 3300026088 | Bacteria | 247727 |
| 423 | Ga0207641_10001373 | 3300026088 | Bacteria | 24051 |
| 424 | Ga0207641_10156844 | 3300026088 | Bacteria | 2066 |
| 425 | Ga0207648_10000151 | 3300026089 | Bacteria | 69912 |
| 426 | Ga0207648_10001734 | 3300026089 | Bacteria | 23872 |
| 427 | Ga0207676_10000252 | 3300026095 | Bacteria | 46432 |
| 428 | Ga0207676_10018067 | 3300026095 | Bacteria | 5121 |
| 429 | Ga0207676_10021276 | 3300026095 | Bacteria | 4758 |
| 430 | Ga0207674_10000162 | 3300026116 | Bacteria | 79631 |
| 431 | Ga0207674_10002086 | 3300026116 | Bacteria | 25296 |
| 432 | Ga0207674_10002450 | 3300026116 | Bacteria | 23436 |
| 433 | Ga0207674_10030309 | 3300026116 | Bacteria | 5689 |
| 434 | Ga0207674_10123495 | 3300026116 | Bacteria | 2555 |
| 435 | Ga0207675_100002440 | 3300026118 | Bacteria | 18416 |
| 436 | Ga0207675_100061753 | 3300026118 | Bacteria | 3498 |
| 437 | Ga0207683_10000225 | 3300026121 | Bacteria | 49694 |
| 438 | Ga0207683_10000815 | 3300026121 | Bacteria | 28504 |
| 439 | Ga0207683_10092583 | 3300026121 | Bacteria | 2693 |
| 440 | Ga0207698_10000008 | 3300026142 | Bacteria | 281991 |
| 441 | Ga0207698_10001996 | 3300026142 | Bacteria | 12015 |
| 442 | Ga0207698_10010263 | 3300026142 | Bacteria | 6006 |
| 443 | Ga0207698_10014569 | 3300026142 | Bacteria | 5233 |
| 444 | Ga0207698_10037301 | 3300026142 | Unclassified | 3578 |
| 445 | Ga0207698_10119256 | 3300026142 | Unclassified | 2229 |
| 446 | Ga0268266_10012912 | 3300028379 | Bacteria | 7206 |
| 447 | Ga0268266_10042253 | 3300028379 | Bacteria | 3893 |
| 448 | Ga0268266_10206104 | 3300028379 | Unclassified | 1802 |
| 449 | Ga0268265_10060216 | 3300028380 | Bacteria | 2909 |
| 450 | Ga0268265_10119820 | 3300028380 | Bacteria | 2166 |
| 451 | Ga0268264_10002830 | 3300028381 | Bacteria | 15137 |
| 452 | Ga0268264_10020253 | 3300028381 | Bacteria | 5436 |
| 453 | Ga0265318_10028358 | 3300028577 | Bacteria | 2190 |
| 454 | Ga0265323_10005508 | 3300028653 | Bacteria | 5378 |
| 455 | Ga0265336_10002621 | 3300028666 | Bacteria | 7317 |
| 456 | Ga0265338_10001846 | 3300028800 | Bacteria | 33258 |
| 457 | Ga0265338_10003121 | 3300028800 | Bacteria | 23686 |
| 458 | Ga0265338_10004949 | 3300028800 | Bacteria | 17660 |
| 459 | Ga0265338_10015022 | 3300028800 | Bacteria | 8550 |
| 460 | Ga0265338_10020744 | 3300028800 | Bacteria | 6891 |
| 461 | Ga0265338_10027470 | 3300028800 | Bacteria | 5710 |
| 462 | Ga0265338_10034714 | 3300028800 | Bacteria | 4867 |
| 463 | Ga0265338_10066064 | 3300028800 | Unclassified | 3133 |
| 464 | Ga0265338_10122483 | 3300028800 | Unclassified | 2069 |
| 465 | Ga0265760_10000861 | 3300031090 | Bacteria | 8780 |
| 466 | Ga0265760_10004210 | 3300031090 | Bacteria | 4139 |
| 467 | Ga0265330_10003771 | 3300031235 | Bacteria | 7824 |
| 468 | Ga0265330_10004657 | 3300031235 | Bacteria | 6928 |
| 469 | Ga0265330_10018157 | 3300031235 | Bacteria | 3234 |
| 470 | Ga0265330_10018354 | 3300031235 | Bacteria | 3213 |
| 471 | Ga0265330_10020443 | 3300031235 | Bacteria | 3024 |
| 472 | Ga0265332_10042852 | 3300031238 | Bacteria | 1955 |
| 473 | Ga0265328_10007374 | 3300031239 | Bacteria | 4587 |
| 474 | Ga0265328_10008353 | 3300031239 | Bacteria | 4276 |
| 475 | Ga0265328_10012594 | 3300031239 | Bacteria | 3363 |
| 476 | Ga0265325_10000515 | 3300031241 | Bacteria | 28005 |
| 477 | Ga0265325_10000731 | 3300031241 | Bacteria | 23769 |
| 478 | Ga0265325_10002504 | 3300031241 | Bacteria | 12376 |
| 479 | Ga0265325_10003635 | 3300031241 | Bacteria | 10007 |
| 480 | Ga0265325_10004243 | 3300031241 | Bacteria | 9098 |
| 481 | Ga0265325_10004445 | 3300031241 | Bacteria | 8866 |
| 482 | Ga0265325_10038175 | 3300031241 | Unclassified | 2535 |
| 483 | Ga0265325_10041963 | 3300031241 | Bacteria | 2395 |
| 484 | Ga0265325_10043186 | 3300031241 | Bacteria | 2353 |
| 485 | Ga0265340_10037917 | 3300031247 | Bacteria | 2386 |
| 486 | Ga0265339_10000081 | 3300031249 | Bacteria | 82039 |
| 487 | Ga0265339_10002003 | 3300031249 | Bacteria | 14962 |
| 488 | Ga0265339_10002593 | 3300031249 | Bacteria | 12899 |
| 489 | Ga0265339_10007929 | 3300031249 | Bacteria | 6811 |
| 490 | Ga0265339_10011078 | 3300031249 | Bacteria | 5568 |
| 491 | Ga0265339_10013890 | 3300031249 | Bacteria | 4872 |
| 492 | Ga0265331_10017523 | 3300031250 | Bacteria | 3732 |
| 493 | Ga0265327_10010465 | 3300031251 | Bacteria | 6518 |
| 494 | Ga0265316_10003282 | 3300031344 | Bacteria | 16413 |
| 495 | Ga0265316_10003316 | 3300031344 | Bacteria | 16317 |
| 496 | Ga0265316_10007178 | 3300031344 | Bacteria | 10527 |
| 497 | Ga0265316_10007229 | 3300031344 | Bacteria | 10488 |
| 498 | Ga0265316_10008207 | 3300031344 | Bacteria | 9718 |
| 499 | Ga0265316_10011579 | 3300031344 | Bacteria | 7944 |
| 500 | Ga0265316_10024239 | 3300031344 | Bacteria | 5090 |
| 501 | Ga0265316_10046167 | 3300031344 | Bacteria | 3453 |
| 502 | Ga0265316_10068924 | 3300031344 | Bacteria | 2730 |
| 503 | Ga0265316_10114137 | 3300031344 | Archaea | 2044 |
| 504 | Ga0265316_10116207 | 3300031344 | Bacteria | 2022 |
| 505 | Ga0307408_100189380 | 3300031548 | Bacteria | 1656 |
| 506 | Ga0265313_10002161 | 3300031595 | Bacteria | 17461 |
| 507 | Ga0265313_10004842 | 3300031595 | Bacteria | 10119 |
| 508 | Ga0265313_10008448 | 3300031595 | Bacteria | 6832 |
| 509 | Ga0265314_10000090 | 3300031711 | Bacteria | 137914 |
| 510 | Ga0265314_10002820 | 3300031711 | Bacteria | 17337 |
| 511 | Ga0265314_10007441 | 3300031711 | Bacteria | 9496 |
| 512 | Ga0265314_10026234 | 3300031711 | Bacteria | 4380 |
| 513 | Ga0265314_10032304 | 3300031711 | Bacteria | 3851 |
| 514 | Ga0265342_10000636 | 3300031712 | Bacteria | 36784 |
| 515 | Ga0265342_10001787 | 3300031712 | Bacteria | 19563 |
| 516 | Ga0265342_10003419 | 3300031712 | Bacteria | 13047 |
| 517 | Ga0265342_10007514 | 3300031712 | Bacteria | 7972 |
| 518 | Ga0265342_10023647 | 3300031712 | Bacteria | 3886 |
| 519 | Ga0265342_10058158 | 3300031712 | Unclassified | 2286 |
| 520 | Ga0265342_10072531 | 3300031712 | Bacteria | 2004 |
| 521 | Ga0316577_10028488 | 3300031733 | Unclassified | 3116 |
| 522 | Ga0307410_10035766 | 3300031852 | Bacteria | 3229 |
| 523 | Ga0307406_10039104 | 3300031901 | Bacteria | 2941 |
| 524 | Ga0307409_100058095 | 3300031995 | Bacteria | 3002 |
| 525 | Ga0307409_100107255 | 3300031995 | Bacteria | 2333 |
| 526 | Ga0307416_100049892 | 3300032002 | Bacteria | 3331 |
| 527 | Ga0307416_100150706 | 3300032002 | Bacteria | 2132 |
| 528 | Ga0307411_10006972 | 3300032005 | Bacteria | 5707 |
| 529 | Ga0373923_0012610 | 3300035111 | Bacteria | 3130 |
| 530 | Ga0373945_0015129 | 3300035116 | Bacteria | 2593 |
| 531 | Ga0373954_0000162 | 3300035118 | Bacteria | 23887 |
| 532 | Ga0373956_0016373 | 3300035119 | Bacteria | 3114 |
| 533 | Ga0373943_0002013 | 3300035170 | Bacteria | 9208 |
| 534 | Ga0373955_0002394 | 3300035172 | Bacteria | 8173 |
| 535 | Ga0373955_0017111 | 3300035172 | Bacteria | 3581 |
| 536 | Ga0373935_0008498 | 3300035692 | Bacteria | 6145 |
| 537 | Ga0373927_0000085 | 3300035695 | Bacteria | 70359 |
| 538 | Ga0373933_0004916 | 3300035724 | Bacteria | 7295 |
| 539 | Ga0373947_0000284 | 3300035725 | Bacteria | 28729 |
| 540 | Ga0373937_0002199 | 3300036401 | Bacteria | 16293 |
| 541 | Ga0373925_0001042 | 3300037068 | Bacteria | 25115 |
| 542 | Ga0373925_0012318 | 3300037068 | Bacteria | 6190 |
| 543 | Ga0373925_0020863 | 3300037068 | Bacteria | 4775 |
| 544 | Ga0395898_0077493 | 3300037466 | Bacteria | 3209 |
| 545 | Ga0436360_0329430 | 3300039438 | Bacteria | 2582 |
| 546 | Ga0436363_0413793 | 3300039450 | Bacteria | 1861 |
| 547 | Ga0451577_0000215 | 3300042876 | Bacteria | 120190 |
| 548 | Ga0451577_0021028 | 3300042876 | Bacteria | 5979 |
| 549 | Ga0451577_0294750 | 3300042876 | Bacteria | 1470 |
| 550 | Ga0466964_0045141 | 3300044706 | Unclassified | 1793 |
| 551 | Ga0453684_0000545 | 3300044712 | Bacteria | 142482 |
| 552 | Ga0466967_0002817 | 3300045976 | Bacteria | 11027 |
| 553 | Ga0466967_0062520 | 3300045976 | Bacteria | 3305 |
| 554 | Ga0466967_0105981 | 3300045976 | Bacteria | 2576 |
| 555 | Ga0495603_0081666 | 3300046455 | Bacteria | 1894 |
| 556 | Ga0495629_0017404 | 3300046459 | Bacteria | 5151 |
| 557 | Ga0495651_0033477 | 3300046462 | Bacteria | 4008 |
| 558 | Ga0495653_0056892 | 3300046463 | Bacteria | 2980 |
| 559 | Ga0495580_0000160 | 3300046472 | Bacteria | 49438 |
| 560 | Ga0495580_0000655 | 3300046472 | Bacteria | 29380 |
| 561 | Ga0495580_0000677 | 3300046472 | Bacteria | 28998 |
| 562 | Ga0495580_0006848 | 3300046472 | Bacteria | 9226 |
| 563 | Ga0495580_0007106 | 3300046472 | Bacteria | 9020 |
| 564 | Ga0495580_0007730 | 3300046472 | Bacteria | 8616 |
| 565 | Ga0495580_0009186 | 3300046472 | Bacteria | 7792 |
| 566 | Ga0495580_0009824 | 3300046472 | Bacteria | 7505 |
| 567 | Ga0495580_0014305 | 3300046472 | Bacteria | 6020 |
| 568 | Ga0495582_0002595 | 3300046473 | Bacteria | 10050 |
| 569 | Ga0495639_0060155 | 3300046475 | Bacteria | 1740 |
| 570 | Ga0495662_0027305 | 3300046476 | Bacteria | 2758 |
| 571 | Ga0495664_0015658 | 3300046477 | Bacteria | 4313 |
| 572 | Ga0495664_0064904 | 3300046477 | Bacteria | 2176 |
| 573 | Ga0495594_0029683 | 3300046499 | Bacteria | 2956 |
| 574 | Ga0495608_0012320 | 3300046511 | Bacteria | 5939 |
| 575 | Ga0495608_0128412 | 3300046511 | Bacteria | 1623 |
| 576 | Ga0495652_0123299 | 3300046529 | Bacteria | 2063 |
| 577 | Ga0495665_0037110 | 3300046531 | Bacteria | 2601 |
| 578 | Ga0495586_0086069 | 3300046535 | Bacteria | 1732 |
| 579 | Ga0495587_0008835 | 3300046536 | Bacteria | 6466 |
| 580 | Ga0495587_0028552 | 3300046536 | Unclassified | 3392 |
| 581 | Ga0495645_0003859 | 3300046543 | Bacteria | 10202 |
| 582 | Ga0495645_0050596 | 3300046543 | Bacteria | 3025 |
| 583 | Ga0495645_0071248 | 3300046543 | Bacteria | 2507 |
| 584 | Ga0495667_0032247 | 3300046559 | Bacteria | 3513 |
| 585 | Ga0495635_0011851 | 3300046663 | Bacteria | 6112 |
| 586 | Ga0495657_0128017 | 3300046675 | Bacteria | 1593 |
| 587 | Ga0495599_0017065 | 3300046678 | Bacteria | 4511 |
| 588 | Ga0495623_0030648 | 3300046679 | Bacteria | 3460 |
| 589 | Ga0495669_0012245 | 3300046684 | Bacteria | 3648 |
| 590 | Ga0495669_0019659 | 3300046684 | Unclassified | 2917 |
| 591 | Ga0495613_0024181 | 3300046689 | Unclassified | 4527 |
| 592 | Ga0495581_0004594 | 3300047315 | Bacteria | 7978 |
| 593 | Ga0495604_0001581 | 3300047317 | Bacteria | 18770 |
| 594 | Ga0495604_0023327 | 3300047317 | Bacteria | 4936 |
| 595 | Ga0495674_0053028 | 3300047319 | Bacteria | 3567 |
| 596 | Ga0495674_0126475 | 3300047319 | Bacteria | 2156 |
| 597 | Ga0495674_0127607 | 3300047319 | Bacteria | 2145 |
| 598 | Ga0495674_0176779 | 3300047319 | Bacteria | 1779 |
| 599 | Ga0495675_0001667 | 3300047444 | Bacteria | 13305 |
| 600 | Ga0495675_0029172 | 3300047444 | Bacteria | 3518 |
| 601 | Ga0495675_0079581 | 3300047444 | Unclassified | 2064 |
| 602 | Ga0495684_0003377 | 3300047471 | Bacteria | 12533 |
| 603 | Ga0495684_0049718 | 3300047471 | Bacteria | 3203 |
| 604 | Ga0495684_0108016 | 3300047471 | Unclassified | 2102 |
| 605 | Ga0495602_0003442 | 3300048088 | Bacteria | 16370 |
| 606 | Ga0495602_0006533 | 3300048088 | Bacteria | 12225 |
| 607 | Ga0495602_0044680 | 3300048088 | Bacteria | 4016 |
| 608 | Ga0495602_0123488 | 3300048088 | Bacteria | 2079 |
| 609 | Ga0496100_0114174 | 3300048903 | Unclassified | 1881 |
| 610 | Ga0496102_0010317 | 3300048905 | Bacteria | 8034 |
| 611 | Ga0496103_0145549 | 3300048906 | Bacteria | 1517 |
| 612 | Ga0496105_0066361 | 3300048908 | Unclassified | 2979 |
| 613 | Ga0496107_0095015 | 3300048910 | Bacteria | 2181 |
| 614 | Ga0496107_0271182 | 3300048910 | Bacteria | 1263 |
| 615 | Ga0496108_0000210 | 3300048911 | Bacteria | 53448 |
| 616 | Ga0496109_0000228 | 3300048912 | Bacteria | 54849 |
| 617 | Ga0496110_0009065 | 3300048913 | Bacteria | 8031 |
| 618 | Ga0496112_0000048 | 3300048915 | Bacteria | 84789 |
| 619 | Ga0496112_0041047 | 3300048915 | Bacteria | 4526 |
| 620 | Ga0496112_0141323 | 3300048915 | Unclassified | 2376 |
| 621 | Ga0496113_0001188 | 3300048916 | Bacteria | 14242 |
| 622 | Ga0496113_0039793 | 3300048916 | Unclassified | 3461 |
| 623 | Ga0496115_0007893 | 3300048918 | Bacteria | 7851 |
| 624 | Ga0496115_0119300 | 3300048918 | Unclassified | 2170 |
| 625 | Ga0496115_0135945 | 3300048918 | Bacteria | 2027 |
| 626 | nmdc:mga0n895_1227_c1 | 3300050512 | Bacteria | 18920 |
| 627 | nmdc:mga08x19_37115_c1 | 3300050514 | Bacteria | 3091 |
| 628 | nmdc:mga08x19_4193_c1 | 3300050514 | Bacteria | 8541 |
| 629 | Ga0495619_0010522 | 3300053085 | Bacteria | 5821 |
| 630 | Ga0501082_0000009 | 3300060353 | Bacteria | 123279 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300048910 | Ga0496107_0271182 | Ga0496107_0271182_72_1253 | 390 |
| 2 | 3300025942 | Ga0207689_10118872 | Ga0207689_101188722 | 404 |
| 3 | 3300028800 | Ga0265338_10020744 | Ga0265338_100207444 | 409 |
| 4 | 3300013308 | Ga0157375_10004378 | Ga0157375_1000437810 | 422 |
| 5 | 3300028577 | Ga0265318_10028358 | Ga0265318_100283582 | 423 |
| 6 | 3300028800 | Ga0265338_10034714 | Ga0265338_100347142 | 423 |
| 7 | 3300031235 | Ga0265330_10004657 | Ga0265330_100046574 | 423 |
| 8 | 3300031238 | Ga0265332_10042852 | Ga0265332_100428522 | 423 |
| 9 | 3300031241 | Ga0265325_10004243 | Ga0265325_100042435 | 423 |
| 10 | 3300031595 | Ga0265313_10002161 | Ga0265313_100021614 | 423 |
| 11 | 3300031712 | Ga0265342_10001787 | Ga0265342_100017875 | 423 |
| 12 | 3300009553 | Ga0105249_10049912 | Ga0105249_100499122 | 424 |
| 13 | 3300042876 | Ga0451577_0294750 | Ga0451577_0294750_25_1356 | 432 |
| 14 | 3300031344 | Ga0265316_10116207 | Ga0265316_101162072 | 435 |
| 15 | 3300031251 | Ga0265327_10010465 | Ga0265327_100104653 | 439 |
| 16 | 3300031241 | Ga0265325_10004445 | Ga0265325_100044454 | 440 |
| 17 | 3300047319 | Ga0495674_0176779 | Ga0495674_0176779_253_1740 | 441 |
| 18 | 3300028800 | Ga0265338_10015022 | Ga0265338_100150225 | 443 |
| 19 | 3300031711 | Ga0265314_10000090 | Ga0265314_1000009075 | 443 |
| 20 | 3300005329 | Ga0070683_100000013 | Ga0070683_100000013135 | 445 |
| 21 | 3300005535 | Ga0070684_100000151 | Ga0070684_10000015122 | 445 |
| 22 | 3300025944 | Ga0207661_10000018 | Ga0207661_10000018135 | 445 |
| 23 | 3300028653 | Ga0265323_10005508 | Ga0265323_100055083 | 445 |
| 24 | 3300006028 | Ga0070717_10066874 | Ga0070717_100668742 | 447 |
| 25 | 3300046543 | Ga0495645_0071248 | Ga0495645_0071248_569_2014 | 449 |
| 26 | 3300005535 | Ga0070684_100081301 | Ga0070684_1000813012 | 450 |
| 27 | 3300014325 | Ga0163163_10099947 | Ga0163163_100999471 | 450 |
| 28 | 3300014969 | Ga0157376_10017982 | Ga0157376_100179824 | 450 |
| 29 | 3300025941 | Ga0207711_10127620 | Ga0207711_101276202 | 450 |
| 30 | 3300046472 | Ga0495580_0000160 | Ga0495580_0000160_29671_31122 | 450 |
| 31 | 3300047471 | Ga0495684_0003377 | Ga0495684_0003377_2583_4034 | 450 |
| 32 | 3300048088 | Ga0495602_0006533 | Ga0495602_0006533_7814_9265 | 450 |
| 33 | 3300014325 | Ga0163163_10003532 | Ga0163163_100035327 | 453 |
| 34 | 3300060353 | Ga0501082_0000009 | Ga0501082_0000009_101025_102458 | 453 |
| 35 | 3300031344 | Ga0265316_10003316 | Ga0265316_1000331617 | 455 |
| 36 | 3300014969 | Ga0157376_10067002 | Ga0157376_100670023 | 456 |
| 37 | 3300005548 | Ga0070665_100087148 | Ga0070665_1000871483 | 457 |
| 38 | 3300013105 | Ga0157369_10076314 | Ga0157369_100763142 | 457 |
| 39 | 3300028800 | Ga0265338_10001846 | Ga0265338_1000184624 | 457 |
| 40 | 3300031239 | Ga0265328_10007374 | Ga0265328_100073742 | 457 |
| 41 | 3300031249 | Ga0265339_10002593 | Ga0265339_100025937 | 457 |
| 42 | 3300031344 | Ga0265316_10007178 | Ga0265316_100071789 | 457 |
| 43 | 3300031711 | Ga0265314_10002820 | Ga0265314_1000282010 | 457 |
| 44 | 3300031712 | Ga0265342_10023647 | Ga0265342_100236472 | 457 |
| 45 | 3300031344 | Ga0265316_10114137 | Ga0265316_101141372 | 459 |
| 46 | 3300047319 | Ga0495674_0126475 | Ga0495674_0126475_549_2015 | 459 |
| 47 | 3300047471 | Ga0495684_0049718 | Ga0495684_0049718_1266_2732 | 459 |
| 48 | 3300005329 | Ga0070683_100019637 | Ga0070683_1000196373 | 460 |
| 49 | 3300009093 | Ga0105240_10000788 | Ga0105240_1000078819 | 460 |
| 50 | 3300025913 | Ga0207695_10018719 | Ga0207695_100187197 | 460 |
| 51 | 3300025944 | Ga0207661_10075252 | Ga0207661_100752522 | 460 |
| 52 | 3300005436 | Ga0070713_100002320 | Ga0070713_1000023202 | 462 |
| 53 | 3300009093 | Ga0105240_10022446 | Ga0105240_100224463 | 462 |
| 54 | 3300009093 | Ga0105240_10039426 | Ga0105240_100394266 | 462 |
| 55 | 3300009177 | Ga0105248_10023606 | Ga0105248_100236062 | 462 |
| 56 | 3300009545 | Ga0105237_10054638 | Ga0105237_100546383 | 462 |
| 57 | 3300025913 | Ga0207695_10087510 | Ga0207695_100875102 | 462 |
| 58 | 3300025914 | Ga0207671_10029761 | Ga0207671_100297613 | 462 |
| 59 | 3300025928 | Ga0207700_10001921 | Ga0207700_100019219 | 462 |
| 60 | 3300005549 | Ga0070704_100179464 | Ga0070704_1001794641 | 464 |
| 61 | 3300031733 | Ga0316577_10028488 | Ga0316577_100284882 | 464 |
| 62 | 3300031344 | Ga0265316_10068924 | Ga0265316_100689242 | 465 |
| 63 | 3300039450 | Ga0436363_0413793 | Ga0436363_0413793_222_1676 | 466 |
| 64 | 3300031712 | Ga0265342_10003419 | Ga0265342_100034196 | 467 |
| 65 | 3300046462 | Ga0495651_0033477 | Ga0495651_0033477_2375_3826 | 467 |
| 66 | 3300046463 | Ga0495653_0056892 | Ga0495653_0056892_1166_2617 | 467 |
| 67 | 3300046476 | Ga0495662_0027305 | Ga0495662_0027305_80_1531 | 467 |
| 68 | 3300046477 | Ga0495664_0064904 | Ga0495664_0064904_271_1722 | 467 |
| 69 | 3300046511 | Ga0495608_0128412 | Ga0495608_0128412_52_1503 | 467 |
| 70 | 3300046529 | Ga0495652_0123299 | Ga0495652_0123299_189_1640 | 467 |
| 71 | 3300046559 | Ga0495667_0032247 | Ga0495667_0032247_909_2360 | 467 |
| 72 | 3300046663 | Ga0495635_0011851 | Ga0495635_0011851_1657_3108 | 467 |
| 73 | 3300046678 | Ga0495599_0017065 | Ga0495599_0017065_2670_4121 | 467 |
| 74 | 3300047317 | Ga0495604_0023327 | Ga0495604_0023327_684_2135 | 467 |
| 75 | 3300047444 | Ga0495675_0029172 | Ga0495675_0029172_1957_3408 | 467 |
| 76 | 3300013307 | Ga0157372_10048853 | Ga0157372_100488534 | 468 |
| 77 | 3300031712 | Ga0265342_10058158 | Ga0265342_100581582 | 468 |
| 78 | 3300046472 | Ga0495580_0014305 | Ga0495580_0014305_1713_3164 | 469 |
| 79 | 3300046543 | Ga0495645_0003859 | Ga0495645_0003859_7075_8526 | 469 |
| 80 | 3300047444 | Ga0495675_0079581 | Ga0495675_0079581_146_1720 | 469 |
| 81 | 3300047471 | Ga0495684_0108016 | Ga0495684_0108016_339_1790 | 469 |
| 82 | 3300005329 | Ga0070683_100002212 | Ga0070683_10000221212 | 470 |
| 83 | 3300005535 | Ga0070684_100000918 | Ga0070684_10000091821 | 470 |
| 84 | 3300005563 | Ga0068855_100032325 | Ga0068855_1000323257 | 470 |
| 85 | 3300009174 | Ga0105241_10042275 | Ga0105241_100422753 | 470 |
| 86 | 3300010375 | Ga0105239_10052149 | Ga0105239_100521492 | 470 |
| 87 | 3300013297 | Ga0157378_10037231 | Ga0157378_100372313 | 470 |
| 88 | 3300013308 | Ga0157375_10224344 | Ga0157375_102243442 | 470 |
| 89 | 3300014968 | Ga0157379_10181467 | Ga0157379_101814671 | 470 |
| 90 | 3300025944 | Ga0207661_10005192 | Ga0207661_100051925 | 470 |
| 91 | 3300031239 | Ga0265328_10012594 | Ga0265328_100125943 | 470 |
| 92 | 3300031241 | Ga0265325_10041963 | Ga0265325_100419631 | 470 |
| 93 | 3300031249 | Ga0265339_10000081 | Ga0265339_1000008149 | 470 |
| 94 | 3300031712 | Ga0265342_10000636 | Ga0265342_1000063612 | 470 |
| 95 | 3300048918 | Ga0496115_0119300 | Ga0496115_0119300_555_2006 | 470 |
| 96 | 3300009098 | Ga0105245_10067329 | Ga0105245_100673292 | 471 |
| 97 | 3300028666 | Ga0265336_10002621 | Ga0265336_100026214 | 471 |
| 98 | 3300005355 | Ga0070671_100122775 | Ga0070671_1001227752 | 472 |
| 99 | 3300005364 | Ga0070673_100070373 | Ga0070673_1000703732 | 472 |
| 100 | 3300005535 | Ga0070684_100048948 | Ga0070684_1000489483 | 472 |
| 101 | 3300005539 | Ga0068853_100009757 | Ga0068853_1000097576 | 472 |
| 102 | 3300005548 | Ga0070665_100010943 | Ga0070665_1000109438 | 472 |
| 103 | 3300005577 | Ga0068857_100000509 | Ga0068857_1000005099 | 472 |
| 104 | 3300005614 | Ga0068856_100009363 | Ga0068856_1000093638 | 472 |
| 105 | 3300005616 | Ga0068852_100034185 | Ga0068852_1000341852 | 472 |
| 106 | 3300006237 | Ga0097621_100002052 | Ga0097621_1000020524 | 472 |
| 107 | 3300009093 | Ga0105240_10008539 | Ga0105240_100085394 | 472 |
| 108 | 3300009174 | Ga0105241_10000173 | Ga0105241_1000017326 | 472 |
| 109 | 3300009174 | Ga0105241_10074747 | Ga0105241_100747472 | 472 |
| 110 | 3300009177 | Ga0105248_10281723 | Ga0105248_102817232 | 472 |
| 111 | 3300009551 | Ga0105238_10001940 | Ga0105238_100019408 | 472 |
| 112 | 3300010375 | Ga0105239_10000496 | Ga0105239_1000049624 | 472 |
| 113 | 3300013105 | Ga0157369_10013448 | Ga0157369_100134483 | 472 |
| 114 | 3300013105 | Ga0157369_10050913 | Ga0157369_100509134 | 472 |
| 115 | 3300013296 | Ga0157374_10004725 | Ga0157374_100047253 | 472 |
| 116 | 3300013296 | Ga0157374_10006358 | Ga0157374_100063588 | 472 |
| 117 | 3300013297 | Ga0157378_10021508 | Ga0157378_100215082 | 472 |
| 118 | 3300014968 | Ga0157379_10149201 | Ga0157379_101492012 | 472 |
| 119 | 3300014969 | Ga0157376_10070767 | Ga0157376_100707672 | 472 |
| 120 | 3300025911 | Ga0207654_10000061 | Ga0207654_1000006124 | 472 |
| 121 | 3300025913 | Ga0207695_10000499 | Ga0207695_1000049926 | 472 |
| 122 | 3300025924 | Ga0207694_10001368 | Ga0207694_1000136811 | 472 |
| 123 | 3300025931 | Ga0207644_10065182 | Ga0207644_100651822 | 472 |
| 124 | 3300025940 | Ga0207691_10010827 | Ga0207691_100108273 | 472 |
| 125 | 3300025941 | Ga0207711_10106826 | Ga0207711_101068262 | 472 |
| 126 | 3300026041 | Ga0207639_10079213 | Ga0207639_100792132 | 472 |
| 127 | 3300026067 | Ga0207678_10018482 | Ga0207678_100184823 | 472 |
| 128 | 3300026078 | Ga0207702_10017670 | Ga0207702_100176704 | 472 |
| 129 | 3300026116 | Ga0207674_10002086 | Ga0207674_100020869 | 472 |
| 130 | 3300026121 | Ga0207683_10000815 | Ga0207683_1000081514 | 472 |
| 131 | 3300028379 | Ga0268266_10042253 | Ga0268266_100422533 | 472 |
| 132 | 3300031235 | Ga0265330_10018354 | Ga0265330_100183543 | 472 |
| 133 | 3300031249 | Ga0265339_10007929 | Ga0265339_100079294 | 472 |
| 134 | 3300046459 | Ga0495629_0017404 | Ga0495629_0017404_3463_4923 | 472 |
| 135 | 3300046536 | Ga0495587_0028552 | Ga0495587_0028552_190_1653 | 472 |
| 136 | 3300046689 | Ga0495613_0024181 | Ga0495613_0024181_1220_2683 | 472 |
| 137 | 3300048088 | Ga0495602_0044680 | Ga0495602_0044680_1919_3379 | 472 |
| 138 | 3300005327 | Ga0070658_10021163 | Ga0070658_100211633 | 473 |
| 139 | 3300005328 | Ga0070676_10001940 | Ga0070676_100019408 | 473 |
| 140 | 3300005329 | Ga0070683_100020754 | Ga0070683_1000207544 | 473 |
| 141 | 3300005344 | Ga0070661_100036026 | Ga0070661_1000360263 | 473 |
| 142 | 3300005455 | Ga0070663_100078530 | Ga0070663_1000785302 | 473 |
| 143 | 3300005456 | Ga0070678_100022702 | Ga0070678_1000227023 | 473 |
| 144 | 3300005535 | Ga0070684_100036163 | Ga0070684_1000361635 | 473 |
| 145 | 3300005539 | Ga0068853_100006775 | Ga0068853_1000067758 | 473 |
| 146 | 3300005563 | Ga0068855_100004407 | Ga0068855_1000044076 | 473 |
| 147 | 3300005578 | Ga0068854_100072241 | Ga0068854_1000722412 | 473 |
| 148 | 3300005578 | Ga0068854_100099845 | Ga0068854_1000998452 | 473 |
| 149 | 3300005614 | Ga0068856_100004935 | Ga0068856_1000049353 | 473 |
| 150 | 3300005614 | Ga0068856_100007757 | Ga0068856_1000077578 | 473 |
| 151 | 3300005614 | Ga0068856_100020598 | Ga0068856_1000205986 | 473 |
| 152 | 3300005616 | Ga0068852_100000004 | Ga0068852_1000000045 | 473 |
| 153 | 3300005616 | Ga0068852_100245993 | Ga0068852_1002459932 | 473 |
| 154 | 3300005842 | Ga0068858_100078478 | Ga0068858_1000784782 | 473 |
| 155 | 3300006881 | Ga0068865_100002522 | Ga0068865_1000025227 | 473 |
| 156 | 3300009093 | Ga0105240_10004821 | Ga0105240_100048214 | 473 |
| 157 | 3300009093 | Ga0105240_10008484 | Ga0105240_100084845 | 473 |
| 158 | 3300009174 | Ga0105241_10022319 | Ga0105241_100223192 | 473 |
| 159 | 3300009551 | Ga0105238_10030707 | Ga0105238_100307072 | 473 |
| 160 | 3300009551 | Ga0105238_10145991 | Ga0105238_101459912 | 473 |
| 161 | 3300010375 | Ga0105239_10025864 | Ga0105239_100258645 | 473 |
| 162 | 3300013100 | Ga0157373_10052906 | Ga0157373_100529062 | 473 |
| 163 | 3300013104 | Ga0157370_10000016 | Ga0157370_100000165 | 473 |
| 164 | 3300013105 | Ga0157369_10000287 | Ga0157369_100002875 | 473 |
| 165 | 3300013105 | Ga0157369_10027807 | Ga0157369_100278073 | 473 |
| 166 | 3300013105 | Ga0157369_10049764 | Ga0157369_100497642 | 473 |
| 167 | 3300013296 | Ga0157374_10293982 | Ga0157374_102939822 | 473 |
| 168 | 3300013307 | Ga0157372_10002345 | Ga0157372_1000234514 | 473 |
| 169 | 3300013307 | Ga0157372_10003981 | Ga0157372_1000398113 | 473 |
| 170 | 3300013307 | Ga0157372_10033808 | Ga0157372_100338084 | 473 |
| 171 | 3300025904 | Ga0207647_10004356 | Ga0207647_1000435612 | 473 |
| 172 | 3300025909 | Ga0207705_10116984 | Ga0207705_101169842 | 473 |
| 173 | 3300025913 | Ga0207695_10000050 | Ga0207695_10000050355 | 473 |
| 174 | 3300025920 | Ga0207649_10059501 | Ga0207649_100595012 | 473 |
| 175 | 3300025933 | Ga0207706_10002647 | Ga0207706_1000264710 | 473 |
| 176 | 3300025942 | Ga0207689_10015609 | Ga0207689_100156093 | 473 |
| 177 | 3300025949 | Ga0207667_10004532 | Ga0207667_100045326 | 473 |
| 178 | 3300025949 | Ga0207667_10005908 | Ga0207667_100059084 | 473 |
| 179 | 3300025960 | Ga0207651_10021589 | Ga0207651_100215892 | 473 |
| 180 | 3300025986 | Ga0207658_10105711 | Ga0207658_101057112 | 473 |
| 181 | 3300026142 | Ga0207698_10000008 | Ga0207698_100000085 | 473 |
| 182 | 3300026142 | Ga0207698_10010263 | Ga0207698_100102634 | 473 |
| 183 | 3300026142 | Ga0207698_10119256 | Ga0207698_101192562 | 473 |
| 184 | 3300028379 | Ga0268266_10206104 | Ga0268266_102061042 | 473 |
| 185 | 3300048906 | Ga0496103_0145549 | Ga0496103_0145549_36_1457 | 473 |
| 186 | 3300005329 | Ga0070683_100000232 | Ga0070683_10000023220 | 474 |
| 187 | 3300005329 | Ga0070683_100102183 | Ga0070683_1001021832 | 474 |
| 188 | 3300005331 | Ga0070670_100015754 | Ga0070670_1000157545 | 474 |
| 189 | 3300005334 | Ga0068869_100001157 | Ga0068869_1000011572 | 474 |
| 190 | 3300005338 | Ga0068868_100001786 | Ga0068868_10000178612 | 474 |
| 191 | 3300005344 | Ga0070661_100006756 | Ga0070661_1000067568 | 474 |
| 192 | 3300005344 | Ga0070661_100032369 | Ga0070661_1000323691 | 474 |
| 193 | 3300005355 | Ga0070671_100000991 | Ga0070671_10000099113 | 474 |
| 194 | 3300005367 | Ga0070667_100003330 | Ga0070667_1000033303 | 474 |
| 195 | 3300005535 | Ga0070684_100000295 | Ga0070684_10000029513 | 474 |
| 196 | 3300005539 | Ga0068853_100000794 | Ga0068853_10000079412 | 474 |
| 197 | 3300005577 | Ga0068857_100009850 | Ga0068857_1000098505 | 474 |
| 198 | 3300005614 | Ga0068856_100003955 | Ga0068856_1000039553 | 474 |
| 199 | 3300005614 | Ga0068856_100006639 | Ga0068856_1000066394 | 474 |
| 200 | 3300005616 | Ga0068852_100002216 | Ga0068852_1000022166 | 474 |
| 201 | 3300005617 | Ga0068859_100002047 | Ga0068859_1000020475 | 474 |
| 202 | 3300005618 | Ga0068864_100001014 | Ga0068864_1000010144 | 474 |
| 203 | 3300005841 | Ga0068863_100000629 | Ga0068863_10000062923 | 474 |
| 204 | 3300005842 | Ga0068858_100002136 | Ga0068858_10000213611 | 474 |
| 205 | 3300005843 | Ga0068860_100000733 | Ga0068860_10000073328 | 474 |
| 206 | 3300006237 | Ga0097621_100000590 | Ga0097621_1000005904 | 474 |
| 207 | 3300006358 | Ga0068871_100008135 | Ga0068871_1000081352 | 474 |
| 208 | 3300006931 | Ga0097620_100002047 | Ga0097620_1000020475 | 474 |
| 209 | 3300009093 | Ga0105240_10000471 | Ga0105240_1000047118 | 474 |
| 210 | 3300009093 | Ga0105240_10052307 | Ga0105240_100523074 | 474 |
| 211 | 3300009098 | Ga0105245_10002635 | Ga0105245_100026353 | 474 |
| 212 | 3300009101 | Ga0105247_10002244 | Ga0105247_100022443 | 474 |
| 213 | 3300009174 | Ga0105241_10000697 | Ga0105241_100006973 | 474 |
| 214 | 3300009174 | Ga0105241_10005272 | Ga0105241_100052723 | 474 |
| 215 | 3300009545 | Ga0105237_10003673 | Ga0105237_1000367312 | 474 |
| 216 | 3300009551 | Ga0105238_10004120 | Ga0105238_1000412011 | 474 |
| 217 | 3300009551 | Ga0105238_10004462 | Ga0105238_100044628 | 474 |
| 218 | 3300010375 | Ga0105239_10005441 | Ga0105239_100054413 | 474 |
| 219 | 3300010375 | Ga0105239_10008702 | Ga0105239_100087027 | 474 |
| 220 | 3300011119 | Ga0105246_10000227 | Ga0105246_1000022711 | 474 |
| 221 | 3300013105 | Ga0157369_10008094 | Ga0157369_100080947 | 474 |
| 222 | 3300013297 | Ga0157378_10002892 | Ga0157378_100028922 | 474 |
| 223 | 3300013297 | Ga0157378_10008074 | Ga0157378_100080743 | 474 |
| 224 | 3300013306 | Ga0163162_10004024 | Ga0163162_1000402411 | 474 |
| 225 | 3300013307 | Ga0157372_10013140 | Ga0157372_100131404 | 474 |
| 226 | 3300013307 | Ga0157372_10062985 | Ga0157372_100629852 | 474 |
| 227 | 3300013308 | Ga0157375_10002161 | Ga0157375_100021614 | 474 |
| 228 | 3300014325 | Ga0163163_10002031 | Ga0163163_100020313 | 474 |
| 229 | 3300014968 | Ga0157379_10012846 | Ga0157379_100128464 | 474 |
| 230 | 3300014969 | Ga0157376_10001554 | Ga0157376_100015543 | 474 |
| 231 | 3300025911 | Ga0207654_10000555 | Ga0207654_1000055512 | 474 |
| 232 | 3300025911 | Ga0207654_10005558 | Ga0207654_100055585 | 474 |
| 233 | 3300025913 | Ga0207695_10001740 | Ga0207695_100017405 | 474 |
| 234 | 3300025913 | Ga0207695_10015681 | Ga0207695_100156817 | 474 |
| 235 | 3300025914 | Ga0207671_10000232 | Ga0207671_1000023258 | 474 |
| 236 | 3300025914 | Ga0207671_10004067 | Ga0207671_100040676 | 474 |
| 237 | 3300025924 | Ga0207694_10001017 | Ga0207694_100010172 | 474 |
| 238 | 3300025924 | Ga0207694_10001309 | Ga0207694_1000130912 | 474 |
| 239 | 3300025924 | Ga0207694_10166531 | Ga0207694_101665312 | 474 |
| 240 | 3300025925 | Ga0207650_10009928 | Ga0207650_100099285 | 474 |
| 241 | 3300025927 | Ga0207687_10001070 | Ga0207687_100010705 | 474 |
| 242 | 3300025929 | Ga0207664_10061235 | Ga0207664_100612352 | 474 |
| 243 | 3300025931 | Ga0207644_10003363 | Ga0207644_100033634 | 474 |
| 244 | 3300025942 | Ga0207689_10001098 | Ga0207689_100010984 | 474 |
| 245 | 3300025949 | Ga0207667_10010675 | Ga0207667_100106757 | 474 |
| 246 | 3300025986 | Ga0207658_10011318 | Ga0207658_100113182 | 474 |
| 247 | 3300026023 | Ga0207677_10000753 | Ga0207677_1000075311 | 474 |
| 248 | 3300026035 | Ga0207703_10005407 | Ga0207703_100054078 | 474 |
| 249 | 3300026041 | Ga0207639_10001235 | Ga0207639_100012358 | 474 |
| 250 | 3300026078 | Ga0207702_10003459 | Ga0207702_1000345914 | 474 |
| 251 | 3300026078 | Ga0207702_10004521 | Ga0207702_100045218 | 474 |
| 252 | 3300026088 | Ga0207641_10001373 | Ga0207641_100013738 | 474 |
| 253 | 3300026095 | Ga0207676_10021276 | Ga0207676_100212763 | 474 |
| 254 | 3300026116 | Ga0207674_10002450 | Ga0207674_100024504 | 474 |
| 255 | 3300026142 | Ga0207698_10001996 | Ga0207698_100019967 | 474 |
| 256 | 3300028381 | Ga0268264_10002830 | Ga0268264_100028308 | 474 |
| 257 | 3300028800 | Ga0265338_10004949 | Ga0265338_100049492 | 474 |
| 258 | 3300028800 | Ga0265338_10027470 | Ga0265338_100274704 | 474 |
| 259 | 3300031711 | Ga0265314_10032304 | Ga0265314_100323042 | 474 |
| 260 | 3300035172 | Ga0373955_0017111 | Ga0373955_0017111_914_2464 | 474 |
| 261 | 3300037466 | Ga0395898_0077493 | Ga0395898_0077493_836_2302 | 474 |
| 262 | 3300025929 | Ga0207664_10004022 | Ga0207664_100040223 | 475 |
| 263 | 3300031235 | Ga0265330_10003771 | Ga0265330_100037712 | 475 |
| 264 | 3300031235 | Ga0265330_10020443 | Ga0265330_100204432 | 475 |
| 265 | 3300031241 | Ga0265325_10000731 | Ga0265325_100007317 | 475 |
| 266 | 3300031249 | Ga0265339_10002003 | Ga0265339_100020038 | 475 |
| 267 | 3300031344 | Ga0265316_10003282 | Ga0265316_1000328213 | 475 |
| 268 | 3300031344 | Ga0265316_10007229 | Ga0265316_100072298 | 475 |
| 269 | 3300031595 | Ga0265313_10008448 | Ga0265313_100084484 | 475 |
| 270 | 3300031712 | Ga0265342_10007514 | Ga0265342_100075144 | 475 |
| 271 | 3300005327 | Ga0070658_10009911 | Ga0070658_100099116 | 476 |
| 272 | 3300005336 | Ga0070680_100009850 | Ga0070680_1000098504 | 476 |
| 273 | 3300005339 | Ga0070660_100001797 | Ga0070660_1000017975 | 476 |
| 274 | 3300005458 | Ga0070681_10001151 | Ga0070681_100011513 | 476 |
| 275 | 3300005530 | Ga0070679_100006004 | Ga0070679_1000060048 | 476 |
| 276 | 3300005563 | Ga0068855_100002307 | Ga0068855_1000023078 | 476 |
| 277 | 3300005577 | Ga0068857_100047871 | Ga0068857_1000478713 | 476 |
| 278 | 3300005616 | Ga0068852_100005699 | Ga0068852_1000056994 | 476 |
| 279 | 3300009093 | Ga0105240_10049613 | Ga0105240_100496133 | 476 |
| 280 | 3300009551 | Ga0105238_10002721 | Ga0105238_100027215 | 476 |
| 281 | 3300013102 | Ga0157371_10061194 | Ga0157371_100611942 | 476 |
| 282 | 3300013104 | Ga0157370_10013716 | Ga0157370_100137167 | 476 |
| 283 | 3300013307 | Ga0157372_10001533 | Ga0157372_1000153314 | 476 |
| 284 | 3300025912 | Ga0207707_10005979 | Ga0207707_100059792 | 476 |
| 285 | 3300025913 | Ga0207695_10000995 | Ga0207695_100009958 | 476 |
| 286 | 3300025919 | Ga0207657_10000449 | Ga0207657_1000044920 | 476 |
| 287 | 3300025921 | Ga0207652_10016697 | Ga0207652_100166974 | 476 |
| 288 | 3300025924 | Ga0207694_10008190 | Ga0207694_100081903 | 476 |
| 289 | 3300025949 | Ga0207667_10000079 | Ga0207667_1000007914 | 476 |
| 290 | 3300026116 | Ga0207674_10123495 | Ga0207674_101234952 | 476 |
| 291 | 3300026142 | Ga0207698_10037301 | Ga0207698_100373014 | 476 |
| 292 | 3300046684 | Ga0495669_0019659 | Ga0495669_0019659_1123_2562 | 476 |
| 293 | 3300031241 | Ga0265325_10003635 | Ga0265325_100036357 | 477 |
| 294 | 3300031344 | Ga0265316_10011579 | Ga0265316_100115794 | 477 |
| 295 | 3300031712 | Ga0265342_10072531 | Ga0265342_100725312 | 477 |
| 296 | 3300045976 | Ga0466967_0062520 | Ga0466967_0062520_705_2180 | 477 |
| 297 | 3300013307 | Ga0157372_10013600 | Ga0157372_100136004 | 478 |
| 298 | 3300031235 | Ga0265330_10018157 | Ga0265330_100181572 | 478 |
| 299 | 3300031241 | Ga0265325_10043186 | Ga0265325_100431862 | 478 |
| 300 | 3300031247 | Ga0265340_10037917 | Ga0265340_100379171 | 478 |
| 301 | 3300031344 | Ga0265316_10008207 | Ga0265316_100082075 | 478 |
| 302 | 3300005329 | Ga0070683_100014899 | Ga0070683_1000148991 | 480 |
| 303 | 3300005436 | Ga0070713_100151289 | Ga0070713_1001512892 | 480 |
| 304 | 3300005535 | Ga0070684_100144857 | Ga0070684_1001448572 | 480 |
| 305 | 3300005618 | Ga0068864_100012908 | Ga0068864_1000129087 | 480 |
| 306 | 3300005841 | Ga0068863_100039701 | Ga0068863_1000397013 | 480 |
| 307 | 3300009177 | Ga0105248_10077774 | Ga0105248_100777742 | 480 |
| 308 | 3300014325 | Ga0163163_10005991 | Ga0163163_100059913 | 480 |
| 309 | 3300014325 | Ga0163163_10024622 | Ga0163163_100246224 | 480 |
| 310 | 3300025911 | Ga0207654_10053682 | Ga0207654_100536822 | 480 |
| 311 | 3300026095 | Ga0207676_10018067 | Ga0207676_100180674 | 480 |
| 312 | 3300046475 | Ga0495639_0060155 | Ga0495639_0060155_60_1511 | 480 |
| 313 | 3300046531 | Ga0495665_0037110 | Ga0495665_0037110_397_1848 | 480 |
| 314 | 3300047315 | Ga0495581_0004594 | Ga0495581_0004594_2320_3771 | 480 |
| 315 | 3300048915 | Ga0496112_0041047 | Ga0496112_0041047_1830_3281 | 480 |
| 316 | 3300053085 | Ga0495619_0010522 | Ga0495619_0010522_576_2027 | 480 |
| 317 | 3300013105 | Ga0157369_10001929 | Ga0157369_1000192911 | 481 |
| 318 | 3300031241 | Ga0265325_10000515 | Ga0265325_100005157 | 481 |
| 319 | 3300031250 | Ga0265331_10017523 | Ga0265331_100175233 | 481 |
| 320 | 3300031344 | Ga0265316_10046167 | Ga0265316_100461672 | 481 |
| 321 | 3300031548 | Ga0307408_100189380 | Ga0307408_1001893801 | 481 |
| 322 | 3300031595 | Ga0265313_10004842 | Ga0265313_100048424 | 481 |
| 323 | 3300031852 | Ga0307410_10035766 | Ga0307410_100357662 | 481 |
| 324 | 3300031901 | Ga0307406_10039104 | Ga0307406_100391042 | 481 |
| 325 | 3300031995 | Ga0307409_100058095 | Ga0307409_1000580953 | 481 |
| 326 | 3300031995 | Ga0307409_100107255 | Ga0307409_1001072552 | 481 |
| 327 | 3300032002 | Ga0307416_100049892 | Ga0307416_1000498923 | 481 |
| 328 | 3300032002 | Ga0307416_100150706 | Ga0307416_1001507061 | 481 |
| 329 | 3300032005 | Ga0307411_10006972 | Ga0307411_100069723 | 481 |
| 330 | 3300042876 | Ga0451577_0021028 | Ga0451577_0021028_4390_5841 | 481 |
| 331 | 3300028800 | Ga0265338_10122483 | Ga0265338_101224832 | 482 |
| 332 | 3300031241 | Ga0265325_10038175 | Ga0265325_100381752 | 482 |
| 333 | 3300035118 | Ga0373954_0000162 | Ga0373954_0000162_3194_4663 | 482 |
| 334 | 3300035119 | Ga0373956_0016373 | Ga0373956_0016373_726_2195 | 482 |
| 335 | 3300035172 | Ga0373955_0002394 | Ga0373955_0002394_5508_6977 | 482 |
| 336 | 3300035724 | Ga0373933_0004916 | Ga0373933_0004916_4852_6321 | 482 |
| 337 | 3300036401 | Ga0373937_0002199 | Ga0373937_0002199_6954_8423 | 482 |
| 338 | 3300046511 | Ga0495608_0012320 | Ga0495608_0012320_1376_2845 | 482 |
| 339 | 3300046536 | Ga0495587_0008835 | Ga0495587_0008835_1889_3358 | 482 |
| 340 | 3300046679 | Ga0495623_0030648 | Ga0495623_0030648_1956_3425 | 482 |
| 341 | 3300047317 | Ga0495604_0001581 | Ga0495604_0001581_3320_4789 | 482 |
| 342 | 3300048088 | Ga0495602_0003442 | Ga0495602_0003442_12613_14082 | 482 |
| 343 | 3300042876 | Ga0451577_0000215 | Ga0451577_0000215_86869_88341 | 484 |
| 344 | 3300044712 | Ga0453684_0000545 | Ga0453684_0000545_133207_134679 | 484 |
| 345 | 3300045976 | Ga0466967_0002817 | Ga0466967_0002817_1634_3100 | 485 |
| 346 | 3300005436 | Ga0070713_100023325 | Ga0070713_1000233252 | 487 |
| 347 | 3300005616 | Ga0068852_100135694 | Ga0068852_1001356942 | 487 |
| 348 | 3300006028 | Ga0070717_10023307 | Ga0070717_100233072 | 487 |
| 349 | 3300009545 | Ga0105237_10088178 | Ga0105237_100881782 | 487 |
| 350 | 3300009551 | Ga0105238_10039762 | Ga0105238_100397622 | 487 |
| 351 | 3300014325 | Ga0163163_10010003 | Ga0163163_100100032 | 487 |
| 352 | 3300025913 | Ga0207695_10131626 | Ga0207695_101316262 | 487 |
| 353 | 3300025914 | Ga0207671_10071171 | Ga0207671_100711712 | 487 |
| 354 | 3300025928 | Ga0207700_10071638 | Ga0207700_100716382 | 487 |
| 355 | 3300046455 | Ga0495603_0081666 | Ga0495603_0081666_151_1638 | 487 |
| 356 | 3300046499 | Ga0495594_0029683 | Ga0495594_0029683_1231_2718 | 487 |
| 357 | 3300046535 | Ga0495586_0086069 | Ga0495586_0086069_69_1556 | 487 |
| 358 | 3300046675 | Ga0495657_0128017 | Ga0495657_0128017_38_1525 | 487 |
| 359 | 3300046684 | Ga0495669_0012245 | Ga0495669_0012245_1079_2566 | 487 |
| 360 | 3300047319 | Ga0495674_0127607 | Ga0495674_0127607_291_1778 | 487 |
| 361 | 3300047444 | Ga0495675_0001667 | Ga0495675_0001667_6342_7829 | 487 |
| 362 | 3300031711 | Ga0265314_10007441 | Ga0265314_100074414 | 491 |
| 363 | 3300005338 | Ga0068868_100003783 | Ga0068868_1000037833 | 493 |
| 364 | 3300005434 | Ga0070709_10022335 | Ga0070709_100223354 | 493 |
| 365 | 3300005841 | Ga0068863_100174388 | Ga0068863_1001743882 | 493 |
| 366 | 3300006237 | Ga0097621_100000655 | Ga0097621_10000065512 | 493 |
| 367 | 3300006237 | Ga0097621_100050999 | Ga0097621_1000509992 | 493 |
| 368 | 3300013297 | Ga0157378_10000256 | Ga0157378_1000025610 | 493 |
| 369 | 3300013306 | Ga0163162_10056233 | Ga0163162_100562334 | 493 |
| 370 | 3300026023 | Ga0207677_10002017 | Ga0207677_100020173 | 493 |
| 371 | 3300006914 | Ga0075436_100029764 | Ga0075436_1000297643 | 494 |
| 372 | 3300007076 | Ga0075435_100036831 | Ga0075435_1000368312 | 494 |
| 373 | 3300025906 | Ga0207699_10006944 | Ga0207699_100069442 | 494 |
| 374 | 3300050514 | nmdc:mga08x19_4193_c1 | nmdc:mga08x19_4193_c1_6343_7842 | 494 |
| 375 | 3300005435 | Ga0070714_100024698 | Ga0070714_1000246982 | 495 |
| 376 | 3300005614 | Ga0068856_100009962 | Ga0068856_1000099627 | 495 |
| 377 | 3300006914 | Ga0075436_100005126 | Ga0075436_1000051269 | 495 |
| 378 | 3300009093 | Ga0105240_10056186 | Ga0105240_100561865 | 495 |
| 379 | 3300013307 | Ga0157372_10009817 | Ga0157372_1000981710 | 495 |
| 380 | 3300013307 | Ga0157372_10031547 | Ga0157372_100315474 | 495 |
| 381 | 3300025913 | Ga0207695_10084911 | Ga0207695_100849112 | 495 |
| 382 | 3300026078 | Ga0207702_10001914 | Ga0207702_100019147 | 495 |
| 383 | 3300031711 | Ga0265314_10026234 | Ga0265314_100262344 | 495 |
| 384 | 3300050514 | nmdc:mga08x19_37115_c1 | nmdc:mga08x19_37115_c1_1338_2840 | 495 |
| 385 | 3300026088 | Ga0207641_10156844 | Ga0207641_101568442 | 496 |
| 386 | 3300031344 | Ga0265316_10024239 | Ga0265316_100242394 | 496 |
| 387 | 3300005435 | Ga0070714_100054217 | Ga0070714_1000542172 | 497 |
| 388 | 3300005436 | Ga0070713_100014596 | Ga0070713_1000145964 | 497 |
| 389 | 3300014325 | Ga0163163_10022862 | Ga0163163_100228625 | 497 |
| 390 | 3300025906 | Ga0207699_10056790 | Ga0207699_100567902 | 497 |
| 391 | 3300025928 | Ga0207700_10010487 | Ga0207700_100104872 | 497 |
| 392 | 3300031090 | Ga0265760_10000861 | Ga0265760_100008616 | 497 |
| 393 | 3300044706 | Ga0466964_0045141 | Ga0466964_0045141_243_1739 | 497 |
| 394 | 3300046472 | Ga0495580_0000677 | Ga0495580_0000677_27247_28743 | 497 |
| 395 | 3300046472 | Ga0495580_0009186 | Ga0495580_0009186_5482_6987 | 497 |
| 396 | 3300005436 | Ga0070713_100000162 | Ga0070713_10000016244 | 498 |
| 397 | 3300005436 | Ga0070713_100119592 | Ga0070713_1001195922 | 498 |
| 398 | 3300005563 | Ga0068855_100149224 | Ga0068855_1001492242 | 498 |
| 399 | 3300005844 | Ga0068862_100084550 | Ga0068862_1000845502 | 498 |
| 400 | 3300006028 | Ga0070717_10106331 | Ga0070717_101063312 | 498 |
| 401 | 3300006028 | Ga0070717_10155256 | Ga0070717_101552561 | 498 |
| 402 | 3300006163 | Ga0070715_10016820 | Ga0070715_100168202 | 498 |
| 403 | 3300006173 | Ga0070716_100003763 | Ga0070716_1000037632 | 498 |
| 404 | 3300006175 | Ga0070712_100006085 | Ga0070712_1000060858 | 498 |
| 405 | 3300009098 | Ga0105245_10002051 | Ga0105245_1000205112 | 498 |
| 406 | 3300025906 | Ga0207699_10063074 | Ga0207699_100630741 | 498 |
| 407 | 3300025915 | Ga0207693_10000119 | Ga0207693_1000011965 | 498 |
| 408 | 3300025928 | Ga0207700_10028770 | Ga0207700_100287702 | 498 |
| 409 | 3300025939 | Ga0207665_10005931 | Ga0207665_100059313 | 498 |
| 410 | 3300025939 | Ga0207665_10075360 | Ga0207665_100753601 | 498 |
| 411 | 3300031090 | Ga0265760_10004210 | Ga0265760_100042103 | 498 |
| 412 | 3300046472 | Ga0495580_0007106 | Ga0495580_0007106_3130_4638 | 498 |
| 413 | 3300005435 | Ga0070714_100023105 | Ga0070714_1000231055 | 499 |
| 414 | 3300005439 | Ga0070711_100003803 | Ga0070711_10000380311 | 499 |
| 415 | 3300005467 | Ga0070706_100012515 | Ga0070706_1000125155 | 499 |
| 416 | 3300006028 | Ga0070717_10005985 | Ga0070717_100059857 | 499 |
| 417 | 3300006028 | Ga0070717_10103686 | Ga0070717_101036862 | 499 |
| 418 | 3300006175 | Ga0070712_100000057 | Ga0070712_10000005732 | 499 |
| 419 | 3300006175 | Ga0070712_100040964 | Ga0070712_1000409643 | 499 |
| 420 | 3300014497 | Ga0182008_10007647 | Ga0182008_100076472 | 499 |
| 421 | 3300025905 | Ga0207685_10004799 | Ga0207685_100047992 | 499 |
| 422 | 3300025910 | Ga0207684_10039919 | Ga0207684_100399192 | 499 |
| 423 | 3300025915 | Ga0207693_10000004 | Ga0207693_10000004150 | 499 |
| 424 | 3300025915 | Ga0207693_10043453 | Ga0207693_100434532 | 499 |
| 425 | 3300025928 | Ga0207700_10001036 | Ga0207700_1000103616 | 499 |
| 426 | 3300025928 | Ga0207700_10052459 | Ga0207700_100524592 | 499 |
| 427 | 3300028380 | Ga0268265_10119820 | Ga0268265_101198201 | 499 |
| 428 | 3300031241 | Ga0265325_10002504 | Ga0265325_100025048 | 499 |
| 429 | 3300035692 | Ga0373935_0008498 | Ga0373935_0008498_2708_4210 | 499 |
| 430 | 3300037068 | Ga0373925_0020863 | Ga0373925_0020863_1360_2862 | 499 |
| 431 | 3300045976 | Ga0466967_0105981 | Ga0466967_0105981_1050_2561 | 499 |
| 432 | 3300046472 | Ga0495580_0009824 | Ga0495580_0009824_2669_4186 | 499 |
| 433 | 3300046543 | Ga0495645_0050596 | Ga0495645_0050596_274_1776 | 499 |
| 434 | 3300047319 | Ga0495674_0053028 | Ga0495674_0053028_768_2270 | 499 |
| 435 | 3300048088 | Ga0495602_0123488 | Ga0495602_0123488_512_2023 | 499 |
| 436 | 3300048918 | Ga0496115_0007893 | Ga0496115_0007893_1088_2590 | 499 |
| 437 | 3300001976 | JGI24752J21851_1001586 | JGI24752J21851_10015862 | 500 |
| 438 | 3300001991 | JGI24743J22301_10000320 | JGI24743J22301_100003204 | 500 |
| 439 | 3300002239 | JGI24034J26672_10000626 | JGI24034J26672_100006264 | 500 |
| 440 | 3300002459 | JGI24751J29686_10000820 | JGI24751J29686_100008206 | 500 |
| 441 | 3300005328 | Ga0070676_10018556 | Ga0070676_100185562 | 500 |
| 442 | 3300005329 | Ga0070683_100009129 | Ga0070683_1000091296 | 500 |
| 443 | 3300005333 | Ga0070677_10022092 | Ga0070677_100220922 | 500 |
| 444 | 3300005337 | Ga0070682_100005613 | Ga0070682_1000056136 | 500 |
| 445 | 3300005339 | Ga0070660_100003632 | Ga0070660_1000036327 | 500 |
| 446 | 3300005343 | Ga0070687_100002133 | Ga0070687_1000021336 | 500 |
| 447 | 3300005347 | Ga0070668_100023425 | Ga0070668_1000234253 | 500 |
| 448 | 3300005354 | Ga0070675_100027019 | Ga0070675_1000270193 | 500 |
| 449 | 3300005364 | Ga0070673_100063291 | Ga0070673_1000632911 | 500 |
| 450 | 3300005365 | Ga0070688_100003030 | Ga0070688_1000030306 | 500 |
| 451 | 3300005366 | Ga0070659_100003873 | Ga0070659_1000038737 | 500 |
| 452 | 3300005437 | Ga0070710_10003631 | Ga0070710_100036316 | 500 |
| 453 | 3300005441 | Ga0070700_100060087 | Ga0070700_1000600872 | 500 |
| 454 | 3300005466 | Ga0070685_10015501 | Ga0070685_100155011 | 500 |
| 455 | 3300005530 | Ga0070679_100065942 | Ga0070679_1000659422 | 500 |
| 456 | 3300005535 | Ga0070684_100001871 | Ga0070684_1000018718 | 500 |
| 457 | 3300005544 | Ga0070686_100003107 | Ga0070686_1000031075 | 500 |
| 458 | 3300005544 | Ga0070686_100044289 | Ga0070686_1000442892 | 500 |
| 459 | 3300005577 | Ga0068857_100006523 | Ga0068857_1000065237 | 500 |
| 460 | 3300005615 | Ga0070702_100058812 | Ga0070702_1000588122 | 500 |
| 461 | 3300005616 | Ga0068852_100013841 | Ga0068852_1000138414 | 500 |
| 462 | 3300005718 | Ga0068866_10003613 | Ga0068866_100036136 | 500 |
| 463 | 3300005719 | Ga0068861_100004458 | Ga0068861_1000044584 | 500 |
| 464 | 3300005834 | Ga0068851_10051141 | Ga0068851_100511412 | 500 |
| 465 | 3300005840 | Ga0068870_10003922 | Ga0068870_100039225 | 500 |
| 466 | 3300005841 | Ga0068863_100010389 | Ga0068863_1000103895 | 500 |
| 467 | 3300006173 | Ga0070716_100000239 | Ga0070716_10000023912 | 500 |
| 468 | 3300006175 | Ga0070712_100004797 | Ga0070712_1000047972 | 500 |
| 469 | 3300006175 | Ga0070712_100023766 | Ga0070712_1000237662 | 500 |
| 470 | 3300006871 | Ga0075434_100006250 | Ga0075434_1000062505 | 500 |
| 471 | 3300006881 | Ga0068865_100005956 | Ga0068865_1000059566 | 500 |
| 472 | 3300009098 | Ga0105245_10029969 | Ga0105245_100299694 | 500 |
| 473 | 3300009174 | Ga0105241_10066102 | Ga0105241_100661022 | 500 |
| 474 | 3300013100 | Ga0157373_10001459 | Ga0157373_100014599 | 500 |
| 475 | 3300013297 | Ga0157378_10016107 | Ga0157378_100161076 | 500 |
| 476 | 3300017792 | Ga0163161_10009379 | Ga0163161_100093794 | 500 |
| 477 | 3300025893 | Ga0207682_10003281 | Ga0207682_100032813 | 500 |
| 478 | 3300025900 | Ga0207710_10004491 | Ga0207710_100044913 | 500 |
| 479 | 3300025901 | Ga0207688_10013571 | Ga0207688_100135712 | 500 |
| 480 | 3300025904 | Ga0207647_10010779 | Ga0207647_100107791 | 500 |
| 481 | 3300025907 | Ga0207645_10001057 | Ga0207645_1000105710 | 500 |
| 482 | 3300025908 | Ga0207643_10003212 | Ga0207643_100032126 | 500 |
| 483 | 3300025914 | Ga0207671_10025734 | Ga0207671_100257342 | 500 |
| 484 | 3300025915 | Ga0207693_10033843 | Ga0207693_100338432 | 500 |
| 485 | 3300025915 | Ga0207693_10061788 | Ga0207693_100617882 | 500 |
| 486 | 3300025916 | Ga0207663_10036175 | Ga0207663_100361752 | 500 |
| 487 | 3300025918 | Ga0207662_10004364 | Ga0207662_100043647 | 500 |
| 488 | 3300025925 | Ga0207650_10000059 | Ga0207650_100000596 | 500 |
| 489 | 3300025927 | Ga0207687_10020023 | Ga0207687_100200233 | 500 |
| 490 | 3300025933 | Ga0207706_10002800 | Ga0207706_100028006 | 500 |
| 491 | 3300025936 | Ga0207670_10032222 | Ga0207670_100322221 | 500 |
| 492 | 3300025939 | Ga0207665_10000850 | Ga0207665_100008508 | 500 |
| 493 | 3300025940 | Ga0207691_10008005 | Ga0207691_100080056 | 500 |
| 494 | 3300025941 | Ga0207711_10007155 | Ga0207711_100071554 | 500 |
| 495 | 3300025942 | Ga0207689_10002443 | Ga0207689_100024436 | 500 |
| 496 | 3300025944 | Ga0207661_10000973 | Ga0207661_1000097310 | 500 |
| 497 | 3300025945 | Ga0207679_10000427 | Ga0207679_1000042710 | 500 |
| 498 | 3300025949 | Ga0207667_10075911 | Ga0207667_100759113 | 500 |
| 499 | 3300026067 | Ga0207678_10009033 | Ga0207678_100090335 | 500 |
| 500 | 3300026088 | Ga0207641_10000025 | Ga0207641_100000258 | 500 |
| 501 | 3300026089 | Ga0207648_10000151 | Ga0207648_1000015119 | 500 |
| 502 | 3300026095 | Ga0207676_10000252 | Ga0207676_100002523 | 500 |
| 503 | 3300026116 | Ga0207674_10000162 | Ga0207674_1000016256 | 500 |
| 504 | 3300026118 | Ga0207675_100002440 | Ga0207675_10000244011 | 500 |
| 505 | 3300026121 | Ga0207683_10000225 | Ga0207683_1000022512 | 500 |
| 506 | 3300026142 | Ga0207698_10014569 | Ga0207698_100145693 | 500 |
| 507 | 3300028379 | Ga0268266_10012912 | Ga0268266_100129126 | 500 |
| 508 | 3300028381 | Ga0268264_10020253 | Ga0268264_100202531 | 500 |
| 509 | 3300031239 | Ga0265328_10008353 | Ga0265328_100083532 | 500 |
| 510 | 3300031249 | Ga0265339_10011078 | Ga0265339_100110783 | 500 |
| 511 | 3300039438 | Ga0436360_0329430 | Ga0436360_0329430_582_2090 | 500 |
| 512 | 3300048905 | Ga0496102_0010317 | Ga0496102_0010317_6272_7774 | 500 |
| 513 | 3300050512 | nmdc:mga0n895_1227_c1 | nmdc:mga0n895_1227_c1_13420_14928 | 500 |
| 514 | 3300005290 | Ga0065712_10017699 | Ga0065712_100176992 | 501 |
| 515 | 3300005564 | Ga0070664_100040970 | Ga0070664_1000409702 | 501 |
| 516 | 3300009093 | Ga0105240_10030386 | Ga0105240_100303867 | 501 |
| 517 | 3300009551 | Ga0105238_10015439 | Ga0105238_100154397 | 501 |
| 518 | 3300010375 | Ga0105239_10284765 | Ga0105239_102847651 | 501 |
| 519 | 3300013296 | Ga0157374_10049561 | Ga0157374_100495612 | 501 |
| 520 | 3300013296 | Ga0157374_10119027 | Ga0157374_101190272 | 501 |
| 521 | 3300013297 | Ga0157378_10107060 | Ga0157378_101070602 | 501 |
| 522 | 3300013306 | Ga0163162_10071143 | Ga0163162_100711432 | 501 |
| 523 | 3300014325 | Ga0163163_10002997 | Ga0163163_100029979 | 501 |
| 524 | 3300015261 | Ga0182006_1025547 | Ga0182006_10255472 | 501 |
| 525 | 3300025911 | Ga0207654_10043895 | Ga0207654_100438952 | 501 |
| 526 | 3300025919 | Ga0207657_10020386 | Ga0207657_100203862 | 501 |
| 527 | 3300025933 | Ga0207706_10028718 | Ga0207706_100287183 | 501 |
| 528 | 3300026023 | Ga0207677_10056856 | Ga0207677_100568562 | 501 |
| 529 | 3300046472 | Ga0495580_0007730 | Ga0495580_0007730_6432_7955 | 501 |
| 530 | 3300048903 | Ga0496100_0114174 | Ga0496100_0114174_57_1580 | 501 |
| 531 | 3300048908 | Ga0496105_0066361 | Ga0496105_0066361_1163_2686 | 501 |
| 532 | 3300048910 | Ga0496107_0095015 | Ga0496107_0095015_331_1854 | 501 |
| 533 | 3300048915 | Ga0496112_0141323 | Ga0496112_0141323_383_1906 | 501 |
| 534 | 3300048916 | Ga0496113_0039793 | Ga0496113_0039793_1354_2877 | 501 |
| 535 | 3300005330 | Ga0070690_100005523 | Ga0070690_1000055236 | 502 |
| 536 | 3300005331 | Ga0070670_100019628 | Ga0070670_1000196281 | 502 |
| 537 | 3300005338 | Ga0068868_100010313 | Ga0068868_1000103136 | 502 |
| 538 | 3300009098 | Ga0105245_10001076 | Ga0105245_100010769 | 502 |
| 539 | 3300009174 | Ga0105241_10009050 | Ga0105241_100090506 | 502 |
| 540 | 3300009176 | Ga0105242_10033611 | Ga0105242_100336111 | 502 |
| 541 | 3300010375 | Ga0105239_10094252 | Ga0105239_100942522 | 502 |
| 542 | 3300011119 | Ga0105246_10003044 | Ga0105246_100030445 | 502 |
| 543 | 3300013100 | Ga0157373_10010375 | Ga0157373_100103755 | 502 |
| 544 | 3300013105 | Ga0157369_10035628 | Ga0157369_100356286 | 502 |
| 545 | 3300013308 | Ga0157375_10035489 | Ga0157375_100354892 | 502 |
| 546 | 3300014325 | Ga0163163_10009980 | Ga0163163_100099807 | 502 |
| 547 | 3300014326 | Ga0157380_10038101 | Ga0157380_100381014 | 502 |
| 548 | 3300014745 | Ga0157377_10002004 | Ga0157377_100020046 | 502 |
| 549 | 3300014968 | Ga0157379_10043938 | Ga0157379_100439384 | 502 |
| 550 | 3300028800 | Ga0265338_10066064 | Ga0265338_100660642 | 502 |
| 551 | 3300035116 | Ga0373945_0015129 | Ga0373945_0015129_626_2203 | 502 |
| 552 | 3300037068 | Ga0373925_0012318 | Ga0373925_0012318_482_2059 | 502 |
| 553 | 3300046472 | Ga0495580_0000655 | Ga0495580_0000655_5771_7348 | 502 |
| 554 | 3300046473 | Ga0495582_0002595 | Ga0495582_0002595_775_2352 | 502 |
| 555 | 3300048911 | Ga0496108_0000210 | Ga0496108_0000210_31779_33299 | 502 |
| 556 | 3300048912 | Ga0496109_0000228 | Ga0496109_0000228_11764_13284 | 502 |
| 557 | 3300048913 | Ga0496110_0009065 | Ga0496110_0009065_3415_4935 | 502 |
| 558 | 3300048915 | Ga0496112_0000048 | Ga0496112_0000048_11473_12993 | 502 |
| 559 | 3300048916 | Ga0496113_0001188 | Ga0496113_0001188_1179_2699 | 502 |
| 560 | 3300048918 | Ga0496115_0135945 | Ga0496115_0135945_96_1616 | 502 |
| 561 | 3300005435 | Ga0070714_100000060 | Ga0070714_10000006036 | 503 |
| 562 | 3300005439 | Ga0070711_100037247 | Ga0070711_1000372472 | 503 |
| 563 | 3300025916 | Ga0207663_10028454 | Ga0207663_100284542 | 503 |
| 564 | 3300025929 | Ga0207664_10000017 | Ga0207664_10000017152 | 503 |
| 565 | 3300035111 | Ga0373923_0012610 | Ga0373923_0012610_1235_2749 | 503 |
| 566 | 3300035170 | Ga0373943_0002013 | Ga0373943_0002013_5239_6753 | 503 |
| 567 | 3300035695 | Ga0373927_0000085 | Ga0373927_0000085_52894_54408 | 503 |
| 568 | 3300035725 | Ga0373947_0000284 | Ga0373947_0000284_10173_11687 | 503 |
| 569 | 3300037068 | Ga0373925_0001042 | Ga0373925_0001042_9102_10616 | 503 |
| 570 | 3300046477 | Ga0495664_0015658 | Ga0495664_0015658_1409_2923 | 503 |
| 571 | 3300028800 | Ga0265338_10003121 | Ga0265338_1000312112 | 504 |
| 572 | 3300031249 | Ga0265339_10013890 | Ga0265339_100138903 | 504 |
| 573 | 3300046472 | Ga0495580_0006848 | Ga0495580_0006848_46_1581 | 508 |
| 574 | 2162886011 | MRS1b_contig_977209 | MRS1b_0457.00001700 | 511 |
| 575 | 3300005290 | Ga0065712_10003223 | Ga0065712_100032233 | 511 |
| 576 | 3300005329 | Ga0070683_100038298 | Ga0070683_1000382981 | 511 |
| 577 | 3300005334 | Ga0068869_100046464 | Ga0068869_1000464642 | 511 |
| 578 | 3300005335 | Ga0070666_10100226 | Ga0070666_101002261 | 511 |
| 579 | 3300005336 | Ga0070680_100064084 | Ga0070680_1000640842 | 511 |
| 580 | 3300005338 | Ga0068868_100014148 | Ga0068868_1000141482 | 511 |
| 581 | 3300005339 | Ga0070660_100020538 | Ga0070660_1000205382 | 511 |
| 582 | 3300005341 | Ga0070691_10021963 | Ga0070691_100219632 | 511 |
| 583 | 3300005344 | Ga0070661_100012262 | Ga0070661_1000122622 | 511 |
| 584 | 3300005347 | Ga0070668_100002481 | Ga0070668_1000024816 | 511 |
| 585 | 3300005353 | Ga0070669_100015431 | Ga0070669_1000154312 | 511 |
| 586 | 3300005367 | Ga0070667_100183630 | Ga0070667_1001836301 | 511 |
| 587 | 3300005455 | Ga0070663_100007746 | Ga0070663_1000077464 | 511 |
| 588 | 3300005456 | Ga0070678_100117958 | Ga0070678_1001179582 | 511 |
| 589 | 3300005457 | Ga0070662_100002730 | Ga0070662_1000027304 | 511 |
| 590 | 3300005458 | Ga0070681_10033363 | Ga0070681_100333632 | 511 |
| 591 | 3300005459 | Ga0068867_100007277 | Ga0068867_1000072772 | 511 |
| 592 | 3300005535 | Ga0070684_100023840 | Ga0070684_1000238405 | 511 |
| 593 | 3300005548 | Ga0070665_100014614 | Ga0070665_1000146148 | 511 |
| 594 | 3300005577 | Ga0068857_100027726 | Ga0068857_1000277264 | 511 |
| 595 | 3300005578 | Ga0068854_100003053 | Ga0068854_1000030538 | 511 |
| 596 | 3300005614 | Ga0068856_100002947 | Ga0068856_10000294715 | 511 |
| 597 | 3300005618 | Ga0068864_100267077 | Ga0068864_1002670771 | 511 |
| 598 | 3300005718 | Ga0068866_10006041 | Ga0068866_100060415 | 511 |
| 599 | 3300005719 | Ga0068861_100042411 | Ga0068861_1000424114 | 511 |
| 600 | 3300005834 | Ga0068851_10014100 | Ga0068851_100141002 | 511 |
| 601 | 3300005842 | Ga0068858_100012821 | Ga0068858_1000128212 | 511 |
| 602 | 3300005844 | Ga0068862_100040754 | Ga0068862_1000407544 | 511 |
| 603 | 3300006358 | Ga0068871_100004701 | Ga0068871_1000047016 | 511 |
| 604 | 3300009148 | Ga0105243_10011240 | Ga0105243_100112404 | 511 |
| 605 | 3300009176 | Ga0105242_10004716 | Ga0105242_100047164 | 511 |
| 606 | 3300009177 | Ga0105248_10068134 | Ga0105248_100681342 | 511 |
| 607 | 3300009553 | Ga0105249_10001008 | Ga0105249_1000100813 | 511 |
| 608 | 3300013102 | Ga0157371_10005422 | Ga0157371_100054225 | 511 |
| 609 | 3300013296 | Ga0157374_10027055 | Ga0157374_100270553 | 511 |
| 610 | 3300013306 | Ga0163162_10019175 | Ga0163162_100191752 | 511 |
| 611 | 3300013307 | Ga0157372_10017181 | Ga0157372_100171813 | 511 |
| 612 | 3300014968 | Ga0157379_10013641 | Ga0157379_100136415 | 511 |
| 613 | 3300025913 | Ga0207695_10047737 | Ga0207695_100477372 | 511 |
| 614 | 3300025919 | Ga0207657_10001912 | Ga0207657_100019125 | 511 |
| 615 | 3300025920 | Ga0207649_10007580 | Ga0207649_100075802 | 511 |
| 616 | 3300025927 | Ga0207687_10011730 | Ga0207687_100117302 | 511 |
| 617 | 3300025933 | Ga0207706_10000296 | Ga0207706_1000029615 | 511 |
| 618 | 3300025942 | Ga0207689_10042690 | Ga0207689_100426902 | 511 |
| 619 | 3300025949 | Ga0207667_10003425 | Ga0207667_1000342515 | 511 |
| 620 | 3300025972 | Ga0207668_10073726 | Ga0207668_100737262 | 511 |
| 621 | 3300025981 | Ga0207640_10005736 | Ga0207640_100057365 | 511 |
| 622 | 3300026023 | Ga0207677_10086007 | Ga0207677_100860072 | 511 |
| 623 | 3300026035 | Ga0207703_10089252 | Ga0207703_100892522 | 511 |
| 624 | 3300026067 | Ga0207678_10000476 | Ga0207678_100004766 | 511 |
| 625 | 3300026078 | Ga0207702_10034300 | Ga0207702_100343001 | 511 |
| 626 | 3300026089 | Ga0207648_10001734 | Ga0207648_1000173413 | 511 |
| 627 | 3300026116 | Ga0207674_10030309 | Ga0207674_100303095 | 511 |
| 628 | 3300026118 | Ga0207675_100061753 | Ga0207675_1000617534 | 511 |
| 629 | 3300026121 | Ga0207683_10092583 | Ga0207683_100925832 | 511 |
| 630 | 3300028380 | Ga0268265_10060216 | Ga0268265_100602162 | 511 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3on3-assembly2.cif.gz_A | the crystal structure of keto/oxoacid ferredoxin oxidoreductase, gamma subunit from geobacter sulfurreducens pca | 0.901 | 322 | 496 |
| 3on3-assembly3.cif.gz_B | the crystal structure of keto/oxoacid ferredoxin oxidoreductase, gamma subunit from geobacter sulfurreducens pca | 0.8966 | 321 | 496 |
| 3g2e-assembly1.cif.gz_D | structure of putative oorc subunit of 2-oxoglutarate:acceptor oxidoreductase from campylobacter jejuni | 0.8907 | 321 | 495 |
| 6n2o-assembly1.cif.gz_C | 2-oxoglutarate:ferredoxin oxidoreductase from magnetococcus marinus with 2-oxoglutarate, coenzyme a and succinyl-coa bound | 0.8903 | 319 | 496 |
| 3on3-assembly2.cif.gz_A | the crystal structure of keto/oxoacid ferredoxin oxidoreductase, gamma subunit from geobacter sulfurreducens pca | 0.8859 | 322 | 496 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3on3A00 | Alpha Beta;3-Layer(aba) Sandwich;Pyruvate-ferredoxin Oxidoreductase; domain 3;Pyruvate-ferredoxin oxidoreductase, PFOR, domain III | 0.8958 | 322 | 496 | 3.40.920.10 |
| af_Q57957_74_243_3.40.50.970 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains | 0.8937 | 113 | 268 | 3.40.50.970 |
| 3on3A00 | Alpha Beta;3-Layer(aba) Sandwich;Pyruvate-ferredoxin Oxidoreductase; domain 3;Pyruvate-ferredoxin oxidoreductase, PFOR, domain III | 0.8806 | 322 | 496 | 3.40.920.10 |
| 3g2eC00 | Alpha Beta;3-Layer(aba) Sandwich;Pyruvate-ferredoxin Oxidoreductase; domain 3;Pyruvate-ferredoxin oxidoreductase, PFOR, domain III | 0.879 | 321 | 495 | 3.40.920.10 |
| af_Q2FZ05_1_182_3.40.920.10 | Alpha Beta;3-Layer(aba) Sandwich;Pyruvate-ferredoxin Oxidoreductase; domain 3;Pyruvate-ferredoxin oxidoreductase, PFOR, domain III | 0.8782 | 319 | 497 | 3.40.920.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3N5KBG3-F1-model_v4 | 2-oxoglutarate oxidoreductase | 0.9666 | 34 | 281 |
GO:0016625
GO:0030976 GO:0044281 GO:0046872 GO:0051536 |
| AF-A0A380RD73-F1-model_v4 | 2-oxoglutarate ferredoxin oxidoreductase subunit beta | 0.9653 | 32 | 280 |
GO:0016625
GO:0030976 |
| AF-A0A354YV83-F1-model_v4 | 2-oxoglutarate oxidoreductase | 0.9646 | 31 | 284 |
GO:0016625
GO:0030976 |
| AF-A0A1F3B1I6-F1-model_v4 | 2-oxoglutarate oxidoreductase | 0.9645 | 114 | 282 |
GO:0016625
GO:0030976 |
| AF-X1J9Y8-F1-model_v4 | Thiamine pyrophosphate enzyme TPP-binding domain-containing protein | 0.9635 | 92 | 282 |
GO:0016625
GO:0030976 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar