F470851

General Info

Members Datasets Scaffolds Average Seq Length
630 222 630 339

Family's Representative Sequence

Representative Sequence 3300032004|Ga0307414_10069185|Ga0307414_100691853
Length 349
Sequence MSAFDRLAVKPGLAPMEAKLVDALPEGPGWQYEPKWDGFRCLVFRDGGDVDLRSKSGKPLGRYFPEVAAAIGALKAKRLVLDGELIIPVGGVLSFEALQMRLHPAESRVRKLAAETPAQLMLFDWLLSTSGKSLLEKPLSERRDALERFHAGENADSLRLSPCTRDRETARVWLDRAGAALDGVVAKRRDEAYAPGERAMLKVKQQRTADCVVGGYRYAAKGRQVVGSLLLGLYNAQGKLDHVGFTSAIPDDDKAALTQRLEALAGPPGFTGKAPGGPSRWSNDRSGDWQPLRPELVVEVRYDHVTGDRFRHGTGFLRWRPDKAPEQCRMDQLTPEARPAELEAAMDGR

Samples

Sample ID Description Type Environment
1 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
20 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
43 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
49 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
50 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
53 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
54 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
55 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
56 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
57 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
58 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
59 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
60 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
62 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
63 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
64 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
66 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
67 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
69 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
70 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
71 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
72 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
73 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
74 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
75 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
76 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
77 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
78 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
79 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
80 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
81 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
82 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
83 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
84 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
85 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
86 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
87 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
88 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
89 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
90 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
91 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
92 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
93 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
151 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
152 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
153 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
154 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
155 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
156 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
157 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
158 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
159 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
160 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
161 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
162 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
163 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
164 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
165 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
166 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
167 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
168 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
169 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
170 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
171 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
172 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
173 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
174 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
175 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
176 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
177 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
178 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
179 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
180 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
181 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
182 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
183 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
184 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
185 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
186 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
187 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
188 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
189 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
190 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
191 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
192 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
193 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
194 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
195 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
196 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
197 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
198 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
199 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
200 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
201 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
202 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
203 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
204 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
205 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
206 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
207 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
208 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
209 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
210 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
211 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
212 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
213 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
214 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
215 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
216 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
217 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
218 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
219 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
220 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
221 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
222 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.52
Metatranscriptomes 0.48
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.32
Nodule 0
Rhizoplane 5.87
Rhizosphere 93.49
Stem 0
Stem Tuber 0
Unclassified 0.32

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24741J21665_1008871 3300001915 Bacteria 1874
2 JGI24740J21852_10001441 3300001979 Bacteria 10908
3 JGI24740J21852_10003168 3300001979 Bacteria 7261
4 JGI24740J21852_10007705 3300001979 Bacteria 4355
5 JGI24740J21852_10023162 3300001979 Bacteria 2125
6 JGI24739J22299_10017852 3300001989 Bacteria 2557
7 JGI24737J22298_10000598 3300001990 Bacteria 12680
8 JGI24735J21928_10017359 3300002067 Bacteria 2227
9 JGI24738J21930_10000859 3300002075 Bacteria 8719
10 JGI24738J21930_10008928 3300002075 Bacteria 2271
11 Ga0070658_10065371 3300005327 Bacteria 2968
12 Ga0070658_10097078 3300005327 Bacteria 2433
13 Ga0070658_10132960 3300005327 Bacteria 2074
14 Ga0070658_10133665 3300005327 Bacteria 2068
15 Ga0070658_10163959 3300005327 Bacteria 1865
16 Ga0070658_10196848 3300005327 Bacteria 1699
17 Ga0070658_10297014 3300005327 Bacteria 1377
18 Ga0070676_10006115 3300005328 Bacteria 6428
19 Ga0070676_10016934 3300005328 Bacteria 4030
20 Ga0070676_10046153 3300005328 Bacteria 2540
21 Ga0070676_10149558 3300005328 Bacteria 1494
22 Ga0070676_10229271 3300005328 Bacteria 1230
23 Ga0070683_100006593 3300005329 Bacteria 9751
24 Ga0070683_100037350 3300005329 Bacteria 4446
25 Ga0070683_100217928 3300005329 Bacteria 1814
26 Ga0070690_100007695 3300005330 Bacteria 6177
27 Ga0070690_100012729 3300005330 Bacteria 4954
28 Ga0070670_100039761 3300005331 Bacteria 4044
29 Ga0070670_100071915 3300005331 Bacteria 2970
30 Ga0068869_100001036 3300005334 Bacteria 16179
31 Ga0068869_100018329 3300005334 Bacteria 4763
32 Ga0068869_100065208 3300005334 Bacteria 2680
33 Ga0070666_10048340 3300005335 Bacteria 2858
34 Ga0070680_100005354 3300005336 Bacteria 9708
35 Ga0070680_100008123 3300005336 Bacteria 8015
36 Ga0070680_100033815 3300005336 Bacteria 4122
37 Ga0070680_100038536 3300005336 Bacteria 3865
38 Ga0070680_100211211 3300005336 Bacteria 1637
39 Ga0070682_100024162 3300005337 Bacteria 3614
40 Ga0068868_100000042 3300005338 Bacteria 68731
41 Ga0068868_100000156 3300005338 Bacteria 44526
42 Ga0068868_100013844 3300005338 Bacteria 5929
43 Ga0068868_100153124 3300005338 Bacteria 1900
44 Ga0070660_100000546 3300005339 Bacteria 25255
45 Ga0070660_100027758 3300005339 Bacteria 4228
46 Ga0070660_100043482 3300005339 Bacteria 3433
47 Ga0070660_100047179 3300005339 Bacteria 3304
48 Ga0070660_100184415 3300005339 Bacteria 1689
49 Ga0070660_100236365 3300005339 Bacteria 1487
50 Ga0070689_100017804 3300005340 Bacteria 5223
51 Ga0070691_10006514 3300005341 Bacteria 5340
52 Ga0070687_100001117 3300005343 Bacteria 9252
53 Ga0070661_100010302 3300005344 Bacteria 6498
54 Ga0070661_100035953 3300005344 Bacteria 3600
55 Ga0070661_100047447 3300005344 Bacteria 3143
56 Ga0070661_100056937 3300005344 Bacteria 2864
57 Ga0070661_100058421 3300005344 Bacteria 2826
58 Ga0070661_100084006 3300005344 Bacteria 2352
59 Ga0070661_100146677 3300005344 Bacteria 1782
60 Ga0070661_100202387 3300005344 Bacteria 1517
61 Ga0070661_100205878 3300005344 Bacteria 1505
62 Ga0070692_10058971 3300005345 Bacteria 2017
63 Ga0070668_100002631 3300005347 Bacteria 13189
64 Ga0070668_100006318 3300005347 Bacteria 8776
65 Ga0070668_100406775 3300005347 Bacteria 1163
66 Ga0070669_100000383 3300005353 Bacteria 33931
67 Ga0070669_100005434 3300005353 Bacteria 9191
68 Ga0070669_100101262 3300005353 Bacteria 2173
69 Ga0070675_100019689 3300005354 Bacteria 5380
70 Ga0070675_100020015 3300005354 Bacteria 5340
71 Ga0070675_100126534 3300005354 Bacteria 2174
72 Ga0070671_100005598 3300005355 Bacteria 10003
73 Ga0070671_100007731 3300005355 Bacteria 8586
74 Ga0070671_100045353 3300005355 Bacteria 3654
75 Ga0070671_100046678 3300005355 Bacteria 3602
76 Ga0070671_100175372 3300005355 Bacteria 1814
77 Ga0070674_100002665 3300005356 Bacteria 9891
78 Ga0070674_100053443 3300005356 Bacteria 2789
79 Ga0070674_100076181 3300005356 Bacteria 2384
80 Ga0070674_100083209 3300005356 Bacteria 2291
81 Ga0070673_100004316 3300005364 Bacteria 8981
82 Ga0070673_100026270 3300005364 Bacteria 4299
83 Ga0070673_100041339 3300005364 Bacteria 3545
84 Ga0070673_100045730 3300005364 Bacteria 3396
85 Ga0070673_100051631 3300005364 Bacteria 3222
86 Ga0070673_100287821 3300005364 Bacteria 1443
87 Ga0070673_100352879 3300005364 Bacteria 1306
88 Ga0070688_100012116 3300005365 Bacteria 4820
89 Ga0070659_100000011 3300005366 Bacteria 185903
90 Ga0070659_100001501 3300005366 Bacteria 16815
91 Ga0070659_100029545 3300005366 Bacteria 4237
92 Ga0070659_100053731 3300005366 Bacteria 3171
93 Ga0070659_100092102 3300005366 Bacteria 2430
94 Ga0070659_100097115 3300005366 Bacteria 2367
95 Ga0070659_100160361 3300005366 Bacteria 1838
96 Ga0070667_100001584 3300005367 Bacteria 20376
97 Ga0070667_100012687 3300005367 Bacteria 6966
98 Ga0070667_100041740 3300005367 Bacteria 3848
99 Ga0070667_100050007 3300005367 Bacteria 3521
100 Ga0070667_100108717 3300005367 Bacteria 2403
101 Ga0070714_100008702 3300005435 Bacteria 7935
102 Ga0070714_100092423 3300005435 Bacteria 2652
103 Ga0070663_100013495 3300005455 Bacteria 5213
104 Ga0070663_100081295 3300005455 Bacteria 2381
105 Ga0070663_100301449 3300005455 Bacteria 1283
106 Ga0070678_100022271 3300005456 Bacteria 4194
107 Ga0070678_100260748 3300005456 Bacteria 1458
108 Ga0070662_100002134 3300005457 Bacteria 12131
109 Ga0070662_100021023 3300005457 Bacteria 4451
110 Ga0070662_100026135 3300005457 Bacteria 4040
111 Ga0070662_100056092 3300005457 Bacteria 2860
112 Ga0070662_100060213 3300005457 Bacteria 2768
113 Ga0070662_100117553 3300005457 Bacteria 2034
114 Ga0070662_100251040 3300005457 Bacteria 1422
115 Ga0070681_10048504 3300005458 Bacteria 4243
116 Ga0070681_10057143 3300005458 Bacteria 3882
117 Ga0070681_10158480 3300005458 Bacteria 2187
118 Ga0068867_100000388 3300005459 Bacteria 29345
119 Ga0068867_100005540 3300005459 Bacteria 8940
120 Ga0068867_100009725 3300005459 Bacteria 6781
121 Ga0068867_100034181 3300005459 Bacteria 3684
122 Ga0070679_100005895 3300005530 Bacteria 11385
123 Ga0070679_100010802 3300005530 Bacteria 8672
124 Ga0070679_100172126 3300005530 Bacteria 2138
125 Ga0070679_100215316 3300005530 Bacteria 1883
126 Ga0070679_100229370 3300005530 Bacteria 1817
127 Ga0070679_100288909 3300005530 Bacteria 1591
128 Ga0070684_100005655 3300005535 Bacteria 9603
129 Ga0070684_100059342 3300005535 Bacteria 3345
130 Ga0070684_100117642 3300005535 Bacteria 2388
131 Ga0068853_100014239 3300005539 Bacteria 6509
132 Ga0068853_100025273 3300005539 Bacteria 4983
133 Ga0068853_100084028 3300005539 Bacteria 2789
134 Ga0068853_100167147 3300005539 Bacteria 1988
135 Ga0068853_100237927 3300005539 Bacteria 1668
136 Ga0070672_100008121 3300005543 Bacteria 7173
137 Ga0070672_100023111 3300005543 Bacteria 4578
138 Ga0070672_100064227 3300005543 Bacteria 2900
139 Ga0070672_100101715 3300005543 Bacteria 2331
140 Ga0070672_100144836 3300005543 Bacteria 1963
141 Ga0070686_100000034 3300005544 Bacteria 112341
142 Ga0070686_100076685 3300005544 Bacteria 2202
143 Ga0070693_100194529 3300005547 Bacteria 1314
144 Ga0070665_100001571 3300005548 Bacteria 26343
145 Ga0070665_100017906 3300005548 Bacteria 7114
146 Ga0070665_100069451 3300005548 Bacteria 3530
147 Ga0070665_100128935 3300005548 Bacteria 2532
148 Ga0070665_100211064 3300005548 Bacteria 1942
149 Ga0068855_100029810 3300005563 Bacteria 6524
150 Ga0068855_100071375 3300005563 Bacteria 4038
151 Ga0070664_100004853 3300005564 Bacteria 10771
152 Ga0070664_100041440 3300005564 Bacteria 3885
153 Ga0070664_100047218 3300005564 Bacteria 3637
154 Ga0070664_100054244 3300005564 Bacteria 3400
155 Ga0070664_100059187 3300005564 Bacteria 3259
156 Ga0068857_100000282 3300005577 Bacteria 34844
157 Ga0068857_100009874 3300005577 Bacteria 8288
158 Ga0068857_100035736 3300005577 Bacteria 4401
159 Ga0068857_100043250 3300005577 Bacteria 3996
160 Ga0068857_100061074 3300005577 Bacteria 3348
161 Ga0068854_100022246 3300005578 Bacteria 4315
162 Ga0068854_100023719 3300005578 Bacteria 4193
163 Ga0068854_100025824 3300005578 Bacteria 4031
164 Ga0068854_100056622 3300005578 Bacteria 2826
165 Ga0068854_100072701 3300005578 Bacteria 2518
166 Ga0068854_100197695 3300005578 Bacteria 1579
167 Ga0068856_100068244 3300005614 Bacteria 3514
168 Ga0068856_100069910 3300005614 Bacteria 3472
169 Ga0068856_100278972 3300005614 Bacteria 1688
170 Ga0068856_100304888 3300005614 Bacteria 1610
171 Ga0068852_100005199 3300005616 Bacteria 9281
172 Ga0068852_100009120 3300005616 Bacteria 7345
173 Ga0068852_100017311 3300005616 Bacteria 5651
174 Ga0068852_100028391 3300005616 Bacteria 4579
175 Ga0068852_100075039 3300005616 Bacteria 2981
176 Ga0068852_100148075 3300005616 Bacteria 2180
177 Ga0068859_100008573 3300005617 Bacteria 10338
178 Ga0068859_100025449 3300005617 Bacteria 5936
179 Ga0068859_100035482 3300005617 Bacteria 5003
180 Ga0068859_100069590 3300005617 Bacteria 3554
181 Ga0068859_100132974 3300005617 Bacteria 2560
182 Ga0068859_100148580 3300005617 Bacteria 2419
183 Ga0068864_100012719 3300005618 Bacteria 6956
184 Ga0068864_100035442 3300005618 Bacteria 4248
185 Ga0068864_100036405 3300005618 Bacteria 4195
186 Ga0068864_100413384 3300005618 Bacteria 1284
187 Ga0068866_10088821 3300005718 Bacteria 1678
188 Ga0068851_10018118 3300005834 Bacteria 3391
189 Ga0068851_10088321 3300005834 Bacteria 1629
190 Ga0068870_10003492 3300005840 Bacteria 6668
191 Ga0068863_100013758 3300005841 Bacteria 7798
192 Ga0068863_100018271 3300005841 Bacteria 6714
193 Ga0068863_100061595 3300005841 Bacteria 3548
194 Ga0068863_100159440 3300005841 Bacteria 2161
195 Ga0068863_100369533 3300005841 Bacteria 1399
196 Ga0068858_100001945 3300005842 Bacteria 21060
197 Ga0068858_100024899 3300005842 Bacteria 5571
198 Ga0068858_100051583 3300005842 Bacteria 3806
199 Ga0068860_100005032 3300005843 Bacteria 13450
200 Ga0068860_100296517 3300005843 Bacteria 1583
201 Ga0068862_100018429 3300005844 Bacteria 5814
202 Ga0068862_100022996 3300005844 Bacteria 5219
203 Ga0097621_100037055 3300006237 Bacteria 3904
204 Ga0097621_100116585 3300006237 Bacteria 2262
205 Ga0068871_100029598 3300006358 Bacteria 4302
206 Ga0068865_100018640 3300006881 Bacteria 4481
207 Ga0068865_100029640 3300006881 Bacteria 3633
208 Ga0075436_100011065 3300006914 Bacteria 6190
209 Ga0097620_100008573 3300006931 Bacteria 10338
210 Ga0097620_100025448 3300006931 Bacteria 5936
211 Ga0097620_100035484 3300006931 Bacteria 5003
212 Ga0097620_100069594 3300006931 Bacteria 3554
213 Ga0097620_100132983 3300006931 Bacteria 2560
214 Ga0097620_100148572 3300006931 Bacteria 2419
215 Ga0075435_100000282 3300007076 Bacteria 31568
216 Ga0105240_10106677 3300009093 Bacteria 3397
217 Ga0105240_10133111 3300009093 Bacteria 2980
218 Ga0105240_10133554 3300009093 Bacteria 2974
219 Ga0105240_10408301 3300009093 Bacteria 1528
220 Ga0105240_10471538 3300009093 Bacteria 1401
221 Ga0111539_10201634 3300009094 Bacteria 2320
222 Ga0105245_10001904 3300009098 Bacteria 18963
223 Ga0105245_10011149 3300009098 Bacteria 7823
224 Ga0105245_10015097 3300009098 Bacteria 6728
225 Ga0105243_10023774 3300009148 Bacteria 4670
226 Ga0105243_10132536 3300009148 Bacteria 2116
227 Ga0105241_10033052 3300009174 Bacteria 3881
228 Ga0105241_10349056 3300009174 Bacteria 1284
229 Ga0105248_10000516 3300009177 Bacteria 43895
230 Ga0105248_10002422 3300009177 Bacteria 20691
231 Ga0105248_10005728 3300009177 Bacteria 13638
232 Ga0105248_10036187 3300009177 Bacteria 5521
233 Ga0105248_10106208 3300009177 Bacteria 3166
234 Ga0105248_10597220 3300009177 Bacteria 1245
235 Ga0105237_10149138 3300009545 Bacteria 2334
236 Ga0105238_10027776 3300009551 Bacteria 5767
237 Ga0105238_10048759 3300009551 Bacteria 4267
238 Ga0105238_10109872 3300009551 Bacteria 2739
239 Ga0105249_10000023 3300009553 Bacteria 238850
240 Ga0105249_10288245 3300009553 Bacteria 1642
241 Ga0105239_10446630 3300010375 Bacteria 1467
242 Ga0105246_10040909 3300011119 Bacteria 3131
243 Ga0157373_10091624 3300013100 Bacteria 2141
244 Ga0157373_10138017 3300013100 Bacteria 1714
245 Ga0157373_10167396 3300013100 Bacteria 1547
246 Ga0157371_10004234 3300013102 Bacteria 12616
247 Ga0157371_10025298 3300013102 Bacteria 4327
248 Ga0157371_10052253 3300013102 Bacteria 2902
249 Ga0157371_10093015 3300013102 Bacteria 2136
250 Ga0157371_10096660 3300013102 Bacteria 2093
251 Ga0157371_10108842 3300013102 Bacteria 1967
252 Ga0157370_10024458 3300013104 Bacteria 5982
253 Ga0157370_10029768 3300013104 Bacteria 5355
254 Ga0157370_10061885 3300013104 Bacteria 3551
255 Ga0157369_10021589 3300013105 Bacteria 7200
256 Ga0157369_10031227 3300013105 Bacteria 5868
257 Ga0157369_10061051 3300013105 Bacteria 4064
258 Ga0157369_10062280 3300013105 Bacteria 4021
259 Ga0157369_10077930 3300013105 Bacteria 3551
260 Ga0157369_10118721 3300013105 Bacteria 2807
261 Ga0157369_10152062 3300013105 Bacteria 2446
262 Ga0157378_10001240 3300013297 Bacteria 23084
263 Ga0157378_10023065 3300013297 Bacteria 5478
264 Ga0163162_10030689 3300013306 Bacteria 5326
265 Ga0163162_10303765 3300013306 Bacteria 1728
266 Ga0157372_10015728 3300013307 Bacteria 8113
267 Ga0157372_10033902 3300013307 Bacteria 5611
268 Ga0157372_10114062 3300013307 Bacteria 3098
269 Ga0157372_10122157 3300013307 Bacteria 2993
270 Ga0157372_10206770 3300013307 Bacteria 2274
271 Ga0157375_10139169 3300013308 Bacteria 2553
272 Ga0157375_10399009 3300013308 Bacteria 1542
273 Ga0163163_10071409 3300014325 Bacteria 3459
274 Ga0182008_10003649 3300014497 Bacteria 9187
275 Ga0157379_10048494 3300014968 Bacteria 3791
276 Ga0157376_10075188 3300014969 Bacteria 2882
277 Ga0206356_11435106 3300020070 Bacteria 3648
278 Ga0206354_11234808 3300020081 Bacteria 1223
279 Ga0206353_10771636 3300020082 Bacteria 1847
280 Ga0207673_1000614 3300025290 Bacteria 3802
281 Ga0207697_10000727 3300025315 Bacteria 18712
282 Ga0207697_10022266 3300025315 Bacteria 2596
283 Ga0207656_10017363 3300025321 Bacteria 2818
284 Ga0207682_10014169 3300025893 Bacteria 3107
285 Ga0207642_10017913 3300025899 Bacteria 2706
286 Ga0207688_10003780 3300025901 Bacteria 8253
287 Ga0207688_10034554 3300025901 Bacteria 2800
288 Ga0207680_10033712 3300025903 Bacteria 2924
289 Ga0207680_10061764 3300025903 Bacteria 2286
290 Ga0207680_10101181 3300025903 Bacteria 1852
291 Ga0207647_10005880 3300025904 Bacteria 8940
292 Ga0207647_10009181 3300025904 Bacteria 7035
293 Ga0207647_10023018 3300025904 Bacteria 4129
294 Ga0207647_10033022 3300025904 Bacteria 3318
295 Ga0207645_10003176 3300025907 Bacteria 12577
296 Ga0207645_10009510 3300025907 Bacteria 6719
297 Ga0207645_10011240 3300025907 Bacteria 6123
298 Ga0207645_10204708 3300025907 Bacteria 1299
299 Ga0207643_10015983 3300025908 Bacteria 4088
300 Ga0207705_10017020 3300025909 Bacteria 5207
301 Ga0207705_10026200 3300025909 Bacteria 4159
302 Ga0207705_10028989 3300025909 Bacteria 3947
303 Ga0207705_10037851 3300025909 Bacteria 3452
304 Ga0207705_10069596 3300025909 Bacteria 2549
305 Ga0207705_10082255 3300025909 Bacteria 2348
306 Ga0207705_10235943 3300025909 Bacteria 1392
307 Ga0207707_10023785 3300025912 Bacteria 5357
308 Ga0207707_10040945 3300025912 Bacteria 4045
309 Ga0207707_10057411 3300025912 Bacteria 3388
310 Ga0207695_10056378 3300025913 Bacteria 4089
311 Ga0207695_10070812 3300025913 Bacteria 3563
312 Ga0207695_10365225 3300025913 Bacteria 1330
313 Ga0207671_10079812 3300025914 Bacteria 2452
314 Ga0207660_10001743 3300025917 Bacteria 14578
315 Ga0207660_10004736 3300025917 Bacteria 8856
316 Ga0207660_10006043 3300025917 Bacteria 7859
317 Ga0207660_10012892 3300025917 Bacteria 5475
318 Ga0207660_10086588 3300025917 Bacteria 2313
319 Ga0207660_10099768 3300025917 Bacteria 2167
320 Ga0207662_10004511 3300025918 Bacteria 7335
321 Ga0207662_10216651 3300025918 Bacteria 1245
322 Ga0207657_10001394 3300025919 Bacteria 25772
323 Ga0207657_10004404 3300025919 Bacteria 14894
324 Ga0207657_10011537 3300025919 Bacteria 8771
325 Ga0207657_10011948 3300025919 Bacteria 8593
326 Ga0207657_10012981 3300025919 Bacteria 8189
327 Ga0207657_10015907 3300025919 Bacteria 7268
328 Ga0207657_10019078 3300025919 Bacteria 6525
329 Ga0207657_10019876 3300025919 Bacteria 6364
330 Ga0207657_10023714 3300025919 Bacteria 5706
331 Ga0207657_10038176 3300025919 Bacteria 4279
332 Ga0207657_10039209 3300025919 Bacteria 4212
333 Ga0207657_10042112 3300025919 Bacteria 4032
334 Ga0207657_10143192 3300025919 Bacteria 1952
335 Ga0207649_10015900 3300025920 Bacteria 4232
336 Ga0207649_10025413 3300025920 Bacteria 3452
337 Ga0207649_10044076 3300025920 Bacteria 2730
338 Ga0207649_10066421 3300025920 Bacteria 2286
339 Ga0207652_10010516 3300025921 Bacteria 7446
340 Ga0207652_10040482 3300025921 Bacteria 3958
341 Ga0207652_10183828 3300025921 Bacteria 1879
342 Ga0207652_10264398 3300025921 Bacteria 1552
343 Ga0207652_10499115 3300025921 Bacteria 1096
344 Ga0207681_10012914 3300025923 Bacteria 5164
345 Ga0207681_10017563 3300025923 Bacteria 4494
346 Ga0207681_10078038 3300025923 Bacteria 2330
347 Ga0207694_10189953 3300025924 Bacteria 1668
348 Ga0207650_10135642 3300025925 Bacteria 1930
349 Ga0207650_10145563 3300025925 Bacteria 1866
350 Ga0207659_10020099 3300025926 Bacteria 4407
351 Ga0207687_10003966 3300025927 Bacteria 9916
352 Ga0207687_10032988 3300025927 Bacteria 3510
353 Ga0207687_10128836 3300025927 Bacteria 1904
354 Ga0207687_10188842 3300025927 Bacteria 1602
355 Ga0207664_10034793 3300025929 Bacteria 3883
356 Ga0207644_10000153 3300025931 Bacteria 49585
357 Ga0207644_10004564 3300025931 Bacteria 9003
358 Ga0207644_10020800 3300025931 Bacteria 4463
359 Ga0207644_10023167 3300025931 Bacteria 4249
360 Ga0207644_10023234 3300025931 Bacteria 4244
361 Ga0207644_10072573 3300025931 Bacteria 2521
362 Ga0207690_10000005 3300025932 Bacteria 581199
363 Ga0207690_10013795 3300025932 Bacteria 4866
364 Ga0207690_10021169 3300025932 Bacteria 4028
365 Ga0207690_10037993 3300025932 Bacteria 3130
366 Ga0207690_10069543 3300025932 Bacteria 2422
367 Ga0207690_10118311 3300025932 Bacteria 1920
368 Ga0207690_10165112 3300025932 Bacteria 1654
369 Ga0207706_10002737 3300025933 Bacteria 17167
370 Ga0207706_10009999 3300025933 Bacteria 8694
371 Ga0207706_10010165 3300025933 Bacteria 8614
372 Ga0207706_10014148 3300025933 Bacteria 7233
373 Ga0207706_10027134 3300025933 Bacteria 5122
374 Ga0207706_10053170 3300025933 Bacteria 3575
375 Ga0207706_10139024 3300025933 Bacteria 2136
376 Ga0207706_10244373 3300025933 Bacteria 1569
377 Ga0207709_10196004 3300025935 Bacteria 1439
378 Ga0207670_10122572 3300025936 Bacteria 1892
379 Ga0207669_10053892 3300025937 Bacteria 2426
380 Ga0207669_10062607 3300025937 Bacteria 2292
381 Ga0207669_10085336 3300025937 Bacteria 2038
382 Ga0207704_10005375 3300025938 Bacteria 5904
383 Ga0207704_10008678 3300025938 Bacteria 4874
384 Ga0207691_10004092 3300025940 Bacteria 14155
385 Ga0207691_10010479 3300025940 Bacteria 8892
386 Ga0207691_10029187 3300025940 Bacteria 5160
387 Ga0207691_10060016 3300025940 Bacteria 3457
388 Ga0207691_10077274 3300025940 Bacteria 2999
389 Ga0207691_10098652 3300025940 Bacteria 2609
390 Ga0207711_10007169 3300025941 Bacteria 9346
391 Ga0207711_10008538 3300025941 Bacteria 8569
392 Ga0207711_10020375 3300025941 Bacteria 5528
393 Ga0207711_10020755 3300025941 Bacteria 5481
394 Ga0207711_10023811 3300025941 Bacteria 5126
395 Ga0207689_10000092 3300025942 Bacteria 73254
396 Ga0207689_10023438 3300025942 Bacteria 5181
397 Ga0207689_10027769 3300025942 Bacteria 4736
398 Ga0207661_10009424 3300025944 Bacteria 7003
399 Ga0207661_10202318 3300025944 Bacteria 1746
400 Ga0207661_10359845 3300025944 Bacteria 1314
401 Ga0207679_10002819 3300025945 Bacteria 10783
402 Ga0207679_10082288 3300025945 Bacteria 2464
403 Ga0207679_10423381 3300025945 Bacteria 1176
404 Ga0207667_10006268 3300025949 Bacteria 14436
405 Ga0207667_10025488 3300025949 Bacteria 6470
406 Ga0207667_10048537 3300025949 Bacteria 4488
407 Ga0207667_10082593 3300025949 Bacteria 3328
408 Ga0207667_10112286 3300025949 Bacteria 2810
409 Ga0207667_10198370 3300025949 Bacteria 2059
410 Ga0207667_10283539 3300025949 Bacteria 1693
411 Ga0207651_10002376 3300025960 Bacteria 8982
412 Ga0207651_10003515 3300025960 Bacteria 7701
413 Ga0207651_10012776 3300025960 Bacteria 4770
414 Ga0207651_10018449 3300025960 Bacteria 4153
415 Ga0207651_10062913 3300025960 Bacteria 2588
416 Ga0207712_10000071 3300025961 Bacteria 124606
417 Ga0207668_10000080 3300025972 Bacteria 72198
418 Ga0207668_10004761 3300025972 Bacteria 7988
419 Ga0207640_10002379 3300025981 Bacteria 10073
420 Ga0207640_10007257 3300025981 Bacteria 6114
421 Ga0207640_10015780 3300025981 Bacteria 4379
422 Ga0207640_10117183 3300025981 Bacteria 1900
423 Ga0207640_10149232 3300025981 Bacteria 1715
424 Ga0207658_10001711 3300025986 Bacteria 16642
425 Ga0207658_10006240 3300025986 Bacteria 8144
426 Ga0207658_10014044 3300025986 Bacteria 5481
427 Ga0207658_10032329 3300025986 Bacteria 3723
428 Ga0207658_10050772 3300025986 Bacteria 3053
429 Ga0207658_10078927 3300025986 Bacteria 2517
430 Ga0207677_10000029 3300026023 Bacteria 121521
431 Ga0207677_10000733 3300026023 Bacteria 19151
432 Ga0207677_10063023 3300026023 Bacteria 2575
433 Ga0207677_10122028 3300026023 Bacteria 1962
434 Ga0207703_10000515 3300026035 Bacteria 39972
435 Ga0207703_10017291 3300026035 Bacteria 5629
436 Ga0207703_10063513 3300026035 Bacteria 3028
437 Ga0207639_10017222 3300026041 Bacteria 5123
438 Ga0207639_10060980 3300026041 Bacteria 2911
439 Ga0207639_10063498 3300026041 Bacteria 2860
440 Ga0207639_10080287 3300026041 Bacteria 2580
441 Ga0207678_10004875 3300026067 Bacteria 12048
442 Ga0207678_10007245 3300026067 Bacteria 9837
443 Ga0207678_10059335 3300026067 Bacteria 3292
444 Ga0207678_10063839 3300026067 Bacteria 3165
445 Ga0207678_10094578 3300026067 Bacteria 2553
446 Ga0207678_10143803 3300026067 Bacteria 2036
447 Ga0207678_10188008 3300026067 Bacteria 1764
448 Ga0207678_10237001 3300026067 Bacteria 1562
449 Ga0207678_10307811 3300026067 Bacteria 1362
450 Ga0207702_10028488 3300026078 Bacteria 4643
451 Ga0207702_10087179 3300026078 Bacteria 2724
452 Ga0207702_10159413 3300026078 Bacteria 2060
453 Ga0207702_10242035 3300026078 Bacteria 1691
454 Ga0207702_10399481 3300026078 Bacteria 1325
455 Ga0207641_10010778 3300026088 Bacteria 7493
456 Ga0207641_10014516 3300026088 Bacteria 6456
457 Ga0207641_10047927 3300026088 Bacteria 3605
458 Ga0207641_10059137 3300026088 Bacteria 3263
459 Ga0207648_10002626 3300026089 Bacteria 19234
460 Ga0207648_10006757 3300026089 Bacteria 11374
461 Ga0207648_10018279 3300026089 Bacteria 6350
462 Ga0207648_10018472 3300026089 Bacteria 6311
463 Ga0207648_10029114 3300026089 Bacteria 4897
464 Ga0207676_10003682 3300026095 Bacteria 10834
465 Ga0207676_10005853 3300026095 Bacteria 8684
466 Ga0207676_10011738 3300026095 Bacteria 6263
467 Ga0207676_10129511 3300026095 Bacteria 2143
468 Ga0207674_10001784 3300026116 Bacteria 27499
469 Ga0207674_10002505 3300026116 Bacteria 23159
470 Ga0207674_10003685 3300026116 Bacteria 18697
471 Ga0207674_10018948 3300026116 Bacteria 7461
472 Ga0207674_10021860 3300026116 Bacteria 6883
473 Ga0207674_10034021 3300026116 Bacteria 5331
474 Ga0207674_10153166 3300026116 Bacteria 2262
475 Ga0207675_100160948 3300026118 Bacteria 2141
476 Ga0207683_10003191 3300026121 Bacteria 14300
477 Ga0207683_10050341 3300026121 Bacteria 3649
478 Ga0207683_10082985 3300026121 Bacteria 2848
479 Ga0207698_10005458 3300026142 Bacteria 7863
480 Ga0207698_10017741 3300026142 Bacteria 4837
481 Ga0207698_10022833 3300026142 Bacteria 4359
482 Ga0207698_10045685 3300026142 Bacteria 3301
483 Ga0207698_10177794 3300026142 Bacteria 1881
484 Ga0268266_10000433 3300028379 Bacteria 62887
485 Ga0268266_10005198 3300028379 Bacteria 12252
486 Ga0268266_10012721 3300028379 Bacteria 7272
487 Ga0268266_10063100 3300028379 Bacteria 3198
488 Ga0268266_10176012 3300028379 Bacteria 1945
489 Ga0268265_10002272 3300028380 Bacteria 14633
490 Ga0268264_10002562 3300028381 Bacteria 15931
491 Ga0268264_10003515 3300028381 Bacteria 13504
492 Ga0265332_10000775 3300031238 Bacteria 19591
493 Ga0265340_10003476 3300031247 Bacteria 8877
494 Ga0265339_10000776 3300031249 Bacteria 24705
495 Ga0307408_100043360 3300031548 Bacteria 3201
496 Ga0265314_10037206 3300031711 Bacteria 3529
497 Ga0265342_10000364 3300031712 Bacteria 50013
498 Ga0307413_10064011 3300031824 Bacteria 2283
499 Ga0307410_10011339 3300031852 Bacteria 5093
500 Ga0307406_10043320 3300031901 Bacteria 2814
501 Ga0307412_10091776 3300031911 Bacteria 2127
502 Ga0307409_100005874 3300031995 Bacteria 7128
503 Ga0307409_100024886 3300031995 Bacteria 4186
504 Ga0307416_100083426 3300032002 Bacteria 2711
505 Ga0307414_10069185 3300032004 Bacteria 2537
506 Ga0307414_10072168 3300032004 Bacteria 2493
507 Ga0307411_10021693 3300032005 Bacteria 3764
508 Ga0307415_100054113 3300032126 Bacteria 2738
509 Ga0373954_0008884 3300035118 Bacteria 4422
510 Ga0373955_0004137 3300035172 Bacteria 6402
511 Ga0373935_0005904 3300035692 Bacteria 7255
512 Ga0373933_0040092 3300035724 Bacteria 2757
513 Ga0373925_0010559 3300037068 Bacteria 6696
514 Ga0395899_0016904 3300037312 Bacteria 5561
515 Ga0395899_0017289 3300037312 Bacteria 5495
516 Ga0395899_0035672 3300037312 Bacteria 3732
517 Ga0395899_0049097 3300037312 Bacteria 3138
518 Ga0395899_0072741 3300037312 Bacteria 2515
519 Ga0395900_0012032 3300037418 Bacteria 8844
520 Ga0395900_0054909 3300037418 Bacteria 4101
521 Ga0395900_0065541 3300037418 Bacteria 3732
522 Ga0395900_0070302 3300037418 Bacteria 3599
523 Ga0395900_0089615 3300037418 Bacteria 3161
524 Ga0395900_0095674 3300037418 Bacteria 3051
525 Ga0395900_0166232 3300037418 Bacteria 2248
526 Ga0395900_0187842 3300037418 Bacteria 2097
527 Ga0395898_0022042 3300037466 Bacteria 6452
528 Ga0395898_0026382 3300037466 Bacteria 5846
529 Ga0395898_0036165 3300037466 Bacteria 4905
530 Ga0395905_0004302 3300037471 Bacteria 14848
531 Ga0395905_0018718 3300037471 Bacteria 6570
532 Ga0395905_0028923 3300037471 Bacteria 5224
533 Ga0395905_0037380 3300037471 Bacteria 4558
534 Ga0395905_0037569 3300037471 Bacteria 4545
535 Ga0395905_0053843 3300037471 Bacteria 3765
536 Ga0395905_0064154 3300037471 Bacteria 3436
537 Ga0395905_0066420 3300037471 Bacteria 3378
538 Ga0395905_0075397 3300037471 Bacteria 3161
539 Ga0395905_0093567 3300037471 Bacteria 2819
540 Ga0395905_0113870 3300037471 Bacteria 2541
541 Ga0395905_0169875 3300037471 Bacteria 2048
542 Ga0395905_0189345 3300037471 Bacteria 1930
543 Ga0395905_0251675 3300037471 Bacteria 1650
544 Ga0395905_0373658 3300037471 Bacteria 1319
545 Ga0395901_0015055 3300038443 Bacteria 7865
546 Ga0395901_0048641 3300038443 Bacteria 4404
547 Ga0395901_0070373 3300038443 Bacteria 3645
548 Ga0395901_0089415 3300038443 Bacteria 3223
549 Ga0395901_0184946 3300038443 Bacteria 2185
550 Ga0395901_0211793 3300038443 Bacteria 2028
551 Ga0395901_0395488 3300038443 Bacteria 1420
552 Ga0436365_1526629 3300039437 Bacteria 2994
553 Ga0436363_1232640 3300039450 Bacteria 11059
554 Ga0466961_0037195 3300044693 Bacteria 3123
555 Ga0466963_0018676 3300044694 Bacteria 4339
556 Ga0466963_0035719 3300044694 Bacteria 3239
557 Ga0466963_0106239 3300044694 Bacteria 1925
558 Ga0466963_0184899 3300044694 Bacteria 1455
559 Ga0466957_0016211 3300044842 Bacteria 4357
560 Ga0466957_0095653 3300044842 Bacteria 1866
561 Ga0466958_0199101 3300045836 Bacteria 1274
562 Ga0466967_0144153 3300045976 Bacteria 2221
563 Ga0466967_0253731 3300045976 Bacteria 1681
564 Ga0495663_0003309 3300046525 Bacteria 4668
565 Ga0495598_0003508 3300046537 Bacteria 3341
566 Ga0495621_0000094 3300046539 Bacteria 18073
567 Ga0495621_0043596 3300046539 Bacteria 1583
568 Ga0495668_0087038 3300046616 Bacteria 1713
569 Ga0495669_0000617 3300046684 Bacteria 15486
570 Ga0495669_0008270 3300046684 Bacteria 4369
571 Ga0495669_0008952 3300046684 Bacteria 4217
572 Ga0495669_0035828 3300046684 Bacteria 2192
573 Ga0495670_0004793 3300046691 Bacteria 6642
574 Ga0495677_0003141 3300047445 Bacteria 6439
575 Ga0495685_010289 3300047447 Bacteria 3135
576 Ga0495602_0024600 3300048088 Bacteria 5841
577 Ga0496100_0004507 3300048903 Bacteria 7392
578 Ga0496101_0000589 3300048904 Bacteria 22135
579 Ga0496101_0055076 3300048904 Bacteria 2872
580 Ga0496101_0123775 3300048904 Bacteria 1957
581 Ga0496103_0032088 3300048906 Bacteria 3204
582 Ga0496103_0050519 3300048906 Bacteria 2572
583 Ga0496104_0011224 3300048907 Bacteria 8018
584 Ga0496104_0360524 3300048907 Bacteria 1366
585 Ga0496105_0010283 3300048908 Bacteria 7355
586 Ga0496106_0007644 3300048909 Bacteria 7995
587 Ga0496106_0023948 3300048909 Bacteria 4537
588 Ga0496107_0000429 3300048910 Bacteria 22785
589 Ga0496107_0000990 3300048910 Bacteria 16900
590 Ga0496108_0005046 3300048911 Bacteria 10663
591 Ga0496108_0012375 3300048911 Bacteria 6943
592 Ga0496108_0036270 3300048911 Bacteria 4102
593 Ga0496109_0009634 3300048912 Bacteria 8240
594 Ga0496109_0038803 3300048912 Bacteria 4307
595 Ga0496109_0064365 3300048912 Bacteria 3355
596 Ga0496110_0011777 3300048913 Bacteria 7178
597 Ga0496110_0012497 3300048913 Bacteria 6983
598 Ga0496110_0036060 3300048913 Bacteria 4293
599 Ga0496110_0231641 3300048913 Bacteria 1680
600 Ga0496111_0000459 3300048914 Bacteria 20678
601 Ga0496111_0008661 3300048914 Bacteria 6747
602 Ga0496111_0298917 3300048914 Bacteria 1193
603 Ga0496112_0000707 3300048915 Bacteria 23147
604 Ga0496112_0002279 3300048915 Bacteria 15342
605 Ga0496112_0034103 3300048915 Bacteria 4952
606 Ga0496112_0084543 3300048915 Bacteria 3138
607 Ga0496112_0282443 3300048915 Bacteria 1607
608 Ga0496113_0000431 3300048916 Bacteria 20368
609 Ga0496113_0005916 3300048916 Bacteria 7684
610 Ga0496113_0073611 3300048916 Bacteria 2603
611 Ga0496114_0036791 3300048917 Bacteria 4047
612 Ga0496114_0060031 3300048917 Bacteria 3178
613 Ga0496115_0010000 3300048918 Bacteria 7068
614 Ga0501031_0028698 3300049568 Bacteria 3628
615 Ga0501038_0075687 3300049574 Bacteria 2845
616 Ga0501039_0056958 3300049575 Bacteria 3028
617 Ga0501042_0011580 3300049578 Bacteria 5956
618 Ga0501046_0093230 3300049580 Bacteria 2315
619 Ga0501072_0068526 3300049588 Bacteria 2801
620 Ga0501076_0068148 3300049592 Bacteria 2842
621 Ga0501079_0174090 3300049741 Bacteria 1678
622 Ga0501080_0414030 3300049742 Bacteria 1212
623 Ga0501045_0003734 3300049824 Bacteria 10473
624 nmdc:mga0n895_21729_c1 3300050512 Bacteria 6006
625 nmdc:mga08x19_19513_c1 3300050514 Bacteria 4161
626 nmdc:mga0a205_1020_c1 3300050515 Bacteria 23290
627 Ga0500643_000244 3300053087 Bacteria 49957
628 Ga0500658_0000152 3300053134 Bacteria 33101
629 Ga0501082_0054646 3300060353 Bacteria 3442
630 Ga0530510_0117834 3300061734 Bacteria 1948

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049741 Ga0501079_0174090 Ga0501079_0174090_11_961 291
2 3300026118 Ga0207675_100160948 Ga0207675_1001609482 294
3 3300035118 Ga0373954_0008884 Ga0373954_0008884_438_1361 302
4 3300037312 Ga0395899_0072741 Ga0395899_0072741_1119_2111 312
5 3300037471 Ga0395905_0028923 Ga0395905_0028923_4092_5084 312
6 3300005347 Ga0070668_100006318 Ga0070668_1000063185 315
7 3300031238 Ga0265332_10000775 Ga0265332_100007754 319
8 3300031247 Ga0265340_10003476 Ga0265340_100034763 319
9 3300031249 Ga0265339_10000776 Ga0265339_100007769 319
10 3300031711 Ga0265314_10037206 Ga0265314_100372062 319
11 3300031712 Ga0265342_10000364 Ga0265342_1000036421 319
12 3300009553 Ga0105249_10000023 Ga0105249_1000002375 320
13 3300013105 Ga0157369_10031227 Ga0157369_100312275 320
14 3300025961 Ga0207712_10000071 Ga0207712_1000007193 320
15 3300025972 Ga0207668_10004761 Ga0207668_100047616 320
16 3300028379 Ga0268266_10176012 Ga0268266_101760122 320
17 3300038443 Ga0395901_0070373 Ga0395901_0070373_2512_3504 320
18 3300005336 Ga0070680_100033815 Ga0070680_1000338152 323
19 3300025917 Ga0207660_10086588 Ga0207660_100865883 323
20 3300025919 Ga0207657_10011537 Ga0207657_100115376 323
21 3300025929 Ga0207664_10034793 Ga0207664_100347931 323
22 3300009098 Ga0105245_10011149 Ga0105245_100111495 324
23 3300025927 Ga0207687_10003966 Ga0207687_100039665 324
24 3300039437 Ga0436365_1526629 Ga0436365_1526629_791_1792 324
25 3300005364 Ga0070673_100287821 Ga0070673_1002878212 326
26 3300005543 Ga0070672_100023111 Ga0070672_1000231113 326
27 3300025923 Ga0207681_10078038 Ga0207681_100780382 326
28 3300035172 Ga0373955_0004137 Ga0373955_0004137_3854_4879 326
29 3300035724 Ga0373933_0040092 Ga0373933_0040092_673_1698 326
30 3300048088 Ga0495602_0024600 Ga0495602_0024600_1170_2195 326
31 3300005338 Ga0068868_100000042 Ga0068868_10000004238 327
32 3300005339 Ga0070660_100000546 Ga0070660_10000054628 327
33 3300005354 Ga0070675_100019689 Ga0070675_1000196894 327
34 3300005366 Ga0070659_100000011 Ga0070659_10000001160 327
35 3300025919 Ga0207657_10001394 Ga0207657_1000139412 327
36 3300025926 Ga0207659_10020099 Ga0207659_100200994 327
37 3300025927 Ga0207687_10032988 Ga0207687_100329883 327
38 3300025932 Ga0207690_10000005 Ga0207690_10000005148 327
39 3300026023 Ga0207677_10000029 Ga0207677_1000002939 327
40 3300039450 Ga0436363_1232640 Ga0436363_1232640_2912_4081 327
41 3300005336 Ga0070680_100038536 Ga0070680_1000385362 328
42 3300005340 Ga0070689_100017804 Ga0070689_1000178045 328
43 3300005343 Ga0070687_100001117 Ga0070687_1000011172 328
44 3300005344 Ga0070661_100084006 Ga0070661_1000840061 328
45 3300005353 Ga0070669_100005434 Ga0070669_1000054349 328
46 3300005354 Ga0070675_100126534 Ga0070675_1001265343 328
47 3300005365 Ga0070688_100012116 Ga0070688_1000121163 328
48 3300005435 Ga0070714_100008702 Ga0070714_1000087024 328
49 3300005455 Ga0070663_100301449 Ga0070663_1003014491 328
50 3300005458 Ga0070681_10048504 Ga0070681_100485044 328
51 3300005458 Ga0070681_10057143 Ga0070681_100571432 328
52 3300005530 Ga0070679_100005895 Ga0070679_1000058959 328
53 3300005530 Ga0070679_100010802 Ga0070679_1000108027 328
54 3300005535 Ga0070684_100059342 Ga0070684_1000593424 328
55 3300005539 Ga0068853_100025273 Ga0068853_1000252732 328
56 3300005614 Ga0068856_100304888 Ga0068856_1003048881 328
57 3300005617 Ga0068859_100008573 Ga0068859_1000085739 328
58 3300005840 Ga0068870_10003492 Ga0068870_100034927 328
59 3300006914 Ga0075436_100011065 Ga0075436_1000110652 328
60 3300006931 Ga0097620_100008573 Ga0097620_1000085739 328
61 3300007076 Ga0075435_100000282 Ga0075435_10000028230 328
62 3300009093 Ga0105240_10133554 Ga0105240_101335543 328
63 3300009094 Ga0111539_10201634 Ga0111539_102016343 328
64 3300009551 Ga0105238_10109872 Ga0105238_101098722 328
65 3300013105 Ga0157369_10152062 Ga0157369_101520622 328
66 3300013307 Ga0157372_10015728 Ga0157372_100157286 328
67 3300014497 Ga0182008_10003649 Ga0182008_100036497 328
68 3300025893 Ga0207682_10014169 Ga0207682_100141692 328
69 3300025908 Ga0207643_10015983 Ga0207643_100159833 328
70 3300025912 Ga0207707_10023785 Ga0207707_100237853 328
71 3300025913 Ga0207695_10365225 Ga0207695_103652252 328
72 3300025917 Ga0207660_10012892 Ga0207660_100128924 328
73 3300025918 Ga0207662_10004511 Ga0207662_100045116 328
74 3300025921 Ga0207652_10010516 Ga0207652_100105163 328
75 3300025924 Ga0207694_10189953 Ga0207694_101899532 328
76 3300025932 Ga0207690_10037993 Ga0207690_100379932 328
77 3300025936 Ga0207670_10122572 Ga0207670_101225722 328
78 3300025960 Ga0207651_10062913 Ga0207651_100629133 328
79 3300026067 Ga0207678_10188008 Ga0207678_101880082 328
80 3300026067 Ga0207678_10307811 Ga0207678_103078111 328
81 3300026078 Ga0207702_10399481 Ga0207702_103994812 328
82 3300047447 Ga0495685_010289 Ga0495685_010289_603_1637 328
83 3300049568 Ga0501031_0028698 Ga0501031_0028698_1876_2970 328
84 3300049574 Ga0501038_0075687 Ga0501038_0075687_688_1782 328
85 3300049575 Ga0501039_0056958 Ga0501039_0056958_518_1612 328
86 3300049578 Ga0501042_0011580 Ga0501042_0011580_3474_4568 328
87 3300049580 Ga0501046_0093230 Ga0501046_0093230_374_1468 328
88 3300049588 Ga0501072_0068526 Ga0501072_0068526_1256_2350 328
89 3300049592 Ga0501076_0068148 Ga0501076_0068148_1256_2350 328
90 3300049824 Ga0501045_0003734 Ga0501045_0003734_6475_7569 328
91 3300050512 nmdc:mga0n895_21729_c1 nmdc:mga0n895_21729_c1_3470_4513 328
92 3300050514 nmdc:mga08x19_19513_c1 nmdc:mga08x19_19513_c1_1886_2929 328
93 3300050515 nmdc:mga0a205_1020_c1 nmdc:mga0a205_1020_c1_10241_11284 328
94 3300060353 Ga0501082_0054646 Ga0501082_0054646_674_1768 328
95 3300061734 Ga0530510_0117834 Ga0530510_0117834_805_1899 328
96 3300005328 Ga0070676_10016934 Ga0070676_100169341 330
97 3300005543 Ga0070672_100101715 Ga0070672_1001017153 330
98 3300005614 Ga0068856_100069910 Ga0068856_1000699102 330
99 3300013104 Ga0157370_10024458 Ga0157370_100244583 330
100 3300013105 Ga0157369_10062280 Ga0157369_100622802 330
101 3300013308 Ga0157375_10399009 Ga0157375_103990092 330
102 3300025940 Ga0207691_10098652 Ga0207691_100986523 330
103 3300025986 Ga0207658_10078927 Ga0207658_100789271 330
104 3300026078 Ga0207702_10159413 Ga0207702_101594133 330
105 3300026116 Ga0207674_10153166 Ga0207674_101531661 330
106 3300037466 Ga0395898_0036165 Ga0395898_0036165_1637_2629 330
107 3300037471 Ga0395905_0037380 Ga0395905_0037380_3308_4300 330
108 3300038443 Ga0395901_0395488 Ga0395901_0395488_171_1163 330
109 3300048914 Ga0496111_0298917 Ga0496111_0298917_114_1106 330
110 3300001915 JGI24741J21665_1008871 JGI24741J21665_10088712 331
111 3300001979 JGI24740J21852_10001441 JGI24740J21852_100014418 331
112 3300001979 JGI24740J21852_10003168 JGI24740J21852_100031688 331
113 3300001979 JGI24740J21852_10007705 JGI24740J21852_100077055 331
114 3300001979 JGI24740J21852_10023162 JGI24740J21852_100231622 331
115 3300001989 JGI24739J22299_10017852 JGI24739J22299_100178523 331
116 3300001990 JGI24737J22298_10000598 JGI24737J22298_100005988 331
117 3300002067 JGI24735J21928_10017359 JGI24735J21928_100173592 331
118 3300002075 JGI24738J21930_10000859 JGI24738J21930_100008592 331
119 3300002075 JGI24738J21930_10008928 JGI24738J21930_100089281 331
120 3300005327 Ga0070658_10065371 Ga0070658_100653713 331
121 3300005327 Ga0070658_10097078 Ga0070658_100970782 331
122 3300005327 Ga0070658_10132960 Ga0070658_101329602 331
123 3300005327 Ga0070658_10133665 Ga0070658_101336652 331
124 3300005327 Ga0070658_10163959 Ga0070658_101639592 331
125 3300005327 Ga0070658_10196848 Ga0070658_101968482 331
126 3300005327 Ga0070658_10297014 Ga0070658_102970142 331
127 3300005328 Ga0070676_10006115 Ga0070676_100061153 331
128 3300005328 Ga0070676_10046153 Ga0070676_100461531 331
129 3300005328 Ga0070676_10149558 Ga0070676_101495582 331
130 3300005328 Ga0070676_10229271 Ga0070676_102292711 331
131 3300005329 Ga0070683_100006593 Ga0070683_1000065939 331
132 3300005329 Ga0070683_100037350 Ga0070683_1000373502 331
133 3300005329 Ga0070683_100217928 Ga0070683_1002179282 331
134 3300005330 Ga0070690_100007695 Ga0070690_1000076958 331
135 3300005330 Ga0070690_100012729 Ga0070690_1000127293 331
136 3300005331 Ga0070670_100039761 Ga0070670_1000397614 331
137 3300005331 Ga0070670_100071915 Ga0070670_1000719152 331
138 3300005334 Ga0068869_100001036 Ga0068869_1000010366 331
139 3300005334 Ga0068869_100018329 Ga0068869_1000183293 331
140 3300005334 Ga0068869_100065208 Ga0068869_1000652082 331
141 3300005335 Ga0070666_10048340 Ga0070666_100483402 331
142 3300005336 Ga0070680_100005354 Ga0070680_1000053545 331
143 3300005336 Ga0070680_100008123 Ga0070680_1000081239 331
144 3300005336 Ga0070680_100211211 Ga0070680_1002112112 331
145 3300005337 Ga0070682_100024162 Ga0070682_1000241622 331
146 3300005338 Ga0068868_100000156 Ga0068868_1000001564 331
147 3300005338 Ga0068868_100013844 Ga0068868_1000138447 331
148 3300005338 Ga0068868_100153124 Ga0068868_1001531242 331
149 3300005339 Ga0070660_100027758 Ga0070660_1000277582 331
150 3300005339 Ga0070660_100043482 Ga0070660_1000434823 331
151 3300005339 Ga0070660_100047179 Ga0070660_1000471794 331
152 3300005339 Ga0070660_100184415 Ga0070660_1001844152 331
153 3300005339 Ga0070660_100236365 Ga0070660_1002363651 331
154 3300005341 Ga0070691_10006514 Ga0070691_100065145 331
155 3300005344 Ga0070661_100010302 Ga0070661_1000103026 331
156 3300005344 Ga0070661_100035953 Ga0070661_1000359533 331
157 3300005344 Ga0070661_100047447 Ga0070661_1000474473 331
158 3300005344 Ga0070661_100056937 Ga0070661_1000569373 331
159 3300005344 Ga0070661_100058421 Ga0070661_1000584212 331
160 3300005344 Ga0070661_100146677 Ga0070661_1001466772 331
161 3300005344 Ga0070661_100202387 Ga0070661_1002023872 331
162 3300005344 Ga0070661_100205878 Ga0070661_1002058781 331
163 3300005345 Ga0070692_10058971 Ga0070692_100589713 331
164 3300005347 Ga0070668_100002631 Ga0070668_10000263110 331
165 3300005347 Ga0070668_100406775 Ga0070668_1004067751 331
166 3300005353 Ga0070669_100000383 Ga0070669_1000003837 331
167 3300005353 Ga0070669_100101262 Ga0070669_1001012622 331
168 3300005354 Ga0070675_100020015 Ga0070675_1000200152 331
169 3300005355 Ga0070671_100005598 Ga0070671_1000055983 331
170 3300005355 Ga0070671_100007731 Ga0070671_1000077319 331
171 3300005355 Ga0070671_100045353 Ga0070671_1000453533 331
172 3300005355 Ga0070671_100046678 Ga0070671_1000466784 331
173 3300005355 Ga0070671_100175372 Ga0070671_1001753722 331
174 3300005356 Ga0070674_100002665 Ga0070674_10000266510 331
175 3300005356 Ga0070674_100053443 Ga0070674_1000534434 331
176 3300005356 Ga0070674_100076181 Ga0070674_1000761812 331
177 3300005356 Ga0070674_100083209 Ga0070674_1000832093 331
178 3300005364 Ga0070673_100004316 Ga0070673_1000043166 331
179 3300005364 Ga0070673_100026270 Ga0070673_1000262703 331
180 3300005364 Ga0070673_100041339 Ga0070673_1000413392 331
181 3300005364 Ga0070673_100045730 Ga0070673_1000457303 331
182 3300005364 Ga0070673_100051631 Ga0070673_1000516311 331
183 3300005364 Ga0070673_100352879 Ga0070673_1003528791 331
184 3300005366 Ga0070659_100001501 Ga0070659_1000015014 331
185 3300005366 Ga0070659_100029545 Ga0070659_1000295455 331
186 3300005366 Ga0070659_100053731 Ga0070659_1000537312 331
187 3300005366 Ga0070659_100092102 Ga0070659_1000921024 331
188 3300005366 Ga0070659_100097115 Ga0070659_1000971152 331
189 3300005366 Ga0070659_100160361 Ga0070659_1001603612 331
190 3300005367 Ga0070667_100001584 Ga0070667_10000158420 331
191 3300005367 Ga0070667_100012687 Ga0070667_1000126873 331
192 3300005367 Ga0070667_100041740 Ga0070667_1000417404 331
193 3300005367 Ga0070667_100050007 Ga0070667_1000500073 331
194 3300005367 Ga0070667_100108717 Ga0070667_1001087172 331
195 3300005435 Ga0070714_100092423 Ga0070714_1000924234 331
196 3300005455 Ga0070663_100013495 Ga0070663_1000134956 331
197 3300005455 Ga0070663_100081295 Ga0070663_1000812952 331
198 3300005456 Ga0070678_100022271 Ga0070678_1000222714 331
199 3300005456 Ga0070678_100260748 Ga0070678_1002607482 331
200 3300005457 Ga0070662_100002134 Ga0070662_1000021343 331
201 3300005457 Ga0070662_100021023 Ga0070662_1000210234 331
202 3300005457 Ga0070662_100026135 Ga0070662_1000261354 331
203 3300005457 Ga0070662_100056092 Ga0070662_1000560922 331
204 3300005457 Ga0070662_100060213 Ga0070662_1000602133 331
205 3300005457 Ga0070662_100117553 Ga0070662_1001175533 331
206 3300005457 Ga0070662_100251040 Ga0070662_1002510402 331
207 3300005458 Ga0070681_10158480 Ga0070681_101584802 331
208 3300005459 Ga0068867_100000388 Ga0068867_10000038824 331
209 3300005459 Ga0068867_100005540 Ga0068867_1000055403 331
210 3300005459 Ga0068867_100009725 Ga0068867_1000097252 331
211 3300005459 Ga0068867_100034181 Ga0068867_1000341814 331
212 3300005530 Ga0070679_100172126 Ga0070679_1001721262 331
213 3300005530 Ga0070679_100215316 Ga0070679_1002153163 331
214 3300005530 Ga0070679_100229370 Ga0070679_1002293702 331
215 3300005530 Ga0070679_100288909 Ga0070679_1002889092 331
216 3300005535 Ga0070684_100005655 Ga0070684_1000056553 331
217 3300005535 Ga0070684_100117642 Ga0070684_1001176422 331
218 3300005539 Ga0068853_100014239 Ga0068853_1000142397 331
219 3300005539 Ga0068853_100084028 Ga0068853_1000840283 331
220 3300005539 Ga0068853_100167147 Ga0068853_1001671472 331
221 3300005539 Ga0068853_100237927 Ga0068853_1002379272 331
222 3300005543 Ga0070672_100008121 Ga0070672_1000081216 331
223 3300005543 Ga0070672_100064227 Ga0070672_1000642273 331
224 3300005543 Ga0070672_100144836 Ga0070672_1001448361 331
225 3300005544 Ga0070686_100000034 Ga0070686_10000003465 331
226 3300005544 Ga0070686_100076685 Ga0070686_1000766852 331
227 3300005547 Ga0070693_100194529 Ga0070693_1001945291 331
228 3300005548 Ga0070665_100001571 Ga0070665_10000157119 331
229 3300005548 Ga0070665_100017906 Ga0070665_1000179066 331
230 3300005548 Ga0070665_100069451 Ga0070665_1000694514 331
231 3300005548 Ga0070665_100128935 Ga0070665_1001289353 331
232 3300005548 Ga0070665_100211064 Ga0070665_1002110641 331
233 3300005563 Ga0068855_100029810 Ga0068855_1000298103 331
234 3300005563 Ga0068855_100071375 Ga0068855_1000713752 331
235 3300005564 Ga0070664_100004853 Ga0070664_1000048536 331
236 3300005564 Ga0070664_100041440 Ga0070664_1000414403 331
237 3300005564 Ga0070664_100047218 Ga0070664_1000472182 331
238 3300005564 Ga0070664_100054244 Ga0070664_1000542444 331
239 3300005564 Ga0070664_100059187 Ga0070664_1000591874 331
240 3300005577 Ga0068857_100000282 Ga0068857_1000002826 331
241 3300005577 Ga0068857_100009874 Ga0068857_1000098746 331
242 3300005577 Ga0068857_100035736 Ga0068857_1000357364 331
243 3300005577 Ga0068857_100043250 Ga0068857_1000432502 331
244 3300005577 Ga0068857_100061074 Ga0068857_1000610744 331
245 3300005578 Ga0068854_100022246 Ga0068854_1000222464 331
246 3300005578 Ga0068854_100023719 Ga0068854_1000237192 331
247 3300005578 Ga0068854_100025824 Ga0068854_1000258242 331
248 3300005578 Ga0068854_100056622 Ga0068854_1000566221 331
249 3300005578 Ga0068854_100072701 Ga0068854_1000727013 331
250 3300005578 Ga0068854_100197695 Ga0068854_1001976952 331
251 3300005614 Ga0068856_100068244 Ga0068856_1000682444 331
252 3300005614 Ga0068856_100278972 Ga0068856_1002789721 331
253 3300005616 Ga0068852_100005199 Ga0068852_1000051994 331
254 3300005616 Ga0068852_100009120 Ga0068852_1000091204 331
255 3300005616 Ga0068852_100017311 Ga0068852_1000173117 331
256 3300005616 Ga0068852_100028391 Ga0068852_1000283914 331
257 3300005616 Ga0068852_100075039 Ga0068852_1000750392 331
258 3300005616 Ga0068852_100148075 Ga0068852_1001480752 331
259 3300005617 Ga0068859_100025449 Ga0068859_1000254492 331
260 3300005617 Ga0068859_100035482 Ga0068859_1000354824 331
261 3300005617 Ga0068859_100069590 Ga0068859_1000695904 331
262 3300005617 Ga0068859_100132974 Ga0068859_1001329743 331
263 3300005617 Ga0068859_100148580 Ga0068859_1001485802 331
264 3300005618 Ga0068864_100012719 Ga0068864_1000127195 331
265 3300005618 Ga0068864_100035442 Ga0068864_1000354424 331
266 3300005618 Ga0068864_100036405 Ga0068864_1000364054 331
267 3300005618 Ga0068864_100413384 Ga0068864_1004133841 331
268 3300005718 Ga0068866_10088821 Ga0068866_100888211 331
269 3300005834 Ga0068851_10018118 Ga0068851_100181182 331
270 3300005834 Ga0068851_10088321 Ga0068851_100883212 331
271 3300005841 Ga0068863_100013758 Ga0068863_1000137589 331
272 3300005841 Ga0068863_100018271 Ga0068863_1000182712 331
273 3300005841 Ga0068863_100061595 Ga0068863_1000615951 331
274 3300005841 Ga0068863_100159440 Ga0068863_1001594402 331
275 3300005841 Ga0068863_100369533 Ga0068863_1003695332 331
276 3300005842 Ga0068858_100001945 Ga0068858_10000194520 331
277 3300005842 Ga0068858_100024899 Ga0068858_1000248992 331
278 3300005842 Ga0068858_100051583 Ga0068858_1000515832 331
279 3300005843 Ga0068860_100005032 Ga0068860_10000503210 331
280 3300005843 Ga0068860_100296517 Ga0068860_1002965171 331
281 3300005844 Ga0068862_100018429 Ga0068862_1000184293 331
282 3300005844 Ga0068862_100022996 Ga0068862_1000229962 331
283 3300006237 Ga0097621_100037055 Ga0097621_1000370552 331
284 3300006237 Ga0097621_100116585 Ga0097621_1001165852 331
285 3300006358 Ga0068871_100029598 Ga0068871_1000295983 331
286 3300006881 Ga0068865_100018640 Ga0068865_1000186404 331
287 3300006881 Ga0068865_100029640 Ga0068865_1000296405 331
288 3300006931 Ga0097620_100025448 Ga0097620_1000254482 331
289 3300006931 Ga0097620_100035484 Ga0097620_1000354844 331
290 3300006931 Ga0097620_100069594 Ga0097620_1000695944 331
291 3300006931 Ga0097620_100132983 Ga0097620_1001329833 331
292 3300006931 Ga0097620_100148572 Ga0097620_1001485722 331
293 3300009093 Ga0105240_10106677 Ga0105240_101066773 331
294 3300009093 Ga0105240_10133111 Ga0105240_101331113 331
295 3300009093 Ga0105240_10408301 Ga0105240_104083012 331
296 3300009093 Ga0105240_10471538 Ga0105240_104715382 331
297 3300009098 Ga0105245_10001904 Ga0105245_1000190413 331
298 3300009098 Ga0105245_10015097 Ga0105245_100150976 331
299 3300009148 Ga0105243_10023774 Ga0105243_100237744 331
300 3300009148 Ga0105243_10132536 Ga0105243_101325362 331
301 3300009174 Ga0105241_10033052 Ga0105241_100330522 331
302 3300009174 Ga0105241_10349056 Ga0105241_103490562 331
303 3300009177 Ga0105248_10000516 Ga0105248_100005164 331
304 3300009177 Ga0105248_10002422 Ga0105248_100024223 331
305 3300009177 Ga0105248_10005728 Ga0105248_100057288 331
306 3300009177 Ga0105248_10036187 Ga0105248_100361874 331
307 3300009177 Ga0105248_10106208 Ga0105248_101062082 331
308 3300009177 Ga0105248_10597220 Ga0105248_105972201 331
309 3300009545 Ga0105237_10149138 Ga0105237_101491382 331
310 3300009551 Ga0105238_10027776 Ga0105238_100277767 331
311 3300009551 Ga0105238_10048759 Ga0105238_100487592 331
312 3300009553 Ga0105249_10288245 Ga0105249_102882452 331
313 3300010375 Ga0105239_10446630 Ga0105239_104466301 331
314 3300011119 Ga0105246_10040909 Ga0105246_100409092 331
315 3300013100 Ga0157373_10091624 Ga0157373_100916242 331
316 3300013100 Ga0157373_10138017 Ga0157373_101380172 331
317 3300013100 Ga0157373_10167396 Ga0157373_101673962 331
318 3300013102 Ga0157371_10004234 Ga0157371_100042344 331
319 3300013102 Ga0157371_10025298 Ga0157371_100252983 331
320 3300013102 Ga0157371_10052253 Ga0157371_100522534 331
321 3300013102 Ga0157371_10093015 Ga0157371_100930152 331
322 3300013102 Ga0157371_10096660 Ga0157371_100966602 331
323 3300013102 Ga0157371_10108842 Ga0157371_101088422 331
324 3300013104 Ga0157370_10029768 Ga0157370_100297682 331
325 3300013104 Ga0157370_10061885 Ga0157370_100618854 331
326 3300013105 Ga0157369_10021589 Ga0157369_100215895 331
327 3300013105 Ga0157369_10061051 Ga0157369_100610515 331
328 3300013105 Ga0157369_10077930 Ga0157369_100779304 331
329 3300013105 Ga0157369_10118721 Ga0157369_101187212 331
330 3300013297 Ga0157378_10001240 Ga0157378_100012401 331
331 3300013297 Ga0157378_10023065 Ga0157378_100230656 331
332 3300013306 Ga0163162_10030689 Ga0163162_100306893 331
333 3300013306 Ga0163162_10303765 Ga0163162_103037652 331
334 3300013307 Ga0157372_10033902 Ga0157372_100339025 331
335 3300013307 Ga0157372_10114062 Ga0157372_101140622 331
336 3300013307 Ga0157372_10122157 Ga0157372_101221573 331
337 3300013307 Ga0157372_10206770 Ga0157372_102067702 331
338 3300013308 Ga0157375_10139169 Ga0157375_101391692 331
339 3300014325 Ga0163163_10071409 Ga0163163_100714092 331
340 3300014968 Ga0157379_10048494 Ga0157379_100484945 331
341 3300014969 Ga0157376_10075188 Ga0157376_100751882 331
342 3300020070 Ga0206356_11435106 Ga0206356_114351064 331
343 3300020081 Ga0206354_11234808 Ga0206354_112348081 331
344 3300020082 Ga0206353_10771636 Ga0206353_107716362 331
345 3300025290 Ga0207673_1000614 Ga0207673_10006141 331
346 3300025315 Ga0207697_10000727 Ga0207697_1000072716 331
347 3300025315 Ga0207697_10022266 Ga0207697_100222662 331
348 3300025321 Ga0207656_10017363 Ga0207656_100173632 331
349 3300025899 Ga0207642_10017913 Ga0207642_100179133 331
350 3300025901 Ga0207688_10003780 Ga0207688_100037805 331
351 3300025901 Ga0207688_10034554 Ga0207688_100345542 331
352 3300025903 Ga0207680_10033712 Ga0207680_100337121 331
353 3300025903 Ga0207680_10061764 Ga0207680_100617641 331
354 3300025903 Ga0207680_10101181 Ga0207680_101011812 331
355 3300025904 Ga0207647_10005880 Ga0207647_1000588010 331
356 3300025904 Ga0207647_10009181 Ga0207647_100091813 331
357 3300025904 Ga0207647_10023018 Ga0207647_100230185 331
358 3300025904 Ga0207647_10033022 Ga0207647_100330222 331
359 3300025907 Ga0207645_10003176 Ga0207645_100031762 331
360 3300025907 Ga0207645_10009510 Ga0207645_100095106 331
361 3300025907 Ga0207645_10011240 Ga0207645_100112402 331
362 3300025907 Ga0207645_10204708 Ga0207645_102047082 331
363 3300025909 Ga0207705_10017020 Ga0207705_100170206 331
364 3300025909 Ga0207705_10026200 Ga0207705_100262003 331
365 3300025909 Ga0207705_10028989 Ga0207705_100289894 331
366 3300025909 Ga0207705_10037851 Ga0207705_100378512 331
367 3300025909 Ga0207705_10069596 Ga0207705_100695962 331
368 3300025909 Ga0207705_10082255 Ga0207705_100822552 331
369 3300025909 Ga0207705_10235943 Ga0207705_102359432 331
370 3300025912 Ga0207707_10040945 Ga0207707_100409453 331
371 3300025912 Ga0207707_10057411 Ga0207707_100574113 331
372 3300025913 Ga0207695_10056378 Ga0207695_100563784 331
373 3300025913 Ga0207695_10070812 Ga0207695_100708122 331
374 3300025914 Ga0207671_10079812 Ga0207671_100798122 331
375 3300025917 Ga0207660_10001743 Ga0207660_1000174314 331
376 3300025917 Ga0207660_10004736 Ga0207660_100047363 331
377 3300025917 Ga0207660_10006043 Ga0207660_100060439 331
378 3300025917 Ga0207660_10099768 Ga0207660_100997682 331
379 3300025918 Ga0207662_10216651 Ga0207662_102166512 331
380 3300025919 Ga0207657_10004404 Ga0207657_100044044 331
381 3300025919 Ga0207657_10011948 Ga0207657_100119486 331
382 3300025919 Ga0207657_10012981 Ga0207657_100129815 331
383 3300025919 Ga0207657_10015907 Ga0207657_100159078 331
384 3300025919 Ga0207657_10019078 Ga0207657_100190786 331
385 3300025919 Ga0207657_10019876 Ga0207657_100198765 331
386 3300025919 Ga0207657_10023714 Ga0207657_100237144 331
387 3300025919 Ga0207657_10038176 Ga0207657_100381764 331
388 3300025919 Ga0207657_10039209 Ga0207657_100392097 331
389 3300025919 Ga0207657_10042112 Ga0207657_100421125 331
390 3300025919 Ga0207657_10143192 Ga0207657_101431923 331
391 3300025920 Ga0207649_10015900 Ga0207649_100159004 331
392 3300025920 Ga0207649_10025413 Ga0207649_100254132 331
393 3300025920 Ga0207649_10044076 Ga0207649_100440763 331
394 3300025920 Ga0207649_10066421 Ga0207649_100664212 331
395 3300025921 Ga0207652_10040482 Ga0207652_100404824 331
396 3300025921 Ga0207652_10183828 Ga0207652_101838282 331
397 3300025921 Ga0207652_10264398 Ga0207652_102643982 331
398 3300025921 Ga0207652_10499115 Ga0207652_104991151 331
399 3300025923 Ga0207681_10012914 Ga0207681_100129144 331
400 3300025923 Ga0207681_10017563 Ga0207681_100175632 331
401 3300025925 Ga0207650_10135642 Ga0207650_101356422 331
402 3300025925 Ga0207650_10145563 Ga0207650_101455632 331
403 3300025927 Ga0207687_10128836 Ga0207687_101288362 331
404 3300025927 Ga0207687_10188842 Ga0207687_101888422 331
405 3300025931 Ga0207644_10000153 Ga0207644_1000015349 331
406 3300025931 Ga0207644_10004564 Ga0207644_1000456410 331
407 3300025931 Ga0207644_10020800 Ga0207644_100208002 331
408 3300025931 Ga0207644_10023167 Ga0207644_100231672 331
409 3300025931 Ga0207644_10023234 Ga0207644_100232343 331
410 3300025931 Ga0207644_10072573 Ga0207644_100725731 331
411 3300025932 Ga0207690_10013795 Ga0207690_100137955 331
412 3300025932 Ga0207690_10021169 Ga0207690_100211691 331
413 3300025932 Ga0207690_10069543 Ga0207690_100695432 331
414 3300025932 Ga0207690_10118311 Ga0207690_101183112 331
415 3300025932 Ga0207690_10165112 Ga0207690_101651121 331
416 3300025933 Ga0207706_10002737 Ga0207706_100027374 331
417 3300025933 Ga0207706_10009999 Ga0207706_100099995 331
418 3300025933 Ga0207706_10010165 Ga0207706_100101656 331
419 3300025933 Ga0207706_10014148 Ga0207706_100141482 331
420 3300025933 Ga0207706_10027134 Ga0207706_100271343 331
421 3300025933 Ga0207706_10053170 Ga0207706_100531702 331
422 3300025933 Ga0207706_10139024 Ga0207706_101390242 331
423 3300025933 Ga0207706_10244373 Ga0207706_102443732 331
424 3300025935 Ga0207709_10196004 Ga0207709_101960042 331
425 3300025937 Ga0207669_10053892 Ga0207669_100538922 331
426 3300025937 Ga0207669_10062607 Ga0207669_100626073 331
427 3300025937 Ga0207669_10085336 Ga0207669_100853362 331
428 3300025938 Ga0207704_10005375 Ga0207704_100053754 331
429 3300025938 Ga0207704_10008678 Ga0207704_100086784 331
430 3300025940 Ga0207691_10004092 Ga0207691_100040924 331
431 3300025940 Ga0207691_10010479 Ga0207691_100104795 331
432 3300025940 Ga0207691_10029187 Ga0207691_100291874 331
433 3300025940 Ga0207691_10060016 Ga0207691_100600163 331
434 3300025940 Ga0207691_10077274 Ga0207691_100772743 331
435 3300025941 Ga0207711_10007169 Ga0207711_100071698 331
436 3300025941 Ga0207711_10008538 Ga0207711_100085383 331
437 3300025941 Ga0207711_10020375 Ga0207711_100203757 331
438 3300025941 Ga0207711_10020755 Ga0207711_100207553 331
439 3300025941 Ga0207711_10023811 Ga0207711_100238115 331
440 3300025942 Ga0207689_10000092 Ga0207689_1000009269 331
441 3300025942 Ga0207689_10023438 Ga0207689_100234382 331
442 3300025942 Ga0207689_10027769 Ga0207689_100277693 331
443 3300025944 Ga0207661_10009424 Ga0207661_100094247 331
444 3300025944 Ga0207661_10202318 Ga0207661_102023182 331
445 3300025944 Ga0207661_10359845 Ga0207661_103598452 331
446 3300025945 Ga0207679_10002819 Ga0207679_100028197 331
447 3300025945 Ga0207679_10082288 Ga0207679_100822883 331
448 3300025945 Ga0207679_10423381 Ga0207679_104233811 331
449 3300025949 Ga0207667_10006268 Ga0207667_100062688 331
450 3300025949 Ga0207667_10025488 Ga0207667_100254887 331
451 3300025949 Ga0207667_10048537 Ga0207667_100485372 331
452 3300025949 Ga0207667_10082593 Ga0207667_100825932 331
453 3300025949 Ga0207667_10112286 Ga0207667_101122862 331
454 3300025949 Ga0207667_10198370 Ga0207667_101983703 331
455 3300025949 Ga0207667_10283539 Ga0207667_102835392 331
456 3300025960 Ga0207651_10002376 Ga0207651_100023765 331
457 3300025960 Ga0207651_10003515 Ga0207651_100035156 331
458 3300025960 Ga0207651_10012776 Ga0207651_100127763 331
459 3300025960 Ga0207651_10018449 Ga0207651_100184494 331
460 3300025972 Ga0207668_10000080 Ga0207668_100000807 331
461 3300025981 Ga0207640_10002379 Ga0207640_100023798 331
462 3300025981 Ga0207640_10007257 Ga0207640_100072574 331
463 3300025981 Ga0207640_10015780 Ga0207640_100157804 331
464 3300025981 Ga0207640_10117183 Ga0207640_101171831 331
465 3300025981 Ga0207640_10149232 Ga0207640_101492322 331
466 3300025986 Ga0207658_10001711 Ga0207658_100017113 331
467 3300025986 Ga0207658_10006240 Ga0207658_100062405 331
468 3300025986 Ga0207658_10014044 Ga0207658_100140446 331
469 3300025986 Ga0207658_10032329 Ga0207658_100323295 331
470 3300025986 Ga0207658_10050772 Ga0207658_100507724 331
471 3300026023 Ga0207677_10000733 Ga0207677_1000073319 331
472 3300026023 Ga0207677_10063023 Ga0207677_100630233 331
473 3300026023 Ga0207677_10122028 Ga0207677_101220282 331
474 3300026035 Ga0207703_10000515 Ga0207703_100005152 331
475 3300026035 Ga0207703_10017291 Ga0207703_100172913 331
476 3300026035 Ga0207703_10063513 Ga0207703_100635132 331
477 3300026041 Ga0207639_10017222 Ga0207639_100172225 331
478 3300026041 Ga0207639_10060980 Ga0207639_100609802 331
479 3300026041 Ga0207639_10063498 Ga0207639_100634982 331
480 3300026041 Ga0207639_10080287 Ga0207639_100802872 331
481 3300026067 Ga0207678_10004875 Ga0207678_100048755 331
482 3300026067 Ga0207678_10007245 Ga0207678_100072456 331
483 3300026067 Ga0207678_10059335 Ga0207678_100593352 331
484 3300026067 Ga0207678_10063839 Ga0207678_100638391 331
485 3300026067 Ga0207678_10094578 Ga0207678_100945782 331
486 3300026067 Ga0207678_10143803 Ga0207678_101438031 331
487 3300026067 Ga0207678_10237001 Ga0207678_102370012 331
488 3300026078 Ga0207702_10028488 Ga0207702_100284882 331
489 3300026078 Ga0207702_10087179 Ga0207702_100871792 331
490 3300026078 Ga0207702_10242035 Ga0207702_102420352 331
491 3300026088 Ga0207641_10010778 Ga0207641_100107782 331
492 3300026088 Ga0207641_10014516 Ga0207641_100145167 331
493 3300026088 Ga0207641_10047927 Ga0207641_100479272 331
494 3300026088 Ga0207641_10059137 Ga0207641_100591372 331
495 3300026089 Ga0207648_10002626 Ga0207648_1000262616 331
496 3300026089 Ga0207648_10006757 Ga0207648_1000675713 331
497 3300026089 Ga0207648_10018279 Ga0207648_100182792 331
498 3300026089 Ga0207648_10018472 Ga0207648_100184726 331
499 3300026089 Ga0207648_10029114 Ga0207648_100291147 331
500 3300026095 Ga0207676_10003682 Ga0207676_100036822 331
501 3300026095 Ga0207676_10005853 Ga0207676_100058539 331
502 3300026095 Ga0207676_10011738 Ga0207676_100117383 331
503 3300026095 Ga0207676_10129511 Ga0207676_101295112 331
504 3300026116 Ga0207674_10001784 Ga0207674_1000178422 331
505 3300026116 Ga0207674_10002505 Ga0207674_1000250514 331
506 3300026116 Ga0207674_10003685 Ga0207674_100036854 331
507 3300026116 Ga0207674_10018948 Ga0207674_100189487 331
508 3300026116 Ga0207674_10021860 Ga0207674_100218606 331
509 3300026116 Ga0207674_10034021 Ga0207674_100340213 331
510 3300026121 Ga0207683_10003191 Ga0207683_1000319113 331
511 3300026121 Ga0207683_10050341 Ga0207683_100503412 331
512 3300026121 Ga0207683_10082985 Ga0207683_100829852 331
513 3300026142 Ga0207698_10005458 Ga0207698_100054587 331
514 3300026142 Ga0207698_10017741 Ga0207698_100177413 331
515 3300026142 Ga0207698_10022833 Ga0207698_100228337 331
516 3300026142 Ga0207698_10045685 Ga0207698_100456854 331
517 3300026142 Ga0207698_10177794 Ga0207698_101777942 331
518 3300028379 Ga0268266_10000433 Ga0268266_100004332 331
519 3300028379 Ga0268266_10005198 Ga0268266_100051983 331
520 3300028379 Ga0268266_10012721 Ga0268266_100127216 331
521 3300028379 Ga0268266_10063100 Ga0268266_100631002 331
522 3300028380 Ga0268265_10002272 Ga0268265_100022729 331
523 3300028381 Ga0268264_10002562 Ga0268264_100025626 331
524 3300028381 Ga0268264_10003515 Ga0268264_100035158 331
525 3300031548 Ga0307408_100043360 Ga0307408_1000433602 331
526 3300031824 Ga0307413_10064011 Ga0307413_100640112 331
527 3300031852 Ga0307410_10011339 Ga0307410_100113394 331
528 3300031901 Ga0307406_10043320 Ga0307406_100433202 331
529 3300031911 Ga0307412_10091776 Ga0307412_100917762 331
530 3300031995 Ga0307409_100005874 Ga0307409_1000058742 331
531 3300031995 Ga0307409_100024886 Ga0307409_1000248862 331
532 3300032002 Ga0307416_100083426 Ga0307416_1000834263 331
533 3300032004 Ga0307414_10069185 Ga0307414_100691853 331
534 3300032004 Ga0307414_10072168 Ga0307414_100721682 331
535 3300032005 Ga0307411_10021693 Ga0307411_100216935 331
536 3300032126 Ga0307415_100054113 Ga0307415_1000541132 331
537 3300035692 Ga0373935_0005904 Ga0373935_0005904_6031_7026 331
538 3300037068 Ga0373925_0010559 Ga0373925_0010559_5323_6318 331
539 3300037312 Ga0395899_0016904 Ga0395899_0016904_604_1599 331
540 3300037312 Ga0395899_0017289 Ga0395899_0017289_4023_5018 331
541 3300037312 Ga0395899_0035672 Ga0395899_0035672_2506_3501 331
542 3300037312 Ga0395899_0049097 Ga0395899_0049097_763_1788 331
543 3300037418 Ga0395900_0012032 Ga0395900_0012032_4989_5984 331
544 3300037418 Ga0395900_0054909 Ga0395900_0054909_2790_3815 331
545 3300037418 Ga0395900_0065541 Ga0395900_0065541_745_1740 331
546 3300037418 Ga0395900_0070302 Ga0395900_0070302_266_1261 331
547 3300037418 Ga0395900_0089615 Ga0395900_0089615_219_1241 331
548 3300037418 Ga0395900_0095674 Ga0395900_0095674_976_1998 331
549 3300037418 Ga0395900_0166232 Ga0395900_0166232_737_1732 331
550 3300037418 Ga0395900_0187842 Ga0395900_0187842_647_1642 331
551 3300037466 Ga0395898_0022042 Ga0395898_0022042_2861_3856 331
552 3300037466 Ga0395898_0026382 Ga0395898_0026382_471_1466 331
553 3300037471 Ga0395905_0004302 Ga0395905_0004302_7106_8119 331
554 3300037471 Ga0395905_0018718 Ga0395905_0018718_216_1235 331
555 3300037471 Ga0395905_0037569 Ga0395905_0037569_654_1649 331
556 3300037471 Ga0395905_0053843 Ga0395905_0053843_2506_3501 331
557 3300037471 Ga0395905_0064154 Ga0395905_0064154_2263_3285 331
558 3300037471 Ga0395905_0066420 Ga0395905_0066420_240_1235 331
559 3300037471 Ga0395905_0075397 Ga0395905_0075397_1797_2792 331
560 3300037471 Ga0395905_0093567 Ga0395905_0093567_1709_2704 331
561 3300037471 Ga0395905_0113870 Ga0395905_0113870_1194_2189 331
562 3300037471 Ga0395905_0169875 Ga0395905_0169875_834_1829 331
563 3300037471 Ga0395905_0189345 Ga0395905_0189345_233_1228 331
564 3300037471 Ga0395905_0251675 Ga0395905_0251675_246_1271 331
565 3300037471 Ga0395905_0373658 Ga0395905_0373658_176_1243 331
566 3300038443 Ga0395901_0015055 Ga0395901_0015055_5343_6338 331
567 3300038443 Ga0395901_0048641 Ga0395901_0048641_3089_4084 331
568 3300038443 Ga0395901_0089415 Ga0395901_0089415_1605_2600 331
569 3300038443 Ga0395901_0184946 Ga0395901_0184946_602_1627 331
570 3300038443 Ga0395901_0211793 Ga0395901_0211793_222_1217 331
571 3300044693 Ga0466961_0037195 Ga0466961_0037195_1115_2140 331
572 3300044694 Ga0466963_0018676 Ga0466963_0018676_1041_2036 331
573 3300044694 Ga0466963_0035719 Ga0466963_0035719_1079_2104 331
574 3300044694 Ga0466963_0106239 Ga0466963_0106239_154_1179 331
575 3300044694 Ga0466963_0184899 Ga0466963_0184899_89_1111 331
576 3300044842 Ga0466957_0016211 Ga0466957_0016211_771_1796 331
577 3300044842 Ga0466957_0095653 Ga0466957_0095653_852_1853 331
578 3300045836 Ga0466958_0199101 Ga0466958_0199101_149_1144 331
579 3300045976 Ga0466967_0144153 Ga0466967_0144153_150_1172 331
580 3300045976 Ga0466967_0253731 Ga0466967_0253731_641_1666 331
581 3300046525 Ga0495663_0003309 Ga0495663_0003309_1150_2175 331
582 3300046537 Ga0495598_0003508 Ga0495598_0003508_1200_2195 331
583 3300046539 Ga0495621_0000094 Ga0495621_0000094_9249_10244 331
584 3300046539 Ga0495621_0043596 Ga0495621_0043596_255_1280 331
585 3300046616 Ga0495668_0087038 Ga0495668_0087038_438_1433 331
586 3300046684 Ga0495669_0000617 Ga0495669_0000617_2736_3761 331
587 3300046684 Ga0495669_0008270 Ga0495669_0008270_739_1734 331
588 3300046684 Ga0495669_0008952 Ga0495669_0008952_1968_2963 331
589 3300046684 Ga0495669_0035828 Ga0495669_0035828_269_1264 331
590 3300046691 Ga0495670_0004793 Ga0495670_0004793_2257_3252 331
591 3300047445 Ga0495677_0003141 Ga0495677_0003141_2544_3569 331
592 3300048903 Ga0496100_0004507 Ga0496100_0004507_3989_5011 331
593 3300048904 Ga0496101_0000589 Ga0496101_0000589_17403_18425 331
594 3300048904 Ga0496101_0055076 Ga0496101_0055076_1808_2803 331
595 3300048904 Ga0496101_0123775 Ga0496101_0123775_407_1402 331
596 3300048906 Ga0496103_0032088 Ga0496103_0032088_2147_3142 331
597 3300048906 Ga0496103_0050519 Ga0496103_0050519_640_1662 331
598 3300048907 Ga0496104_0011224 Ga0496104_0011224_537_1559 331
599 3300048907 Ga0496104_0360524 Ga0496104_0360524_308_1303 331
600 3300048908 Ga0496105_0010283 Ga0496105_0010283_2083_3105 331
601 3300048909 Ga0496106_0007644 Ga0496106_0007644_5221_6216 331
602 3300048909 Ga0496106_0023948 Ga0496106_0023948_2519_3541 331
603 3300048910 Ga0496107_0000429 Ga0496107_0000429_2927_3922 331
604 3300048910 Ga0496107_0000990 Ga0496107_0000990_13364_14386 331
605 3300048911 Ga0496108_0005046 Ga0496108_0005046_7265_8287 331
606 3300048911 Ga0496108_0012375 Ga0496108_0012375_4037_5032 331
607 3300048911 Ga0496108_0036270 Ga0496108_0036270_2693_3760 331
608 3300048912 Ga0496109_0009634 Ga0496109_0009634_2531_3526 331
609 3300048912 Ga0496109_0038803 Ga0496109_0038803_2299_3321 331
610 3300048912 Ga0496109_0064365 Ga0496109_0064365_1912_2907 331
611 3300048913 Ga0496110_0011777 Ga0496110_0011777_1336_2331 331
612 3300048913 Ga0496110_0012497 Ga0496110_0012497_1964_2959 331
613 3300048913 Ga0496110_0036060 Ga0496110_0036060_2285_3307 331
614 3300048913 Ga0496110_0231641 Ga0496110_0231641_142_1137 331
615 3300048914 Ga0496111_0000459 Ga0496111_0000459_2584_3606 331
616 3300048914 Ga0496111_0008661 Ga0496111_0008661_2008_3003 331
617 3300048915 Ga0496112_0000707 Ga0496112_0000707_2298_3320 331
618 3300048915 Ga0496112_0002279 Ga0496112_0002279_2791_3786 331
619 3300048915 Ga0496112_0034103 Ga0496112_0034103_1731_2726 331
620 3300048915 Ga0496112_0084543 Ga0496112_0084543_232_1227 331
621 3300048915 Ga0496112_0282443 Ga0496112_0282443_76_1098 331
622 3300048916 Ga0496113_0000431 Ga0496113_0000431_17073_18095 331
623 3300048916 Ga0496113_0005916 Ga0496113_0005916_4560_5555 331
624 3300048916 Ga0496113_0073611 Ga0496113_0073611_1049_2044 331
625 3300048917 Ga0496114_0036791 Ga0496114_0036791_1558_2580 331
626 3300048917 Ga0496114_0060031 Ga0496114_0060031_1443_2468 331
627 3300048918 Ga0496115_0010000 Ga0496115_0010000_3378_4403 331
628 3300049742 Ga0501080_0414030 Ga0501080_0414030_29_1024 331
629 3300053087 Ga0500643_000244 Ga0500643_000244_38051_39046 331
630 3300053134 Ga0500658_0000152 Ga0500658_0000152_16515_17510 331

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01068

DNA_ligase_A_M

ATP dependent DNA ligase domain

11

204

0.87

PF04679

DNA_ligase_A_C

ATP dependent DNA ligase C terminal region

222

323

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
7rpw-assembly1.cif.gz_E archaeal dna ligase and heterotrimeric pcna in complex with adenylated dna 0.7888 1 191
3vnn-assembly1.cif.gz_A crystal structure of a sub-domain of the nucleotidyltransferase (adenylation) domain of human dna ligase iv 0.7387 18 144
7l35-assembly1.cif.gz_A human dna ligase 1 - r771w nicked dna complex 0.7272 1 315
6p0d-assembly1.cif.gz_A human dna ligase 1 (e346a/e592a) bound to an adenylated, hydroxyl terminated dna nick 0.722 11 315
6q1v-assembly1.cif.gz_A human dna ligase 1 (e592r) bound to an adenylated, hydroxyl terminated dna nick 0.7097 11 315
ID Description Score Start End Superfamily
af_L0TDE1_8_201_3.30.470.30 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;DNA ligase/mRNA capping enzyme 0.9447 1 188 3.30.470.30
af_L0TDE1_8_201_3.30.470.30 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;DNA ligase/mRNA capping enzyme 0.9117 1 188 3.30.470.30
af_L0TDE1_203_339_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.8466 191 313 2.40.50.140
af_P9WNV3_639_759_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.8421 191 312 2.40.50.140
af_P9WNV5_183_380_3.30.470.30 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;DNA ligase/mRNA capping enzyme 0.8246 3 188 3.30.470.30
ID Description Score Start End GO Terms
AF-A0A436S515-F1-model_v4 ATP-dependent DNA ligase 0.9693 1 145 GO:0003910
GO:0005524
GO:0006281
GO:0006310
AF-A0A2V8HRN8-F1-model_v4 ATP-dependent DNA ligase 0.9692 1 152 GO:0003910
GO:0005524
GO:0006281
GO:0006310
AF-A0A535WW92-F1-model_v4 ATP-dependent DNA ligase (EC 6.5.1.1) 0.9688 18 114 GO:0003910
GO:0005524
GO:0006281
GO:0006310
AF-A0A2V5P8F7-F1-model_v4 ATP-dependent DNA ligase 0.9644 1 109 GO:0003910
GO:0005524
GO:0006281
GO:0006310
AF-A0A7V9NFQ0-F1-model_v4 ATP-dependent DNA ligase family profile domain-containing protein 0.9631 1 119 GO:0003910
GO:0005524
GO:0006281
GO:0006310

Feature Viewer

pLDDT pTM Quality
85.16 0.72 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map