F470851
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 630 | 222 | 630 | 339 |
Family's Representative Sequence
| Representative Sequence | 3300032004|Ga0307414_10069185|Ga0307414_100691853 |
| Length | 349 |
| Sequence | MSAFDRLAVKPGLAPMEAKLVDALPEGPGWQYEPKWDGFRCLVFRDGGDVDLRSKSGKPLGRYFPEVAAAIGALKAKRLVLDGELIIPVGGVLSFEALQMRLHPAESRVRKLAAETPAQLMLFDWLLSTSGKSLLEKPLSERRDALERFHAGENADSLRLSPCTRDRETARVWLDRAGAALDGVVAKRRDEAYAPGERAMLKVKQQRTADCVVGGYRYAAKGRQVVGSLLLGLYNAQGKLDHVGFTSAIPDDDKAALTQRLEALAGPPGFTGKAPGGPSRWSNDRSGDWQPLRPELVVEVRYDHVTGDRFRHGTGFLRWRPDKAPEQCRMDQLTPEARPAELEAAMDGR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 2 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 3 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 4 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 5 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 6 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 7 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 11 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 13 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 15 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 17 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 19 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 20 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 30 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 37 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 38 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 39 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 41 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 46 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 48 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 49 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 50 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 51 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 52 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 53 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 54 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 55 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 56 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 57 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 58 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 59 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 60 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 62 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 63 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 64 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 66 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 87 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 90 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 91 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 92 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 151 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 152 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 153 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 154 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 155 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 156 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 157 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 158 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 159 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 160 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 161 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 162 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 163 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 164 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 165 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 166 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 167 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 168 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 169 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 170 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 171 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 172 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 173 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 174 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 175 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 176 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 177 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 178 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 179 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 180 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 181 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 182 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 192 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 193 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 194 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 195 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 196 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 197 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 198 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 199 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 200 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 201 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 202 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 203 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 204 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 205 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 206 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 207 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 208 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 209 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 210 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 211 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 212 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 213 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 214 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 215 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 216 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 217 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 218 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 219 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 220 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 221 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 222 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.52 |
| Metatranscriptomes | 0.48 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.32 |
| Nodule | 0 |
| Rhizoplane | 5.87 |
| Rhizosphere | 93.49 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.32 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24741J21665_1008871 | 3300001915 | Bacteria | 1874 |
| 2 | JGI24740J21852_10001441 | 3300001979 | Bacteria | 10908 |
| 3 | JGI24740J21852_10003168 | 3300001979 | Bacteria | 7261 |
| 4 | JGI24740J21852_10007705 | 3300001979 | Bacteria | 4355 |
| 5 | JGI24740J21852_10023162 | 3300001979 | Bacteria | 2125 |
| 6 | JGI24739J22299_10017852 | 3300001989 | Bacteria | 2557 |
| 7 | JGI24737J22298_10000598 | 3300001990 | Bacteria | 12680 |
| 8 | JGI24735J21928_10017359 | 3300002067 | Bacteria | 2227 |
| 9 | JGI24738J21930_10000859 | 3300002075 | Bacteria | 8719 |
| 10 | JGI24738J21930_10008928 | 3300002075 | Bacteria | 2271 |
| 11 | Ga0070658_10065371 | 3300005327 | Bacteria | 2968 |
| 12 | Ga0070658_10097078 | 3300005327 | Bacteria | 2433 |
| 13 | Ga0070658_10132960 | 3300005327 | Bacteria | 2074 |
| 14 | Ga0070658_10133665 | 3300005327 | Bacteria | 2068 |
| 15 | Ga0070658_10163959 | 3300005327 | Bacteria | 1865 |
| 16 | Ga0070658_10196848 | 3300005327 | Bacteria | 1699 |
| 17 | Ga0070658_10297014 | 3300005327 | Bacteria | 1377 |
| 18 | Ga0070676_10006115 | 3300005328 | Bacteria | 6428 |
| 19 | Ga0070676_10016934 | 3300005328 | Bacteria | 4030 |
| 20 | Ga0070676_10046153 | 3300005328 | Bacteria | 2540 |
| 21 | Ga0070676_10149558 | 3300005328 | Bacteria | 1494 |
| 22 | Ga0070676_10229271 | 3300005328 | Bacteria | 1230 |
| 23 | Ga0070683_100006593 | 3300005329 | Bacteria | 9751 |
| 24 | Ga0070683_100037350 | 3300005329 | Bacteria | 4446 |
| 25 | Ga0070683_100217928 | 3300005329 | Bacteria | 1814 |
| 26 | Ga0070690_100007695 | 3300005330 | Bacteria | 6177 |
| 27 | Ga0070690_100012729 | 3300005330 | Bacteria | 4954 |
| 28 | Ga0070670_100039761 | 3300005331 | Bacteria | 4044 |
| 29 | Ga0070670_100071915 | 3300005331 | Bacteria | 2970 |
| 30 | Ga0068869_100001036 | 3300005334 | Bacteria | 16179 |
| 31 | Ga0068869_100018329 | 3300005334 | Bacteria | 4763 |
| 32 | Ga0068869_100065208 | 3300005334 | Bacteria | 2680 |
| 33 | Ga0070666_10048340 | 3300005335 | Bacteria | 2858 |
| 34 | Ga0070680_100005354 | 3300005336 | Bacteria | 9708 |
| 35 | Ga0070680_100008123 | 3300005336 | Bacteria | 8015 |
| 36 | Ga0070680_100033815 | 3300005336 | Bacteria | 4122 |
| 37 | Ga0070680_100038536 | 3300005336 | Bacteria | 3865 |
| 38 | Ga0070680_100211211 | 3300005336 | Bacteria | 1637 |
| 39 | Ga0070682_100024162 | 3300005337 | Bacteria | 3614 |
| 40 | Ga0068868_100000042 | 3300005338 | Bacteria | 68731 |
| 41 | Ga0068868_100000156 | 3300005338 | Bacteria | 44526 |
| 42 | Ga0068868_100013844 | 3300005338 | Bacteria | 5929 |
| 43 | Ga0068868_100153124 | 3300005338 | Bacteria | 1900 |
| 44 | Ga0070660_100000546 | 3300005339 | Bacteria | 25255 |
| 45 | Ga0070660_100027758 | 3300005339 | Bacteria | 4228 |
| 46 | Ga0070660_100043482 | 3300005339 | Bacteria | 3433 |
| 47 | Ga0070660_100047179 | 3300005339 | Bacteria | 3304 |
| 48 | Ga0070660_100184415 | 3300005339 | Bacteria | 1689 |
| 49 | Ga0070660_100236365 | 3300005339 | Bacteria | 1487 |
| 50 | Ga0070689_100017804 | 3300005340 | Bacteria | 5223 |
| 51 | Ga0070691_10006514 | 3300005341 | Bacteria | 5340 |
| 52 | Ga0070687_100001117 | 3300005343 | Bacteria | 9252 |
| 53 | Ga0070661_100010302 | 3300005344 | Bacteria | 6498 |
| 54 | Ga0070661_100035953 | 3300005344 | Bacteria | 3600 |
| 55 | Ga0070661_100047447 | 3300005344 | Bacteria | 3143 |
| 56 | Ga0070661_100056937 | 3300005344 | Bacteria | 2864 |
| 57 | Ga0070661_100058421 | 3300005344 | Bacteria | 2826 |
| 58 | Ga0070661_100084006 | 3300005344 | Bacteria | 2352 |
| 59 | Ga0070661_100146677 | 3300005344 | Bacteria | 1782 |
| 60 | Ga0070661_100202387 | 3300005344 | Bacteria | 1517 |
| 61 | Ga0070661_100205878 | 3300005344 | Bacteria | 1505 |
| 62 | Ga0070692_10058971 | 3300005345 | Bacteria | 2017 |
| 63 | Ga0070668_100002631 | 3300005347 | Bacteria | 13189 |
| 64 | Ga0070668_100006318 | 3300005347 | Bacteria | 8776 |
| 65 | Ga0070668_100406775 | 3300005347 | Bacteria | 1163 |
| 66 | Ga0070669_100000383 | 3300005353 | Bacteria | 33931 |
| 67 | Ga0070669_100005434 | 3300005353 | Bacteria | 9191 |
| 68 | Ga0070669_100101262 | 3300005353 | Bacteria | 2173 |
| 69 | Ga0070675_100019689 | 3300005354 | Bacteria | 5380 |
| 70 | Ga0070675_100020015 | 3300005354 | Bacteria | 5340 |
| 71 | Ga0070675_100126534 | 3300005354 | Bacteria | 2174 |
| 72 | Ga0070671_100005598 | 3300005355 | Bacteria | 10003 |
| 73 | Ga0070671_100007731 | 3300005355 | Bacteria | 8586 |
| 74 | Ga0070671_100045353 | 3300005355 | Bacteria | 3654 |
| 75 | Ga0070671_100046678 | 3300005355 | Bacteria | 3602 |
| 76 | Ga0070671_100175372 | 3300005355 | Bacteria | 1814 |
| 77 | Ga0070674_100002665 | 3300005356 | Bacteria | 9891 |
| 78 | Ga0070674_100053443 | 3300005356 | Bacteria | 2789 |
| 79 | Ga0070674_100076181 | 3300005356 | Bacteria | 2384 |
| 80 | Ga0070674_100083209 | 3300005356 | Bacteria | 2291 |
| 81 | Ga0070673_100004316 | 3300005364 | Bacteria | 8981 |
| 82 | Ga0070673_100026270 | 3300005364 | Bacteria | 4299 |
| 83 | Ga0070673_100041339 | 3300005364 | Bacteria | 3545 |
| 84 | Ga0070673_100045730 | 3300005364 | Bacteria | 3396 |
| 85 | Ga0070673_100051631 | 3300005364 | Bacteria | 3222 |
| 86 | Ga0070673_100287821 | 3300005364 | Bacteria | 1443 |
| 87 | Ga0070673_100352879 | 3300005364 | Bacteria | 1306 |
| 88 | Ga0070688_100012116 | 3300005365 | Bacteria | 4820 |
| 89 | Ga0070659_100000011 | 3300005366 | Bacteria | 185903 |
| 90 | Ga0070659_100001501 | 3300005366 | Bacteria | 16815 |
| 91 | Ga0070659_100029545 | 3300005366 | Bacteria | 4237 |
| 92 | Ga0070659_100053731 | 3300005366 | Bacteria | 3171 |
| 93 | Ga0070659_100092102 | 3300005366 | Bacteria | 2430 |
| 94 | Ga0070659_100097115 | 3300005366 | Bacteria | 2367 |
| 95 | Ga0070659_100160361 | 3300005366 | Bacteria | 1838 |
| 96 | Ga0070667_100001584 | 3300005367 | Bacteria | 20376 |
| 97 | Ga0070667_100012687 | 3300005367 | Bacteria | 6966 |
| 98 | Ga0070667_100041740 | 3300005367 | Bacteria | 3848 |
| 99 | Ga0070667_100050007 | 3300005367 | Bacteria | 3521 |
| 100 | Ga0070667_100108717 | 3300005367 | Bacteria | 2403 |
| 101 | Ga0070714_100008702 | 3300005435 | Bacteria | 7935 |
| 102 | Ga0070714_100092423 | 3300005435 | Bacteria | 2652 |
| 103 | Ga0070663_100013495 | 3300005455 | Bacteria | 5213 |
| 104 | Ga0070663_100081295 | 3300005455 | Bacteria | 2381 |
| 105 | Ga0070663_100301449 | 3300005455 | Bacteria | 1283 |
| 106 | Ga0070678_100022271 | 3300005456 | Bacteria | 4194 |
| 107 | Ga0070678_100260748 | 3300005456 | Bacteria | 1458 |
| 108 | Ga0070662_100002134 | 3300005457 | Bacteria | 12131 |
| 109 | Ga0070662_100021023 | 3300005457 | Bacteria | 4451 |
| 110 | Ga0070662_100026135 | 3300005457 | Bacteria | 4040 |
| 111 | Ga0070662_100056092 | 3300005457 | Bacteria | 2860 |
| 112 | Ga0070662_100060213 | 3300005457 | Bacteria | 2768 |
| 113 | Ga0070662_100117553 | 3300005457 | Bacteria | 2034 |
| 114 | Ga0070662_100251040 | 3300005457 | Bacteria | 1422 |
| 115 | Ga0070681_10048504 | 3300005458 | Bacteria | 4243 |
| 116 | Ga0070681_10057143 | 3300005458 | Bacteria | 3882 |
| 117 | Ga0070681_10158480 | 3300005458 | Bacteria | 2187 |
| 118 | Ga0068867_100000388 | 3300005459 | Bacteria | 29345 |
| 119 | Ga0068867_100005540 | 3300005459 | Bacteria | 8940 |
| 120 | Ga0068867_100009725 | 3300005459 | Bacteria | 6781 |
| 121 | Ga0068867_100034181 | 3300005459 | Bacteria | 3684 |
| 122 | Ga0070679_100005895 | 3300005530 | Bacteria | 11385 |
| 123 | Ga0070679_100010802 | 3300005530 | Bacteria | 8672 |
| 124 | Ga0070679_100172126 | 3300005530 | Bacteria | 2138 |
| 125 | Ga0070679_100215316 | 3300005530 | Bacteria | 1883 |
| 126 | Ga0070679_100229370 | 3300005530 | Bacteria | 1817 |
| 127 | Ga0070679_100288909 | 3300005530 | Bacteria | 1591 |
| 128 | Ga0070684_100005655 | 3300005535 | Bacteria | 9603 |
| 129 | Ga0070684_100059342 | 3300005535 | Bacteria | 3345 |
| 130 | Ga0070684_100117642 | 3300005535 | Bacteria | 2388 |
| 131 | Ga0068853_100014239 | 3300005539 | Bacteria | 6509 |
| 132 | Ga0068853_100025273 | 3300005539 | Bacteria | 4983 |
| 133 | Ga0068853_100084028 | 3300005539 | Bacteria | 2789 |
| 134 | Ga0068853_100167147 | 3300005539 | Bacteria | 1988 |
| 135 | Ga0068853_100237927 | 3300005539 | Bacteria | 1668 |
| 136 | Ga0070672_100008121 | 3300005543 | Bacteria | 7173 |
| 137 | Ga0070672_100023111 | 3300005543 | Bacteria | 4578 |
| 138 | Ga0070672_100064227 | 3300005543 | Bacteria | 2900 |
| 139 | Ga0070672_100101715 | 3300005543 | Bacteria | 2331 |
| 140 | Ga0070672_100144836 | 3300005543 | Bacteria | 1963 |
| 141 | Ga0070686_100000034 | 3300005544 | Bacteria | 112341 |
| 142 | Ga0070686_100076685 | 3300005544 | Bacteria | 2202 |
| 143 | Ga0070693_100194529 | 3300005547 | Bacteria | 1314 |
| 144 | Ga0070665_100001571 | 3300005548 | Bacteria | 26343 |
| 145 | Ga0070665_100017906 | 3300005548 | Bacteria | 7114 |
| 146 | Ga0070665_100069451 | 3300005548 | Bacteria | 3530 |
| 147 | Ga0070665_100128935 | 3300005548 | Bacteria | 2532 |
| 148 | Ga0070665_100211064 | 3300005548 | Bacteria | 1942 |
| 149 | Ga0068855_100029810 | 3300005563 | Bacteria | 6524 |
| 150 | Ga0068855_100071375 | 3300005563 | Bacteria | 4038 |
| 151 | Ga0070664_100004853 | 3300005564 | Bacteria | 10771 |
| 152 | Ga0070664_100041440 | 3300005564 | Bacteria | 3885 |
| 153 | Ga0070664_100047218 | 3300005564 | Bacteria | 3637 |
| 154 | Ga0070664_100054244 | 3300005564 | Bacteria | 3400 |
| 155 | Ga0070664_100059187 | 3300005564 | Bacteria | 3259 |
| 156 | Ga0068857_100000282 | 3300005577 | Bacteria | 34844 |
| 157 | Ga0068857_100009874 | 3300005577 | Bacteria | 8288 |
| 158 | Ga0068857_100035736 | 3300005577 | Bacteria | 4401 |
| 159 | Ga0068857_100043250 | 3300005577 | Bacteria | 3996 |
| 160 | Ga0068857_100061074 | 3300005577 | Bacteria | 3348 |
| 161 | Ga0068854_100022246 | 3300005578 | Bacteria | 4315 |
| 162 | Ga0068854_100023719 | 3300005578 | Bacteria | 4193 |
| 163 | Ga0068854_100025824 | 3300005578 | Bacteria | 4031 |
| 164 | Ga0068854_100056622 | 3300005578 | Bacteria | 2826 |
| 165 | Ga0068854_100072701 | 3300005578 | Bacteria | 2518 |
| 166 | Ga0068854_100197695 | 3300005578 | Bacteria | 1579 |
| 167 | Ga0068856_100068244 | 3300005614 | Bacteria | 3514 |
| 168 | Ga0068856_100069910 | 3300005614 | Bacteria | 3472 |
| 169 | Ga0068856_100278972 | 3300005614 | Bacteria | 1688 |
| 170 | Ga0068856_100304888 | 3300005614 | Bacteria | 1610 |
| 171 | Ga0068852_100005199 | 3300005616 | Bacteria | 9281 |
| 172 | Ga0068852_100009120 | 3300005616 | Bacteria | 7345 |
| 173 | Ga0068852_100017311 | 3300005616 | Bacteria | 5651 |
| 174 | Ga0068852_100028391 | 3300005616 | Bacteria | 4579 |
| 175 | Ga0068852_100075039 | 3300005616 | Bacteria | 2981 |
| 176 | Ga0068852_100148075 | 3300005616 | Bacteria | 2180 |
| 177 | Ga0068859_100008573 | 3300005617 | Bacteria | 10338 |
| 178 | Ga0068859_100025449 | 3300005617 | Bacteria | 5936 |
| 179 | Ga0068859_100035482 | 3300005617 | Bacteria | 5003 |
| 180 | Ga0068859_100069590 | 3300005617 | Bacteria | 3554 |
| 181 | Ga0068859_100132974 | 3300005617 | Bacteria | 2560 |
| 182 | Ga0068859_100148580 | 3300005617 | Bacteria | 2419 |
| 183 | Ga0068864_100012719 | 3300005618 | Bacteria | 6956 |
| 184 | Ga0068864_100035442 | 3300005618 | Bacteria | 4248 |
| 185 | Ga0068864_100036405 | 3300005618 | Bacteria | 4195 |
| 186 | Ga0068864_100413384 | 3300005618 | Bacteria | 1284 |
| 187 | Ga0068866_10088821 | 3300005718 | Bacteria | 1678 |
| 188 | Ga0068851_10018118 | 3300005834 | Bacteria | 3391 |
| 189 | Ga0068851_10088321 | 3300005834 | Bacteria | 1629 |
| 190 | Ga0068870_10003492 | 3300005840 | Bacteria | 6668 |
| 191 | Ga0068863_100013758 | 3300005841 | Bacteria | 7798 |
| 192 | Ga0068863_100018271 | 3300005841 | Bacteria | 6714 |
| 193 | Ga0068863_100061595 | 3300005841 | Bacteria | 3548 |
| 194 | Ga0068863_100159440 | 3300005841 | Bacteria | 2161 |
| 195 | Ga0068863_100369533 | 3300005841 | Bacteria | 1399 |
| 196 | Ga0068858_100001945 | 3300005842 | Bacteria | 21060 |
| 197 | Ga0068858_100024899 | 3300005842 | Bacteria | 5571 |
| 198 | Ga0068858_100051583 | 3300005842 | Bacteria | 3806 |
| 199 | Ga0068860_100005032 | 3300005843 | Bacteria | 13450 |
| 200 | Ga0068860_100296517 | 3300005843 | Bacteria | 1583 |
| 201 | Ga0068862_100018429 | 3300005844 | Bacteria | 5814 |
| 202 | Ga0068862_100022996 | 3300005844 | Bacteria | 5219 |
| 203 | Ga0097621_100037055 | 3300006237 | Bacteria | 3904 |
| 204 | Ga0097621_100116585 | 3300006237 | Bacteria | 2262 |
| 205 | Ga0068871_100029598 | 3300006358 | Bacteria | 4302 |
| 206 | Ga0068865_100018640 | 3300006881 | Bacteria | 4481 |
| 207 | Ga0068865_100029640 | 3300006881 | Bacteria | 3633 |
| 208 | Ga0075436_100011065 | 3300006914 | Bacteria | 6190 |
| 209 | Ga0097620_100008573 | 3300006931 | Bacteria | 10338 |
| 210 | Ga0097620_100025448 | 3300006931 | Bacteria | 5936 |
| 211 | Ga0097620_100035484 | 3300006931 | Bacteria | 5003 |
| 212 | Ga0097620_100069594 | 3300006931 | Bacteria | 3554 |
| 213 | Ga0097620_100132983 | 3300006931 | Bacteria | 2560 |
| 214 | Ga0097620_100148572 | 3300006931 | Bacteria | 2419 |
| 215 | Ga0075435_100000282 | 3300007076 | Bacteria | 31568 |
| 216 | Ga0105240_10106677 | 3300009093 | Bacteria | 3397 |
| 217 | Ga0105240_10133111 | 3300009093 | Bacteria | 2980 |
| 218 | Ga0105240_10133554 | 3300009093 | Bacteria | 2974 |
| 219 | Ga0105240_10408301 | 3300009093 | Bacteria | 1528 |
| 220 | Ga0105240_10471538 | 3300009093 | Bacteria | 1401 |
| 221 | Ga0111539_10201634 | 3300009094 | Bacteria | 2320 |
| 222 | Ga0105245_10001904 | 3300009098 | Bacteria | 18963 |
| 223 | Ga0105245_10011149 | 3300009098 | Bacteria | 7823 |
| 224 | Ga0105245_10015097 | 3300009098 | Bacteria | 6728 |
| 225 | Ga0105243_10023774 | 3300009148 | Bacteria | 4670 |
| 226 | Ga0105243_10132536 | 3300009148 | Bacteria | 2116 |
| 227 | Ga0105241_10033052 | 3300009174 | Bacteria | 3881 |
| 228 | Ga0105241_10349056 | 3300009174 | Bacteria | 1284 |
| 229 | Ga0105248_10000516 | 3300009177 | Bacteria | 43895 |
| 230 | Ga0105248_10002422 | 3300009177 | Bacteria | 20691 |
| 231 | Ga0105248_10005728 | 3300009177 | Bacteria | 13638 |
| 232 | Ga0105248_10036187 | 3300009177 | Bacteria | 5521 |
| 233 | Ga0105248_10106208 | 3300009177 | Bacteria | 3166 |
| 234 | Ga0105248_10597220 | 3300009177 | Bacteria | 1245 |
| 235 | Ga0105237_10149138 | 3300009545 | Bacteria | 2334 |
| 236 | Ga0105238_10027776 | 3300009551 | Bacteria | 5767 |
| 237 | Ga0105238_10048759 | 3300009551 | Bacteria | 4267 |
| 238 | Ga0105238_10109872 | 3300009551 | Bacteria | 2739 |
| 239 | Ga0105249_10000023 | 3300009553 | Bacteria | 238850 |
| 240 | Ga0105249_10288245 | 3300009553 | Bacteria | 1642 |
| 241 | Ga0105239_10446630 | 3300010375 | Bacteria | 1467 |
| 242 | Ga0105246_10040909 | 3300011119 | Bacteria | 3131 |
| 243 | Ga0157373_10091624 | 3300013100 | Bacteria | 2141 |
| 244 | Ga0157373_10138017 | 3300013100 | Bacteria | 1714 |
| 245 | Ga0157373_10167396 | 3300013100 | Bacteria | 1547 |
| 246 | Ga0157371_10004234 | 3300013102 | Bacteria | 12616 |
| 247 | Ga0157371_10025298 | 3300013102 | Bacteria | 4327 |
| 248 | Ga0157371_10052253 | 3300013102 | Bacteria | 2902 |
| 249 | Ga0157371_10093015 | 3300013102 | Bacteria | 2136 |
| 250 | Ga0157371_10096660 | 3300013102 | Bacteria | 2093 |
| 251 | Ga0157371_10108842 | 3300013102 | Bacteria | 1967 |
| 252 | Ga0157370_10024458 | 3300013104 | Bacteria | 5982 |
| 253 | Ga0157370_10029768 | 3300013104 | Bacteria | 5355 |
| 254 | Ga0157370_10061885 | 3300013104 | Bacteria | 3551 |
| 255 | Ga0157369_10021589 | 3300013105 | Bacteria | 7200 |
| 256 | Ga0157369_10031227 | 3300013105 | Bacteria | 5868 |
| 257 | Ga0157369_10061051 | 3300013105 | Bacteria | 4064 |
| 258 | Ga0157369_10062280 | 3300013105 | Bacteria | 4021 |
| 259 | Ga0157369_10077930 | 3300013105 | Bacteria | 3551 |
| 260 | Ga0157369_10118721 | 3300013105 | Bacteria | 2807 |
| 261 | Ga0157369_10152062 | 3300013105 | Bacteria | 2446 |
| 262 | Ga0157378_10001240 | 3300013297 | Bacteria | 23084 |
| 263 | Ga0157378_10023065 | 3300013297 | Bacteria | 5478 |
| 264 | Ga0163162_10030689 | 3300013306 | Bacteria | 5326 |
| 265 | Ga0163162_10303765 | 3300013306 | Bacteria | 1728 |
| 266 | Ga0157372_10015728 | 3300013307 | Bacteria | 8113 |
| 267 | Ga0157372_10033902 | 3300013307 | Bacteria | 5611 |
| 268 | Ga0157372_10114062 | 3300013307 | Bacteria | 3098 |
| 269 | Ga0157372_10122157 | 3300013307 | Bacteria | 2993 |
| 270 | Ga0157372_10206770 | 3300013307 | Bacteria | 2274 |
| 271 | Ga0157375_10139169 | 3300013308 | Bacteria | 2553 |
| 272 | Ga0157375_10399009 | 3300013308 | Bacteria | 1542 |
| 273 | Ga0163163_10071409 | 3300014325 | Bacteria | 3459 |
| 274 | Ga0182008_10003649 | 3300014497 | Bacteria | 9187 |
| 275 | Ga0157379_10048494 | 3300014968 | Bacteria | 3791 |
| 276 | Ga0157376_10075188 | 3300014969 | Bacteria | 2882 |
| 277 | Ga0206356_11435106 | 3300020070 | Bacteria | 3648 |
| 278 | Ga0206354_11234808 | 3300020081 | Bacteria | 1223 |
| 279 | Ga0206353_10771636 | 3300020082 | Bacteria | 1847 |
| 280 | Ga0207673_1000614 | 3300025290 | Bacteria | 3802 |
| 281 | Ga0207697_10000727 | 3300025315 | Bacteria | 18712 |
| 282 | Ga0207697_10022266 | 3300025315 | Bacteria | 2596 |
| 283 | Ga0207656_10017363 | 3300025321 | Bacteria | 2818 |
| 284 | Ga0207682_10014169 | 3300025893 | Bacteria | 3107 |
| 285 | Ga0207642_10017913 | 3300025899 | Bacteria | 2706 |
| 286 | Ga0207688_10003780 | 3300025901 | Bacteria | 8253 |
| 287 | Ga0207688_10034554 | 3300025901 | Bacteria | 2800 |
| 288 | Ga0207680_10033712 | 3300025903 | Bacteria | 2924 |
| 289 | Ga0207680_10061764 | 3300025903 | Bacteria | 2286 |
| 290 | Ga0207680_10101181 | 3300025903 | Bacteria | 1852 |
| 291 | Ga0207647_10005880 | 3300025904 | Bacteria | 8940 |
| 292 | Ga0207647_10009181 | 3300025904 | Bacteria | 7035 |
| 293 | Ga0207647_10023018 | 3300025904 | Bacteria | 4129 |
| 294 | Ga0207647_10033022 | 3300025904 | Bacteria | 3318 |
| 295 | Ga0207645_10003176 | 3300025907 | Bacteria | 12577 |
| 296 | Ga0207645_10009510 | 3300025907 | Bacteria | 6719 |
| 297 | Ga0207645_10011240 | 3300025907 | Bacteria | 6123 |
| 298 | Ga0207645_10204708 | 3300025907 | Bacteria | 1299 |
| 299 | Ga0207643_10015983 | 3300025908 | Bacteria | 4088 |
| 300 | Ga0207705_10017020 | 3300025909 | Bacteria | 5207 |
| 301 | Ga0207705_10026200 | 3300025909 | Bacteria | 4159 |
| 302 | Ga0207705_10028989 | 3300025909 | Bacteria | 3947 |
| 303 | Ga0207705_10037851 | 3300025909 | Bacteria | 3452 |
| 304 | Ga0207705_10069596 | 3300025909 | Bacteria | 2549 |
| 305 | Ga0207705_10082255 | 3300025909 | Bacteria | 2348 |
| 306 | Ga0207705_10235943 | 3300025909 | Bacteria | 1392 |
| 307 | Ga0207707_10023785 | 3300025912 | Bacteria | 5357 |
| 308 | Ga0207707_10040945 | 3300025912 | Bacteria | 4045 |
| 309 | Ga0207707_10057411 | 3300025912 | Bacteria | 3388 |
| 310 | Ga0207695_10056378 | 3300025913 | Bacteria | 4089 |
| 311 | Ga0207695_10070812 | 3300025913 | Bacteria | 3563 |
| 312 | Ga0207695_10365225 | 3300025913 | Bacteria | 1330 |
| 313 | Ga0207671_10079812 | 3300025914 | Bacteria | 2452 |
| 314 | Ga0207660_10001743 | 3300025917 | Bacteria | 14578 |
| 315 | Ga0207660_10004736 | 3300025917 | Bacteria | 8856 |
| 316 | Ga0207660_10006043 | 3300025917 | Bacteria | 7859 |
| 317 | Ga0207660_10012892 | 3300025917 | Bacteria | 5475 |
| 318 | Ga0207660_10086588 | 3300025917 | Bacteria | 2313 |
| 319 | Ga0207660_10099768 | 3300025917 | Bacteria | 2167 |
| 320 | Ga0207662_10004511 | 3300025918 | Bacteria | 7335 |
| 321 | Ga0207662_10216651 | 3300025918 | Bacteria | 1245 |
| 322 | Ga0207657_10001394 | 3300025919 | Bacteria | 25772 |
| 323 | Ga0207657_10004404 | 3300025919 | Bacteria | 14894 |
| 324 | Ga0207657_10011537 | 3300025919 | Bacteria | 8771 |
| 325 | Ga0207657_10011948 | 3300025919 | Bacteria | 8593 |
| 326 | Ga0207657_10012981 | 3300025919 | Bacteria | 8189 |
| 327 | Ga0207657_10015907 | 3300025919 | Bacteria | 7268 |
| 328 | Ga0207657_10019078 | 3300025919 | Bacteria | 6525 |
| 329 | Ga0207657_10019876 | 3300025919 | Bacteria | 6364 |
| 330 | Ga0207657_10023714 | 3300025919 | Bacteria | 5706 |
| 331 | Ga0207657_10038176 | 3300025919 | Bacteria | 4279 |
| 332 | Ga0207657_10039209 | 3300025919 | Bacteria | 4212 |
| 333 | Ga0207657_10042112 | 3300025919 | Bacteria | 4032 |
| 334 | Ga0207657_10143192 | 3300025919 | Bacteria | 1952 |
| 335 | Ga0207649_10015900 | 3300025920 | Bacteria | 4232 |
| 336 | Ga0207649_10025413 | 3300025920 | Bacteria | 3452 |
| 337 | Ga0207649_10044076 | 3300025920 | Bacteria | 2730 |
| 338 | Ga0207649_10066421 | 3300025920 | Bacteria | 2286 |
| 339 | Ga0207652_10010516 | 3300025921 | Bacteria | 7446 |
| 340 | Ga0207652_10040482 | 3300025921 | Bacteria | 3958 |
| 341 | Ga0207652_10183828 | 3300025921 | Bacteria | 1879 |
| 342 | Ga0207652_10264398 | 3300025921 | Bacteria | 1552 |
| 343 | Ga0207652_10499115 | 3300025921 | Bacteria | 1096 |
| 344 | Ga0207681_10012914 | 3300025923 | Bacteria | 5164 |
| 345 | Ga0207681_10017563 | 3300025923 | Bacteria | 4494 |
| 346 | Ga0207681_10078038 | 3300025923 | Bacteria | 2330 |
| 347 | Ga0207694_10189953 | 3300025924 | Bacteria | 1668 |
| 348 | Ga0207650_10135642 | 3300025925 | Bacteria | 1930 |
| 349 | Ga0207650_10145563 | 3300025925 | Bacteria | 1866 |
| 350 | Ga0207659_10020099 | 3300025926 | Bacteria | 4407 |
| 351 | Ga0207687_10003966 | 3300025927 | Bacteria | 9916 |
| 352 | Ga0207687_10032988 | 3300025927 | Bacteria | 3510 |
| 353 | Ga0207687_10128836 | 3300025927 | Bacteria | 1904 |
| 354 | Ga0207687_10188842 | 3300025927 | Bacteria | 1602 |
| 355 | Ga0207664_10034793 | 3300025929 | Bacteria | 3883 |
| 356 | Ga0207644_10000153 | 3300025931 | Bacteria | 49585 |
| 357 | Ga0207644_10004564 | 3300025931 | Bacteria | 9003 |
| 358 | Ga0207644_10020800 | 3300025931 | Bacteria | 4463 |
| 359 | Ga0207644_10023167 | 3300025931 | Bacteria | 4249 |
| 360 | Ga0207644_10023234 | 3300025931 | Bacteria | 4244 |
| 361 | Ga0207644_10072573 | 3300025931 | Bacteria | 2521 |
| 362 | Ga0207690_10000005 | 3300025932 | Bacteria | 581199 |
| 363 | Ga0207690_10013795 | 3300025932 | Bacteria | 4866 |
| 364 | Ga0207690_10021169 | 3300025932 | Bacteria | 4028 |
| 365 | Ga0207690_10037993 | 3300025932 | Bacteria | 3130 |
| 366 | Ga0207690_10069543 | 3300025932 | Bacteria | 2422 |
| 367 | Ga0207690_10118311 | 3300025932 | Bacteria | 1920 |
| 368 | Ga0207690_10165112 | 3300025932 | Bacteria | 1654 |
| 369 | Ga0207706_10002737 | 3300025933 | Bacteria | 17167 |
| 370 | Ga0207706_10009999 | 3300025933 | Bacteria | 8694 |
| 371 | Ga0207706_10010165 | 3300025933 | Bacteria | 8614 |
| 372 | Ga0207706_10014148 | 3300025933 | Bacteria | 7233 |
| 373 | Ga0207706_10027134 | 3300025933 | Bacteria | 5122 |
| 374 | Ga0207706_10053170 | 3300025933 | Bacteria | 3575 |
| 375 | Ga0207706_10139024 | 3300025933 | Bacteria | 2136 |
| 376 | Ga0207706_10244373 | 3300025933 | Bacteria | 1569 |
| 377 | Ga0207709_10196004 | 3300025935 | Bacteria | 1439 |
| 378 | Ga0207670_10122572 | 3300025936 | Bacteria | 1892 |
| 379 | Ga0207669_10053892 | 3300025937 | Bacteria | 2426 |
| 380 | Ga0207669_10062607 | 3300025937 | Bacteria | 2292 |
| 381 | Ga0207669_10085336 | 3300025937 | Bacteria | 2038 |
| 382 | Ga0207704_10005375 | 3300025938 | Bacteria | 5904 |
| 383 | Ga0207704_10008678 | 3300025938 | Bacteria | 4874 |
| 384 | Ga0207691_10004092 | 3300025940 | Bacteria | 14155 |
| 385 | Ga0207691_10010479 | 3300025940 | Bacteria | 8892 |
| 386 | Ga0207691_10029187 | 3300025940 | Bacteria | 5160 |
| 387 | Ga0207691_10060016 | 3300025940 | Bacteria | 3457 |
| 388 | Ga0207691_10077274 | 3300025940 | Bacteria | 2999 |
| 389 | Ga0207691_10098652 | 3300025940 | Bacteria | 2609 |
| 390 | Ga0207711_10007169 | 3300025941 | Bacteria | 9346 |
| 391 | Ga0207711_10008538 | 3300025941 | Bacteria | 8569 |
| 392 | Ga0207711_10020375 | 3300025941 | Bacteria | 5528 |
| 393 | Ga0207711_10020755 | 3300025941 | Bacteria | 5481 |
| 394 | Ga0207711_10023811 | 3300025941 | Bacteria | 5126 |
| 395 | Ga0207689_10000092 | 3300025942 | Bacteria | 73254 |
| 396 | Ga0207689_10023438 | 3300025942 | Bacteria | 5181 |
| 397 | Ga0207689_10027769 | 3300025942 | Bacteria | 4736 |
| 398 | Ga0207661_10009424 | 3300025944 | Bacteria | 7003 |
| 399 | Ga0207661_10202318 | 3300025944 | Bacteria | 1746 |
| 400 | Ga0207661_10359845 | 3300025944 | Bacteria | 1314 |
| 401 | Ga0207679_10002819 | 3300025945 | Bacteria | 10783 |
| 402 | Ga0207679_10082288 | 3300025945 | Bacteria | 2464 |
| 403 | Ga0207679_10423381 | 3300025945 | Bacteria | 1176 |
| 404 | Ga0207667_10006268 | 3300025949 | Bacteria | 14436 |
| 405 | Ga0207667_10025488 | 3300025949 | Bacteria | 6470 |
| 406 | Ga0207667_10048537 | 3300025949 | Bacteria | 4488 |
| 407 | Ga0207667_10082593 | 3300025949 | Bacteria | 3328 |
| 408 | Ga0207667_10112286 | 3300025949 | Bacteria | 2810 |
| 409 | Ga0207667_10198370 | 3300025949 | Bacteria | 2059 |
| 410 | Ga0207667_10283539 | 3300025949 | Bacteria | 1693 |
| 411 | Ga0207651_10002376 | 3300025960 | Bacteria | 8982 |
| 412 | Ga0207651_10003515 | 3300025960 | Bacteria | 7701 |
| 413 | Ga0207651_10012776 | 3300025960 | Bacteria | 4770 |
| 414 | Ga0207651_10018449 | 3300025960 | Bacteria | 4153 |
| 415 | Ga0207651_10062913 | 3300025960 | Bacteria | 2588 |
| 416 | Ga0207712_10000071 | 3300025961 | Bacteria | 124606 |
| 417 | Ga0207668_10000080 | 3300025972 | Bacteria | 72198 |
| 418 | Ga0207668_10004761 | 3300025972 | Bacteria | 7988 |
| 419 | Ga0207640_10002379 | 3300025981 | Bacteria | 10073 |
| 420 | Ga0207640_10007257 | 3300025981 | Bacteria | 6114 |
| 421 | Ga0207640_10015780 | 3300025981 | Bacteria | 4379 |
| 422 | Ga0207640_10117183 | 3300025981 | Bacteria | 1900 |
| 423 | Ga0207640_10149232 | 3300025981 | Bacteria | 1715 |
| 424 | Ga0207658_10001711 | 3300025986 | Bacteria | 16642 |
| 425 | Ga0207658_10006240 | 3300025986 | Bacteria | 8144 |
| 426 | Ga0207658_10014044 | 3300025986 | Bacteria | 5481 |
| 427 | Ga0207658_10032329 | 3300025986 | Bacteria | 3723 |
| 428 | Ga0207658_10050772 | 3300025986 | Bacteria | 3053 |
| 429 | Ga0207658_10078927 | 3300025986 | Bacteria | 2517 |
| 430 | Ga0207677_10000029 | 3300026023 | Bacteria | 121521 |
| 431 | Ga0207677_10000733 | 3300026023 | Bacteria | 19151 |
| 432 | Ga0207677_10063023 | 3300026023 | Bacteria | 2575 |
| 433 | Ga0207677_10122028 | 3300026023 | Bacteria | 1962 |
| 434 | Ga0207703_10000515 | 3300026035 | Bacteria | 39972 |
| 435 | Ga0207703_10017291 | 3300026035 | Bacteria | 5629 |
| 436 | Ga0207703_10063513 | 3300026035 | Bacteria | 3028 |
| 437 | Ga0207639_10017222 | 3300026041 | Bacteria | 5123 |
| 438 | Ga0207639_10060980 | 3300026041 | Bacteria | 2911 |
| 439 | Ga0207639_10063498 | 3300026041 | Bacteria | 2860 |
| 440 | Ga0207639_10080287 | 3300026041 | Bacteria | 2580 |
| 441 | Ga0207678_10004875 | 3300026067 | Bacteria | 12048 |
| 442 | Ga0207678_10007245 | 3300026067 | Bacteria | 9837 |
| 443 | Ga0207678_10059335 | 3300026067 | Bacteria | 3292 |
| 444 | Ga0207678_10063839 | 3300026067 | Bacteria | 3165 |
| 445 | Ga0207678_10094578 | 3300026067 | Bacteria | 2553 |
| 446 | Ga0207678_10143803 | 3300026067 | Bacteria | 2036 |
| 447 | Ga0207678_10188008 | 3300026067 | Bacteria | 1764 |
| 448 | Ga0207678_10237001 | 3300026067 | Bacteria | 1562 |
| 449 | Ga0207678_10307811 | 3300026067 | Bacteria | 1362 |
| 450 | Ga0207702_10028488 | 3300026078 | Bacteria | 4643 |
| 451 | Ga0207702_10087179 | 3300026078 | Bacteria | 2724 |
| 452 | Ga0207702_10159413 | 3300026078 | Bacteria | 2060 |
| 453 | Ga0207702_10242035 | 3300026078 | Bacteria | 1691 |
| 454 | Ga0207702_10399481 | 3300026078 | Bacteria | 1325 |
| 455 | Ga0207641_10010778 | 3300026088 | Bacteria | 7493 |
| 456 | Ga0207641_10014516 | 3300026088 | Bacteria | 6456 |
| 457 | Ga0207641_10047927 | 3300026088 | Bacteria | 3605 |
| 458 | Ga0207641_10059137 | 3300026088 | Bacteria | 3263 |
| 459 | Ga0207648_10002626 | 3300026089 | Bacteria | 19234 |
| 460 | Ga0207648_10006757 | 3300026089 | Bacteria | 11374 |
| 461 | Ga0207648_10018279 | 3300026089 | Bacteria | 6350 |
| 462 | Ga0207648_10018472 | 3300026089 | Bacteria | 6311 |
| 463 | Ga0207648_10029114 | 3300026089 | Bacteria | 4897 |
| 464 | Ga0207676_10003682 | 3300026095 | Bacteria | 10834 |
| 465 | Ga0207676_10005853 | 3300026095 | Bacteria | 8684 |
| 466 | Ga0207676_10011738 | 3300026095 | Bacteria | 6263 |
| 467 | Ga0207676_10129511 | 3300026095 | Bacteria | 2143 |
| 468 | Ga0207674_10001784 | 3300026116 | Bacteria | 27499 |
| 469 | Ga0207674_10002505 | 3300026116 | Bacteria | 23159 |
| 470 | Ga0207674_10003685 | 3300026116 | Bacteria | 18697 |
| 471 | Ga0207674_10018948 | 3300026116 | Bacteria | 7461 |
| 472 | Ga0207674_10021860 | 3300026116 | Bacteria | 6883 |
| 473 | Ga0207674_10034021 | 3300026116 | Bacteria | 5331 |
| 474 | Ga0207674_10153166 | 3300026116 | Bacteria | 2262 |
| 475 | Ga0207675_100160948 | 3300026118 | Bacteria | 2141 |
| 476 | Ga0207683_10003191 | 3300026121 | Bacteria | 14300 |
| 477 | Ga0207683_10050341 | 3300026121 | Bacteria | 3649 |
| 478 | Ga0207683_10082985 | 3300026121 | Bacteria | 2848 |
| 479 | Ga0207698_10005458 | 3300026142 | Bacteria | 7863 |
| 480 | Ga0207698_10017741 | 3300026142 | Bacteria | 4837 |
| 481 | Ga0207698_10022833 | 3300026142 | Bacteria | 4359 |
| 482 | Ga0207698_10045685 | 3300026142 | Bacteria | 3301 |
| 483 | Ga0207698_10177794 | 3300026142 | Bacteria | 1881 |
| 484 | Ga0268266_10000433 | 3300028379 | Bacteria | 62887 |
| 485 | Ga0268266_10005198 | 3300028379 | Bacteria | 12252 |
| 486 | Ga0268266_10012721 | 3300028379 | Bacteria | 7272 |
| 487 | Ga0268266_10063100 | 3300028379 | Bacteria | 3198 |
| 488 | Ga0268266_10176012 | 3300028379 | Bacteria | 1945 |
| 489 | Ga0268265_10002272 | 3300028380 | Bacteria | 14633 |
| 490 | Ga0268264_10002562 | 3300028381 | Bacteria | 15931 |
| 491 | Ga0268264_10003515 | 3300028381 | Bacteria | 13504 |
| 492 | Ga0265332_10000775 | 3300031238 | Bacteria | 19591 |
| 493 | Ga0265340_10003476 | 3300031247 | Bacteria | 8877 |
| 494 | Ga0265339_10000776 | 3300031249 | Bacteria | 24705 |
| 495 | Ga0307408_100043360 | 3300031548 | Bacteria | 3201 |
| 496 | Ga0265314_10037206 | 3300031711 | Bacteria | 3529 |
| 497 | Ga0265342_10000364 | 3300031712 | Bacteria | 50013 |
| 498 | Ga0307413_10064011 | 3300031824 | Bacteria | 2283 |
| 499 | Ga0307410_10011339 | 3300031852 | Bacteria | 5093 |
| 500 | Ga0307406_10043320 | 3300031901 | Bacteria | 2814 |
| 501 | Ga0307412_10091776 | 3300031911 | Bacteria | 2127 |
| 502 | Ga0307409_100005874 | 3300031995 | Bacteria | 7128 |
| 503 | Ga0307409_100024886 | 3300031995 | Bacteria | 4186 |
| 504 | Ga0307416_100083426 | 3300032002 | Bacteria | 2711 |
| 505 | Ga0307414_10069185 | 3300032004 | Bacteria | 2537 |
| 506 | Ga0307414_10072168 | 3300032004 | Bacteria | 2493 |
| 507 | Ga0307411_10021693 | 3300032005 | Bacteria | 3764 |
| 508 | Ga0307415_100054113 | 3300032126 | Bacteria | 2738 |
| 509 | Ga0373954_0008884 | 3300035118 | Bacteria | 4422 |
| 510 | Ga0373955_0004137 | 3300035172 | Bacteria | 6402 |
| 511 | Ga0373935_0005904 | 3300035692 | Bacteria | 7255 |
| 512 | Ga0373933_0040092 | 3300035724 | Bacteria | 2757 |
| 513 | Ga0373925_0010559 | 3300037068 | Bacteria | 6696 |
| 514 | Ga0395899_0016904 | 3300037312 | Bacteria | 5561 |
| 515 | Ga0395899_0017289 | 3300037312 | Bacteria | 5495 |
| 516 | Ga0395899_0035672 | 3300037312 | Bacteria | 3732 |
| 517 | Ga0395899_0049097 | 3300037312 | Bacteria | 3138 |
| 518 | Ga0395899_0072741 | 3300037312 | Bacteria | 2515 |
| 519 | Ga0395900_0012032 | 3300037418 | Bacteria | 8844 |
| 520 | Ga0395900_0054909 | 3300037418 | Bacteria | 4101 |
| 521 | Ga0395900_0065541 | 3300037418 | Bacteria | 3732 |
| 522 | Ga0395900_0070302 | 3300037418 | Bacteria | 3599 |
| 523 | Ga0395900_0089615 | 3300037418 | Bacteria | 3161 |
| 524 | Ga0395900_0095674 | 3300037418 | Bacteria | 3051 |
| 525 | Ga0395900_0166232 | 3300037418 | Bacteria | 2248 |
| 526 | Ga0395900_0187842 | 3300037418 | Bacteria | 2097 |
| 527 | Ga0395898_0022042 | 3300037466 | Bacteria | 6452 |
| 528 | Ga0395898_0026382 | 3300037466 | Bacteria | 5846 |
| 529 | Ga0395898_0036165 | 3300037466 | Bacteria | 4905 |
| 530 | Ga0395905_0004302 | 3300037471 | Bacteria | 14848 |
| 531 | Ga0395905_0018718 | 3300037471 | Bacteria | 6570 |
| 532 | Ga0395905_0028923 | 3300037471 | Bacteria | 5224 |
| 533 | Ga0395905_0037380 | 3300037471 | Bacteria | 4558 |
| 534 | Ga0395905_0037569 | 3300037471 | Bacteria | 4545 |
| 535 | Ga0395905_0053843 | 3300037471 | Bacteria | 3765 |
| 536 | Ga0395905_0064154 | 3300037471 | Bacteria | 3436 |
| 537 | Ga0395905_0066420 | 3300037471 | Bacteria | 3378 |
| 538 | Ga0395905_0075397 | 3300037471 | Bacteria | 3161 |
| 539 | Ga0395905_0093567 | 3300037471 | Bacteria | 2819 |
| 540 | Ga0395905_0113870 | 3300037471 | Bacteria | 2541 |
| 541 | Ga0395905_0169875 | 3300037471 | Bacteria | 2048 |
| 542 | Ga0395905_0189345 | 3300037471 | Bacteria | 1930 |
| 543 | Ga0395905_0251675 | 3300037471 | Bacteria | 1650 |
| 544 | Ga0395905_0373658 | 3300037471 | Bacteria | 1319 |
| 545 | Ga0395901_0015055 | 3300038443 | Bacteria | 7865 |
| 546 | Ga0395901_0048641 | 3300038443 | Bacteria | 4404 |
| 547 | Ga0395901_0070373 | 3300038443 | Bacteria | 3645 |
| 548 | Ga0395901_0089415 | 3300038443 | Bacteria | 3223 |
| 549 | Ga0395901_0184946 | 3300038443 | Bacteria | 2185 |
| 550 | Ga0395901_0211793 | 3300038443 | Bacteria | 2028 |
| 551 | Ga0395901_0395488 | 3300038443 | Bacteria | 1420 |
| 552 | Ga0436365_1526629 | 3300039437 | Bacteria | 2994 |
| 553 | Ga0436363_1232640 | 3300039450 | Bacteria | 11059 |
| 554 | Ga0466961_0037195 | 3300044693 | Bacteria | 3123 |
| 555 | Ga0466963_0018676 | 3300044694 | Bacteria | 4339 |
| 556 | Ga0466963_0035719 | 3300044694 | Bacteria | 3239 |
| 557 | Ga0466963_0106239 | 3300044694 | Bacteria | 1925 |
| 558 | Ga0466963_0184899 | 3300044694 | Bacteria | 1455 |
| 559 | Ga0466957_0016211 | 3300044842 | Bacteria | 4357 |
| 560 | Ga0466957_0095653 | 3300044842 | Bacteria | 1866 |
| 561 | Ga0466958_0199101 | 3300045836 | Bacteria | 1274 |
| 562 | Ga0466967_0144153 | 3300045976 | Bacteria | 2221 |
| 563 | Ga0466967_0253731 | 3300045976 | Bacteria | 1681 |
| 564 | Ga0495663_0003309 | 3300046525 | Bacteria | 4668 |
| 565 | Ga0495598_0003508 | 3300046537 | Bacteria | 3341 |
| 566 | Ga0495621_0000094 | 3300046539 | Bacteria | 18073 |
| 567 | Ga0495621_0043596 | 3300046539 | Bacteria | 1583 |
| 568 | Ga0495668_0087038 | 3300046616 | Bacteria | 1713 |
| 569 | Ga0495669_0000617 | 3300046684 | Bacteria | 15486 |
| 570 | Ga0495669_0008270 | 3300046684 | Bacteria | 4369 |
| 571 | Ga0495669_0008952 | 3300046684 | Bacteria | 4217 |
| 572 | Ga0495669_0035828 | 3300046684 | Bacteria | 2192 |
| 573 | Ga0495670_0004793 | 3300046691 | Bacteria | 6642 |
| 574 | Ga0495677_0003141 | 3300047445 | Bacteria | 6439 |
| 575 | Ga0495685_010289 | 3300047447 | Bacteria | 3135 |
| 576 | Ga0495602_0024600 | 3300048088 | Bacteria | 5841 |
| 577 | Ga0496100_0004507 | 3300048903 | Bacteria | 7392 |
| 578 | Ga0496101_0000589 | 3300048904 | Bacteria | 22135 |
| 579 | Ga0496101_0055076 | 3300048904 | Bacteria | 2872 |
| 580 | Ga0496101_0123775 | 3300048904 | Bacteria | 1957 |
| 581 | Ga0496103_0032088 | 3300048906 | Bacteria | 3204 |
| 582 | Ga0496103_0050519 | 3300048906 | Bacteria | 2572 |
| 583 | Ga0496104_0011224 | 3300048907 | Bacteria | 8018 |
| 584 | Ga0496104_0360524 | 3300048907 | Bacteria | 1366 |
| 585 | Ga0496105_0010283 | 3300048908 | Bacteria | 7355 |
| 586 | Ga0496106_0007644 | 3300048909 | Bacteria | 7995 |
| 587 | Ga0496106_0023948 | 3300048909 | Bacteria | 4537 |
| 588 | Ga0496107_0000429 | 3300048910 | Bacteria | 22785 |
| 589 | Ga0496107_0000990 | 3300048910 | Bacteria | 16900 |
| 590 | Ga0496108_0005046 | 3300048911 | Bacteria | 10663 |
| 591 | Ga0496108_0012375 | 3300048911 | Bacteria | 6943 |
| 592 | Ga0496108_0036270 | 3300048911 | Bacteria | 4102 |
| 593 | Ga0496109_0009634 | 3300048912 | Bacteria | 8240 |
| 594 | Ga0496109_0038803 | 3300048912 | Bacteria | 4307 |
| 595 | Ga0496109_0064365 | 3300048912 | Bacteria | 3355 |
| 596 | Ga0496110_0011777 | 3300048913 | Bacteria | 7178 |
| 597 | Ga0496110_0012497 | 3300048913 | Bacteria | 6983 |
| 598 | Ga0496110_0036060 | 3300048913 | Bacteria | 4293 |
| 599 | Ga0496110_0231641 | 3300048913 | Bacteria | 1680 |
| 600 | Ga0496111_0000459 | 3300048914 | Bacteria | 20678 |
| 601 | Ga0496111_0008661 | 3300048914 | Bacteria | 6747 |
| 602 | Ga0496111_0298917 | 3300048914 | Bacteria | 1193 |
| 603 | Ga0496112_0000707 | 3300048915 | Bacteria | 23147 |
| 604 | Ga0496112_0002279 | 3300048915 | Bacteria | 15342 |
| 605 | Ga0496112_0034103 | 3300048915 | Bacteria | 4952 |
| 606 | Ga0496112_0084543 | 3300048915 | Bacteria | 3138 |
| 607 | Ga0496112_0282443 | 3300048915 | Bacteria | 1607 |
| 608 | Ga0496113_0000431 | 3300048916 | Bacteria | 20368 |
| 609 | Ga0496113_0005916 | 3300048916 | Bacteria | 7684 |
| 610 | Ga0496113_0073611 | 3300048916 | Bacteria | 2603 |
| 611 | Ga0496114_0036791 | 3300048917 | Bacteria | 4047 |
| 612 | Ga0496114_0060031 | 3300048917 | Bacteria | 3178 |
| 613 | Ga0496115_0010000 | 3300048918 | Bacteria | 7068 |
| 614 | Ga0501031_0028698 | 3300049568 | Bacteria | 3628 |
| 615 | Ga0501038_0075687 | 3300049574 | Bacteria | 2845 |
| 616 | Ga0501039_0056958 | 3300049575 | Bacteria | 3028 |
| 617 | Ga0501042_0011580 | 3300049578 | Bacteria | 5956 |
| 618 | Ga0501046_0093230 | 3300049580 | Bacteria | 2315 |
| 619 | Ga0501072_0068526 | 3300049588 | Bacteria | 2801 |
| 620 | Ga0501076_0068148 | 3300049592 | Bacteria | 2842 |
| 621 | Ga0501079_0174090 | 3300049741 | Bacteria | 1678 |
| 622 | Ga0501080_0414030 | 3300049742 | Bacteria | 1212 |
| 623 | Ga0501045_0003734 | 3300049824 | Bacteria | 10473 |
| 624 | nmdc:mga0n895_21729_c1 | 3300050512 | Bacteria | 6006 |
| 625 | nmdc:mga08x19_19513_c1 | 3300050514 | Bacteria | 4161 |
| 626 | nmdc:mga0a205_1020_c1 | 3300050515 | Bacteria | 23290 |
| 627 | Ga0500643_000244 | 3300053087 | Bacteria | 49957 |
| 628 | Ga0500658_0000152 | 3300053134 | Bacteria | 33101 |
| 629 | Ga0501082_0054646 | 3300060353 | Bacteria | 3442 |
| 630 | Ga0530510_0117834 | 3300061734 | Bacteria | 1948 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049741 | Ga0501079_0174090 | Ga0501079_0174090_11_961 | 291 |
| 2 | 3300026118 | Ga0207675_100160948 | Ga0207675_1001609482 | 294 |
| 3 | 3300035118 | Ga0373954_0008884 | Ga0373954_0008884_438_1361 | 302 |
| 4 | 3300037312 | Ga0395899_0072741 | Ga0395899_0072741_1119_2111 | 312 |
| 5 | 3300037471 | Ga0395905_0028923 | Ga0395905_0028923_4092_5084 | 312 |
| 6 | 3300005347 | Ga0070668_100006318 | Ga0070668_1000063185 | 315 |
| 7 | 3300031238 | Ga0265332_10000775 | Ga0265332_100007754 | 319 |
| 8 | 3300031247 | Ga0265340_10003476 | Ga0265340_100034763 | 319 |
| 9 | 3300031249 | Ga0265339_10000776 | Ga0265339_100007769 | 319 |
| 10 | 3300031711 | Ga0265314_10037206 | Ga0265314_100372062 | 319 |
| 11 | 3300031712 | Ga0265342_10000364 | Ga0265342_1000036421 | 319 |
| 12 | 3300009553 | Ga0105249_10000023 | Ga0105249_1000002375 | 320 |
| 13 | 3300013105 | Ga0157369_10031227 | Ga0157369_100312275 | 320 |
| 14 | 3300025961 | Ga0207712_10000071 | Ga0207712_1000007193 | 320 |
| 15 | 3300025972 | Ga0207668_10004761 | Ga0207668_100047616 | 320 |
| 16 | 3300028379 | Ga0268266_10176012 | Ga0268266_101760122 | 320 |
| 17 | 3300038443 | Ga0395901_0070373 | Ga0395901_0070373_2512_3504 | 320 |
| 18 | 3300005336 | Ga0070680_100033815 | Ga0070680_1000338152 | 323 |
| 19 | 3300025917 | Ga0207660_10086588 | Ga0207660_100865883 | 323 |
| 20 | 3300025919 | Ga0207657_10011537 | Ga0207657_100115376 | 323 |
| 21 | 3300025929 | Ga0207664_10034793 | Ga0207664_100347931 | 323 |
| 22 | 3300009098 | Ga0105245_10011149 | Ga0105245_100111495 | 324 |
| 23 | 3300025927 | Ga0207687_10003966 | Ga0207687_100039665 | 324 |
| 24 | 3300039437 | Ga0436365_1526629 | Ga0436365_1526629_791_1792 | 324 |
| 25 | 3300005364 | Ga0070673_100287821 | Ga0070673_1002878212 | 326 |
| 26 | 3300005543 | Ga0070672_100023111 | Ga0070672_1000231113 | 326 |
| 27 | 3300025923 | Ga0207681_10078038 | Ga0207681_100780382 | 326 |
| 28 | 3300035172 | Ga0373955_0004137 | Ga0373955_0004137_3854_4879 | 326 |
| 29 | 3300035724 | Ga0373933_0040092 | Ga0373933_0040092_673_1698 | 326 |
| 30 | 3300048088 | Ga0495602_0024600 | Ga0495602_0024600_1170_2195 | 326 |
| 31 | 3300005338 | Ga0068868_100000042 | Ga0068868_10000004238 | 327 |
| 32 | 3300005339 | Ga0070660_100000546 | Ga0070660_10000054628 | 327 |
| 33 | 3300005354 | Ga0070675_100019689 | Ga0070675_1000196894 | 327 |
| 34 | 3300005366 | Ga0070659_100000011 | Ga0070659_10000001160 | 327 |
| 35 | 3300025919 | Ga0207657_10001394 | Ga0207657_1000139412 | 327 |
| 36 | 3300025926 | Ga0207659_10020099 | Ga0207659_100200994 | 327 |
| 37 | 3300025927 | Ga0207687_10032988 | Ga0207687_100329883 | 327 |
| 38 | 3300025932 | Ga0207690_10000005 | Ga0207690_10000005148 | 327 |
| 39 | 3300026023 | Ga0207677_10000029 | Ga0207677_1000002939 | 327 |
| 40 | 3300039450 | Ga0436363_1232640 | Ga0436363_1232640_2912_4081 | 327 |
| 41 | 3300005336 | Ga0070680_100038536 | Ga0070680_1000385362 | 328 |
| 42 | 3300005340 | Ga0070689_100017804 | Ga0070689_1000178045 | 328 |
| 43 | 3300005343 | Ga0070687_100001117 | Ga0070687_1000011172 | 328 |
| 44 | 3300005344 | Ga0070661_100084006 | Ga0070661_1000840061 | 328 |
| 45 | 3300005353 | Ga0070669_100005434 | Ga0070669_1000054349 | 328 |
| 46 | 3300005354 | Ga0070675_100126534 | Ga0070675_1001265343 | 328 |
| 47 | 3300005365 | Ga0070688_100012116 | Ga0070688_1000121163 | 328 |
| 48 | 3300005435 | Ga0070714_100008702 | Ga0070714_1000087024 | 328 |
| 49 | 3300005455 | Ga0070663_100301449 | Ga0070663_1003014491 | 328 |
| 50 | 3300005458 | Ga0070681_10048504 | Ga0070681_100485044 | 328 |
| 51 | 3300005458 | Ga0070681_10057143 | Ga0070681_100571432 | 328 |
| 52 | 3300005530 | Ga0070679_100005895 | Ga0070679_1000058959 | 328 |
| 53 | 3300005530 | Ga0070679_100010802 | Ga0070679_1000108027 | 328 |
| 54 | 3300005535 | Ga0070684_100059342 | Ga0070684_1000593424 | 328 |
| 55 | 3300005539 | Ga0068853_100025273 | Ga0068853_1000252732 | 328 |
| 56 | 3300005614 | Ga0068856_100304888 | Ga0068856_1003048881 | 328 |
| 57 | 3300005617 | Ga0068859_100008573 | Ga0068859_1000085739 | 328 |
| 58 | 3300005840 | Ga0068870_10003492 | Ga0068870_100034927 | 328 |
| 59 | 3300006914 | Ga0075436_100011065 | Ga0075436_1000110652 | 328 |
| 60 | 3300006931 | Ga0097620_100008573 | Ga0097620_1000085739 | 328 |
| 61 | 3300007076 | Ga0075435_100000282 | Ga0075435_10000028230 | 328 |
| 62 | 3300009093 | Ga0105240_10133554 | Ga0105240_101335543 | 328 |
| 63 | 3300009094 | Ga0111539_10201634 | Ga0111539_102016343 | 328 |
| 64 | 3300009551 | Ga0105238_10109872 | Ga0105238_101098722 | 328 |
| 65 | 3300013105 | Ga0157369_10152062 | Ga0157369_101520622 | 328 |
| 66 | 3300013307 | Ga0157372_10015728 | Ga0157372_100157286 | 328 |
| 67 | 3300014497 | Ga0182008_10003649 | Ga0182008_100036497 | 328 |
| 68 | 3300025893 | Ga0207682_10014169 | Ga0207682_100141692 | 328 |
| 69 | 3300025908 | Ga0207643_10015983 | Ga0207643_100159833 | 328 |
| 70 | 3300025912 | Ga0207707_10023785 | Ga0207707_100237853 | 328 |
| 71 | 3300025913 | Ga0207695_10365225 | Ga0207695_103652252 | 328 |
| 72 | 3300025917 | Ga0207660_10012892 | Ga0207660_100128924 | 328 |
| 73 | 3300025918 | Ga0207662_10004511 | Ga0207662_100045116 | 328 |
| 74 | 3300025921 | Ga0207652_10010516 | Ga0207652_100105163 | 328 |
| 75 | 3300025924 | Ga0207694_10189953 | Ga0207694_101899532 | 328 |
| 76 | 3300025932 | Ga0207690_10037993 | Ga0207690_100379932 | 328 |
| 77 | 3300025936 | Ga0207670_10122572 | Ga0207670_101225722 | 328 |
| 78 | 3300025960 | Ga0207651_10062913 | Ga0207651_100629133 | 328 |
| 79 | 3300026067 | Ga0207678_10188008 | Ga0207678_101880082 | 328 |
| 80 | 3300026067 | Ga0207678_10307811 | Ga0207678_103078111 | 328 |
| 81 | 3300026078 | Ga0207702_10399481 | Ga0207702_103994812 | 328 |
| 82 | 3300047447 | Ga0495685_010289 | Ga0495685_010289_603_1637 | 328 |
| 83 | 3300049568 | Ga0501031_0028698 | Ga0501031_0028698_1876_2970 | 328 |
| 84 | 3300049574 | Ga0501038_0075687 | Ga0501038_0075687_688_1782 | 328 |
| 85 | 3300049575 | Ga0501039_0056958 | Ga0501039_0056958_518_1612 | 328 |
| 86 | 3300049578 | Ga0501042_0011580 | Ga0501042_0011580_3474_4568 | 328 |
| 87 | 3300049580 | Ga0501046_0093230 | Ga0501046_0093230_374_1468 | 328 |
| 88 | 3300049588 | Ga0501072_0068526 | Ga0501072_0068526_1256_2350 | 328 |
| 89 | 3300049592 | Ga0501076_0068148 | Ga0501076_0068148_1256_2350 | 328 |
| 90 | 3300049824 | Ga0501045_0003734 | Ga0501045_0003734_6475_7569 | 328 |
| 91 | 3300050512 | nmdc:mga0n895_21729_c1 | nmdc:mga0n895_21729_c1_3470_4513 | 328 |
| 92 | 3300050514 | nmdc:mga08x19_19513_c1 | nmdc:mga08x19_19513_c1_1886_2929 | 328 |
| 93 | 3300050515 | nmdc:mga0a205_1020_c1 | nmdc:mga0a205_1020_c1_10241_11284 | 328 |
| 94 | 3300060353 | Ga0501082_0054646 | Ga0501082_0054646_674_1768 | 328 |
| 95 | 3300061734 | Ga0530510_0117834 | Ga0530510_0117834_805_1899 | 328 |
| 96 | 3300005328 | Ga0070676_10016934 | Ga0070676_100169341 | 330 |
| 97 | 3300005543 | Ga0070672_100101715 | Ga0070672_1001017153 | 330 |
| 98 | 3300005614 | Ga0068856_100069910 | Ga0068856_1000699102 | 330 |
| 99 | 3300013104 | Ga0157370_10024458 | Ga0157370_100244583 | 330 |
| 100 | 3300013105 | Ga0157369_10062280 | Ga0157369_100622802 | 330 |
| 101 | 3300013308 | Ga0157375_10399009 | Ga0157375_103990092 | 330 |
| 102 | 3300025940 | Ga0207691_10098652 | Ga0207691_100986523 | 330 |
| 103 | 3300025986 | Ga0207658_10078927 | Ga0207658_100789271 | 330 |
| 104 | 3300026078 | Ga0207702_10159413 | Ga0207702_101594133 | 330 |
| 105 | 3300026116 | Ga0207674_10153166 | Ga0207674_101531661 | 330 |
| 106 | 3300037466 | Ga0395898_0036165 | Ga0395898_0036165_1637_2629 | 330 |
| 107 | 3300037471 | Ga0395905_0037380 | Ga0395905_0037380_3308_4300 | 330 |
| 108 | 3300038443 | Ga0395901_0395488 | Ga0395901_0395488_171_1163 | 330 |
| 109 | 3300048914 | Ga0496111_0298917 | Ga0496111_0298917_114_1106 | 330 |
| 110 | 3300001915 | JGI24741J21665_1008871 | JGI24741J21665_10088712 | 331 |
| 111 | 3300001979 | JGI24740J21852_10001441 | JGI24740J21852_100014418 | 331 |
| 112 | 3300001979 | JGI24740J21852_10003168 | JGI24740J21852_100031688 | 331 |
| 113 | 3300001979 | JGI24740J21852_10007705 | JGI24740J21852_100077055 | 331 |
| 114 | 3300001979 | JGI24740J21852_10023162 | JGI24740J21852_100231622 | 331 |
| 115 | 3300001989 | JGI24739J22299_10017852 | JGI24739J22299_100178523 | 331 |
| 116 | 3300001990 | JGI24737J22298_10000598 | JGI24737J22298_100005988 | 331 |
| 117 | 3300002067 | JGI24735J21928_10017359 | JGI24735J21928_100173592 | 331 |
| 118 | 3300002075 | JGI24738J21930_10000859 | JGI24738J21930_100008592 | 331 |
| 119 | 3300002075 | JGI24738J21930_10008928 | JGI24738J21930_100089281 | 331 |
| 120 | 3300005327 | Ga0070658_10065371 | Ga0070658_100653713 | 331 |
| 121 | 3300005327 | Ga0070658_10097078 | Ga0070658_100970782 | 331 |
| 122 | 3300005327 | Ga0070658_10132960 | Ga0070658_101329602 | 331 |
| 123 | 3300005327 | Ga0070658_10133665 | Ga0070658_101336652 | 331 |
| 124 | 3300005327 | Ga0070658_10163959 | Ga0070658_101639592 | 331 |
| 125 | 3300005327 | Ga0070658_10196848 | Ga0070658_101968482 | 331 |
| 126 | 3300005327 | Ga0070658_10297014 | Ga0070658_102970142 | 331 |
| 127 | 3300005328 | Ga0070676_10006115 | Ga0070676_100061153 | 331 |
| 128 | 3300005328 | Ga0070676_10046153 | Ga0070676_100461531 | 331 |
| 129 | 3300005328 | Ga0070676_10149558 | Ga0070676_101495582 | 331 |
| 130 | 3300005328 | Ga0070676_10229271 | Ga0070676_102292711 | 331 |
| 131 | 3300005329 | Ga0070683_100006593 | Ga0070683_1000065939 | 331 |
| 132 | 3300005329 | Ga0070683_100037350 | Ga0070683_1000373502 | 331 |
| 133 | 3300005329 | Ga0070683_100217928 | Ga0070683_1002179282 | 331 |
| 134 | 3300005330 | Ga0070690_100007695 | Ga0070690_1000076958 | 331 |
| 135 | 3300005330 | Ga0070690_100012729 | Ga0070690_1000127293 | 331 |
| 136 | 3300005331 | Ga0070670_100039761 | Ga0070670_1000397614 | 331 |
| 137 | 3300005331 | Ga0070670_100071915 | Ga0070670_1000719152 | 331 |
| 138 | 3300005334 | Ga0068869_100001036 | Ga0068869_1000010366 | 331 |
| 139 | 3300005334 | Ga0068869_100018329 | Ga0068869_1000183293 | 331 |
| 140 | 3300005334 | Ga0068869_100065208 | Ga0068869_1000652082 | 331 |
| 141 | 3300005335 | Ga0070666_10048340 | Ga0070666_100483402 | 331 |
| 142 | 3300005336 | Ga0070680_100005354 | Ga0070680_1000053545 | 331 |
| 143 | 3300005336 | Ga0070680_100008123 | Ga0070680_1000081239 | 331 |
| 144 | 3300005336 | Ga0070680_100211211 | Ga0070680_1002112112 | 331 |
| 145 | 3300005337 | Ga0070682_100024162 | Ga0070682_1000241622 | 331 |
| 146 | 3300005338 | Ga0068868_100000156 | Ga0068868_1000001564 | 331 |
| 147 | 3300005338 | Ga0068868_100013844 | Ga0068868_1000138447 | 331 |
| 148 | 3300005338 | Ga0068868_100153124 | Ga0068868_1001531242 | 331 |
| 149 | 3300005339 | Ga0070660_100027758 | Ga0070660_1000277582 | 331 |
| 150 | 3300005339 | Ga0070660_100043482 | Ga0070660_1000434823 | 331 |
| 151 | 3300005339 | Ga0070660_100047179 | Ga0070660_1000471794 | 331 |
| 152 | 3300005339 | Ga0070660_100184415 | Ga0070660_1001844152 | 331 |
| 153 | 3300005339 | Ga0070660_100236365 | Ga0070660_1002363651 | 331 |
| 154 | 3300005341 | Ga0070691_10006514 | Ga0070691_100065145 | 331 |
| 155 | 3300005344 | Ga0070661_100010302 | Ga0070661_1000103026 | 331 |
| 156 | 3300005344 | Ga0070661_100035953 | Ga0070661_1000359533 | 331 |
| 157 | 3300005344 | Ga0070661_100047447 | Ga0070661_1000474473 | 331 |
| 158 | 3300005344 | Ga0070661_100056937 | Ga0070661_1000569373 | 331 |
| 159 | 3300005344 | Ga0070661_100058421 | Ga0070661_1000584212 | 331 |
| 160 | 3300005344 | Ga0070661_100146677 | Ga0070661_1001466772 | 331 |
| 161 | 3300005344 | Ga0070661_100202387 | Ga0070661_1002023872 | 331 |
| 162 | 3300005344 | Ga0070661_100205878 | Ga0070661_1002058781 | 331 |
| 163 | 3300005345 | Ga0070692_10058971 | Ga0070692_100589713 | 331 |
| 164 | 3300005347 | Ga0070668_100002631 | Ga0070668_10000263110 | 331 |
| 165 | 3300005347 | Ga0070668_100406775 | Ga0070668_1004067751 | 331 |
| 166 | 3300005353 | Ga0070669_100000383 | Ga0070669_1000003837 | 331 |
| 167 | 3300005353 | Ga0070669_100101262 | Ga0070669_1001012622 | 331 |
| 168 | 3300005354 | Ga0070675_100020015 | Ga0070675_1000200152 | 331 |
| 169 | 3300005355 | Ga0070671_100005598 | Ga0070671_1000055983 | 331 |
| 170 | 3300005355 | Ga0070671_100007731 | Ga0070671_1000077319 | 331 |
| 171 | 3300005355 | Ga0070671_100045353 | Ga0070671_1000453533 | 331 |
| 172 | 3300005355 | Ga0070671_100046678 | Ga0070671_1000466784 | 331 |
| 173 | 3300005355 | Ga0070671_100175372 | Ga0070671_1001753722 | 331 |
| 174 | 3300005356 | Ga0070674_100002665 | Ga0070674_10000266510 | 331 |
| 175 | 3300005356 | Ga0070674_100053443 | Ga0070674_1000534434 | 331 |
| 176 | 3300005356 | Ga0070674_100076181 | Ga0070674_1000761812 | 331 |
| 177 | 3300005356 | Ga0070674_100083209 | Ga0070674_1000832093 | 331 |
| 178 | 3300005364 | Ga0070673_100004316 | Ga0070673_1000043166 | 331 |
| 179 | 3300005364 | Ga0070673_100026270 | Ga0070673_1000262703 | 331 |
| 180 | 3300005364 | Ga0070673_100041339 | Ga0070673_1000413392 | 331 |
| 181 | 3300005364 | Ga0070673_100045730 | Ga0070673_1000457303 | 331 |
| 182 | 3300005364 | Ga0070673_100051631 | Ga0070673_1000516311 | 331 |
| 183 | 3300005364 | Ga0070673_100352879 | Ga0070673_1003528791 | 331 |
| 184 | 3300005366 | Ga0070659_100001501 | Ga0070659_1000015014 | 331 |
| 185 | 3300005366 | Ga0070659_100029545 | Ga0070659_1000295455 | 331 |
| 186 | 3300005366 | Ga0070659_100053731 | Ga0070659_1000537312 | 331 |
| 187 | 3300005366 | Ga0070659_100092102 | Ga0070659_1000921024 | 331 |
| 188 | 3300005366 | Ga0070659_100097115 | Ga0070659_1000971152 | 331 |
| 189 | 3300005366 | Ga0070659_100160361 | Ga0070659_1001603612 | 331 |
| 190 | 3300005367 | Ga0070667_100001584 | Ga0070667_10000158420 | 331 |
| 191 | 3300005367 | Ga0070667_100012687 | Ga0070667_1000126873 | 331 |
| 192 | 3300005367 | Ga0070667_100041740 | Ga0070667_1000417404 | 331 |
| 193 | 3300005367 | Ga0070667_100050007 | Ga0070667_1000500073 | 331 |
| 194 | 3300005367 | Ga0070667_100108717 | Ga0070667_1001087172 | 331 |
| 195 | 3300005435 | Ga0070714_100092423 | Ga0070714_1000924234 | 331 |
| 196 | 3300005455 | Ga0070663_100013495 | Ga0070663_1000134956 | 331 |
| 197 | 3300005455 | Ga0070663_100081295 | Ga0070663_1000812952 | 331 |
| 198 | 3300005456 | Ga0070678_100022271 | Ga0070678_1000222714 | 331 |
| 199 | 3300005456 | Ga0070678_100260748 | Ga0070678_1002607482 | 331 |
| 200 | 3300005457 | Ga0070662_100002134 | Ga0070662_1000021343 | 331 |
| 201 | 3300005457 | Ga0070662_100021023 | Ga0070662_1000210234 | 331 |
| 202 | 3300005457 | Ga0070662_100026135 | Ga0070662_1000261354 | 331 |
| 203 | 3300005457 | Ga0070662_100056092 | Ga0070662_1000560922 | 331 |
| 204 | 3300005457 | Ga0070662_100060213 | Ga0070662_1000602133 | 331 |
| 205 | 3300005457 | Ga0070662_100117553 | Ga0070662_1001175533 | 331 |
| 206 | 3300005457 | Ga0070662_100251040 | Ga0070662_1002510402 | 331 |
| 207 | 3300005458 | Ga0070681_10158480 | Ga0070681_101584802 | 331 |
| 208 | 3300005459 | Ga0068867_100000388 | Ga0068867_10000038824 | 331 |
| 209 | 3300005459 | Ga0068867_100005540 | Ga0068867_1000055403 | 331 |
| 210 | 3300005459 | Ga0068867_100009725 | Ga0068867_1000097252 | 331 |
| 211 | 3300005459 | Ga0068867_100034181 | Ga0068867_1000341814 | 331 |
| 212 | 3300005530 | Ga0070679_100172126 | Ga0070679_1001721262 | 331 |
| 213 | 3300005530 | Ga0070679_100215316 | Ga0070679_1002153163 | 331 |
| 214 | 3300005530 | Ga0070679_100229370 | Ga0070679_1002293702 | 331 |
| 215 | 3300005530 | Ga0070679_100288909 | Ga0070679_1002889092 | 331 |
| 216 | 3300005535 | Ga0070684_100005655 | Ga0070684_1000056553 | 331 |
| 217 | 3300005535 | Ga0070684_100117642 | Ga0070684_1001176422 | 331 |
| 218 | 3300005539 | Ga0068853_100014239 | Ga0068853_1000142397 | 331 |
| 219 | 3300005539 | Ga0068853_100084028 | Ga0068853_1000840283 | 331 |
| 220 | 3300005539 | Ga0068853_100167147 | Ga0068853_1001671472 | 331 |
| 221 | 3300005539 | Ga0068853_100237927 | Ga0068853_1002379272 | 331 |
| 222 | 3300005543 | Ga0070672_100008121 | Ga0070672_1000081216 | 331 |
| 223 | 3300005543 | Ga0070672_100064227 | Ga0070672_1000642273 | 331 |
| 224 | 3300005543 | Ga0070672_100144836 | Ga0070672_1001448361 | 331 |
| 225 | 3300005544 | Ga0070686_100000034 | Ga0070686_10000003465 | 331 |
| 226 | 3300005544 | Ga0070686_100076685 | Ga0070686_1000766852 | 331 |
| 227 | 3300005547 | Ga0070693_100194529 | Ga0070693_1001945291 | 331 |
| 228 | 3300005548 | Ga0070665_100001571 | Ga0070665_10000157119 | 331 |
| 229 | 3300005548 | Ga0070665_100017906 | Ga0070665_1000179066 | 331 |
| 230 | 3300005548 | Ga0070665_100069451 | Ga0070665_1000694514 | 331 |
| 231 | 3300005548 | Ga0070665_100128935 | Ga0070665_1001289353 | 331 |
| 232 | 3300005548 | Ga0070665_100211064 | Ga0070665_1002110641 | 331 |
| 233 | 3300005563 | Ga0068855_100029810 | Ga0068855_1000298103 | 331 |
| 234 | 3300005563 | Ga0068855_100071375 | Ga0068855_1000713752 | 331 |
| 235 | 3300005564 | Ga0070664_100004853 | Ga0070664_1000048536 | 331 |
| 236 | 3300005564 | Ga0070664_100041440 | Ga0070664_1000414403 | 331 |
| 237 | 3300005564 | Ga0070664_100047218 | Ga0070664_1000472182 | 331 |
| 238 | 3300005564 | Ga0070664_100054244 | Ga0070664_1000542444 | 331 |
| 239 | 3300005564 | Ga0070664_100059187 | Ga0070664_1000591874 | 331 |
| 240 | 3300005577 | Ga0068857_100000282 | Ga0068857_1000002826 | 331 |
| 241 | 3300005577 | Ga0068857_100009874 | Ga0068857_1000098746 | 331 |
| 242 | 3300005577 | Ga0068857_100035736 | Ga0068857_1000357364 | 331 |
| 243 | 3300005577 | Ga0068857_100043250 | Ga0068857_1000432502 | 331 |
| 244 | 3300005577 | Ga0068857_100061074 | Ga0068857_1000610744 | 331 |
| 245 | 3300005578 | Ga0068854_100022246 | Ga0068854_1000222464 | 331 |
| 246 | 3300005578 | Ga0068854_100023719 | Ga0068854_1000237192 | 331 |
| 247 | 3300005578 | Ga0068854_100025824 | Ga0068854_1000258242 | 331 |
| 248 | 3300005578 | Ga0068854_100056622 | Ga0068854_1000566221 | 331 |
| 249 | 3300005578 | Ga0068854_100072701 | Ga0068854_1000727013 | 331 |
| 250 | 3300005578 | Ga0068854_100197695 | Ga0068854_1001976952 | 331 |
| 251 | 3300005614 | Ga0068856_100068244 | Ga0068856_1000682444 | 331 |
| 252 | 3300005614 | Ga0068856_100278972 | Ga0068856_1002789721 | 331 |
| 253 | 3300005616 | Ga0068852_100005199 | Ga0068852_1000051994 | 331 |
| 254 | 3300005616 | Ga0068852_100009120 | Ga0068852_1000091204 | 331 |
| 255 | 3300005616 | Ga0068852_100017311 | Ga0068852_1000173117 | 331 |
| 256 | 3300005616 | Ga0068852_100028391 | Ga0068852_1000283914 | 331 |
| 257 | 3300005616 | Ga0068852_100075039 | Ga0068852_1000750392 | 331 |
| 258 | 3300005616 | Ga0068852_100148075 | Ga0068852_1001480752 | 331 |
| 259 | 3300005617 | Ga0068859_100025449 | Ga0068859_1000254492 | 331 |
| 260 | 3300005617 | Ga0068859_100035482 | Ga0068859_1000354824 | 331 |
| 261 | 3300005617 | Ga0068859_100069590 | Ga0068859_1000695904 | 331 |
| 262 | 3300005617 | Ga0068859_100132974 | Ga0068859_1001329743 | 331 |
| 263 | 3300005617 | Ga0068859_100148580 | Ga0068859_1001485802 | 331 |
| 264 | 3300005618 | Ga0068864_100012719 | Ga0068864_1000127195 | 331 |
| 265 | 3300005618 | Ga0068864_100035442 | Ga0068864_1000354424 | 331 |
| 266 | 3300005618 | Ga0068864_100036405 | Ga0068864_1000364054 | 331 |
| 267 | 3300005618 | Ga0068864_100413384 | Ga0068864_1004133841 | 331 |
| 268 | 3300005718 | Ga0068866_10088821 | Ga0068866_100888211 | 331 |
| 269 | 3300005834 | Ga0068851_10018118 | Ga0068851_100181182 | 331 |
| 270 | 3300005834 | Ga0068851_10088321 | Ga0068851_100883212 | 331 |
| 271 | 3300005841 | Ga0068863_100013758 | Ga0068863_1000137589 | 331 |
| 272 | 3300005841 | Ga0068863_100018271 | Ga0068863_1000182712 | 331 |
| 273 | 3300005841 | Ga0068863_100061595 | Ga0068863_1000615951 | 331 |
| 274 | 3300005841 | Ga0068863_100159440 | Ga0068863_1001594402 | 331 |
| 275 | 3300005841 | Ga0068863_100369533 | Ga0068863_1003695332 | 331 |
| 276 | 3300005842 | Ga0068858_100001945 | Ga0068858_10000194520 | 331 |
| 277 | 3300005842 | Ga0068858_100024899 | Ga0068858_1000248992 | 331 |
| 278 | 3300005842 | Ga0068858_100051583 | Ga0068858_1000515832 | 331 |
| 279 | 3300005843 | Ga0068860_100005032 | Ga0068860_10000503210 | 331 |
| 280 | 3300005843 | Ga0068860_100296517 | Ga0068860_1002965171 | 331 |
| 281 | 3300005844 | Ga0068862_100018429 | Ga0068862_1000184293 | 331 |
| 282 | 3300005844 | Ga0068862_100022996 | Ga0068862_1000229962 | 331 |
| 283 | 3300006237 | Ga0097621_100037055 | Ga0097621_1000370552 | 331 |
| 284 | 3300006237 | Ga0097621_100116585 | Ga0097621_1001165852 | 331 |
| 285 | 3300006358 | Ga0068871_100029598 | Ga0068871_1000295983 | 331 |
| 286 | 3300006881 | Ga0068865_100018640 | Ga0068865_1000186404 | 331 |
| 287 | 3300006881 | Ga0068865_100029640 | Ga0068865_1000296405 | 331 |
| 288 | 3300006931 | Ga0097620_100025448 | Ga0097620_1000254482 | 331 |
| 289 | 3300006931 | Ga0097620_100035484 | Ga0097620_1000354844 | 331 |
| 290 | 3300006931 | Ga0097620_100069594 | Ga0097620_1000695944 | 331 |
| 291 | 3300006931 | Ga0097620_100132983 | Ga0097620_1001329833 | 331 |
| 292 | 3300006931 | Ga0097620_100148572 | Ga0097620_1001485722 | 331 |
| 293 | 3300009093 | Ga0105240_10106677 | Ga0105240_101066773 | 331 |
| 294 | 3300009093 | Ga0105240_10133111 | Ga0105240_101331113 | 331 |
| 295 | 3300009093 | Ga0105240_10408301 | Ga0105240_104083012 | 331 |
| 296 | 3300009093 | Ga0105240_10471538 | Ga0105240_104715382 | 331 |
| 297 | 3300009098 | Ga0105245_10001904 | Ga0105245_1000190413 | 331 |
| 298 | 3300009098 | Ga0105245_10015097 | Ga0105245_100150976 | 331 |
| 299 | 3300009148 | Ga0105243_10023774 | Ga0105243_100237744 | 331 |
| 300 | 3300009148 | Ga0105243_10132536 | Ga0105243_101325362 | 331 |
| 301 | 3300009174 | Ga0105241_10033052 | Ga0105241_100330522 | 331 |
| 302 | 3300009174 | Ga0105241_10349056 | Ga0105241_103490562 | 331 |
| 303 | 3300009177 | Ga0105248_10000516 | Ga0105248_100005164 | 331 |
| 304 | 3300009177 | Ga0105248_10002422 | Ga0105248_100024223 | 331 |
| 305 | 3300009177 | Ga0105248_10005728 | Ga0105248_100057288 | 331 |
| 306 | 3300009177 | Ga0105248_10036187 | Ga0105248_100361874 | 331 |
| 307 | 3300009177 | Ga0105248_10106208 | Ga0105248_101062082 | 331 |
| 308 | 3300009177 | Ga0105248_10597220 | Ga0105248_105972201 | 331 |
| 309 | 3300009545 | Ga0105237_10149138 | Ga0105237_101491382 | 331 |
| 310 | 3300009551 | Ga0105238_10027776 | Ga0105238_100277767 | 331 |
| 311 | 3300009551 | Ga0105238_10048759 | Ga0105238_100487592 | 331 |
| 312 | 3300009553 | Ga0105249_10288245 | Ga0105249_102882452 | 331 |
| 313 | 3300010375 | Ga0105239_10446630 | Ga0105239_104466301 | 331 |
| 314 | 3300011119 | Ga0105246_10040909 | Ga0105246_100409092 | 331 |
| 315 | 3300013100 | Ga0157373_10091624 | Ga0157373_100916242 | 331 |
| 316 | 3300013100 | Ga0157373_10138017 | Ga0157373_101380172 | 331 |
| 317 | 3300013100 | Ga0157373_10167396 | Ga0157373_101673962 | 331 |
| 318 | 3300013102 | Ga0157371_10004234 | Ga0157371_100042344 | 331 |
| 319 | 3300013102 | Ga0157371_10025298 | Ga0157371_100252983 | 331 |
| 320 | 3300013102 | Ga0157371_10052253 | Ga0157371_100522534 | 331 |
| 321 | 3300013102 | Ga0157371_10093015 | Ga0157371_100930152 | 331 |
| 322 | 3300013102 | Ga0157371_10096660 | Ga0157371_100966602 | 331 |
| 323 | 3300013102 | Ga0157371_10108842 | Ga0157371_101088422 | 331 |
| 324 | 3300013104 | Ga0157370_10029768 | Ga0157370_100297682 | 331 |
| 325 | 3300013104 | Ga0157370_10061885 | Ga0157370_100618854 | 331 |
| 326 | 3300013105 | Ga0157369_10021589 | Ga0157369_100215895 | 331 |
| 327 | 3300013105 | Ga0157369_10061051 | Ga0157369_100610515 | 331 |
| 328 | 3300013105 | Ga0157369_10077930 | Ga0157369_100779304 | 331 |
| 329 | 3300013105 | Ga0157369_10118721 | Ga0157369_101187212 | 331 |
| 330 | 3300013297 | Ga0157378_10001240 | Ga0157378_100012401 | 331 |
| 331 | 3300013297 | Ga0157378_10023065 | Ga0157378_100230656 | 331 |
| 332 | 3300013306 | Ga0163162_10030689 | Ga0163162_100306893 | 331 |
| 333 | 3300013306 | Ga0163162_10303765 | Ga0163162_103037652 | 331 |
| 334 | 3300013307 | Ga0157372_10033902 | Ga0157372_100339025 | 331 |
| 335 | 3300013307 | Ga0157372_10114062 | Ga0157372_101140622 | 331 |
| 336 | 3300013307 | Ga0157372_10122157 | Ga0157372_101221573 | 331 |
| 337 | 3300013307 | Ga0157372_10206770 | Ga0157372_102067702 | 331 |
| 338 | 3300013308 | Ga0157375_10139169 | Ga0157375_101391692 | 331 |
| 339 | 3300014325 | Ga0163163_10071409 | Ga0163163_100714092 | 331 |
| 340 | 3300014968 | Ga0157379_10048494 | Ga0157379_100484945 | 331 |
| 341 | 3300014969 | Ga0157376_10075188 | Ga0157376_100751882 | 331 |
| 342 | 3300020070 | Ga0206356_11435106 | Ga0206356_114351064 | 331 |
| 343 | 3300020081 | Ga0206354_11234808 | Ga0206354_112348081 | 331 |
| 344 | 3300020082 | Ga0206353_10771636 | Ga0206353_107716362 | 331 |
| 345 | 3300025290 | Ga0207673_1000614 | Ga0207673_10006141 | 331 |
| 346 | 3300025315 | Ga0207697_10000727 | Ga0207697_1000072716 | 331 |
| 347 | 3300025315 | Ga0207697_10022266 | Ga0207697_100222662 | 331 |
| 348 | 3300025321 | Ga0207656_10017363 | Ga0207656_100173632 | 331 |
| 349 | 3300025899 | Ga0207642_10017913 | Ga0207642_100179133 | 331 |
| 350 | 3300025901 | Ga0207688_10003780 | Ga0207688_100037805 | 331 |
| 351 | 3300025901 | Ga0207688_10034554 | Ga0207688_100345542 | 331 |
| 352 | 3300025903 | Ga0207680_10033712 | Ga0207680_100337121 | 331 |
| 353 | 3300025903 | Ga0207680_10061764 | Ga0207680_100617641 | 331 |
| 354 | 3300025903 | Ga0207680_10101181 | Ga0207680_101011812 | 331 |
| 355 | 3300025904 | Ga0207647_10005880 | Ga0207647_1000588010 | 331 |
| 356 | 3300025904 | Ga0207647_10009181 | Ga0207647_100091813 | 331 |
| 357 | 3300025904 | Ga0207647_10023018 | Ga0207647_100230185 | 331 |
| 358 | 3300025904 | Ga0207647_10033022 | Ga0207647_100330222 | 331 |
| 359 | 3300025907 | Ga0207645_10003176 | Ga0207645_100031762 | 331 |
| 360 | 3300025907 | Ga0207645_10009510 | Ga0207645_100095106 | 331 |
| 361 | 3300025907 | Ga0207645_10011240 | Ga0207645_100112402 | 331 |
| 362 | 3300025907 | Ga0207645_10204708 | Ga0207645_102047082 | 331 |
| 363 | 3300025909 | Ga0207705_10017020 | Ga0207705_100170206 | 331 |
| 364 | 3300025909 | Ga0207705_10026200 | Ga0207705_100262003 | 331 |
| 365 | 3300025909 | Ga0207705_10028989 | Ga0207705_100289894 | 331 |
| 366 | 3300025909 | Ga0207705_10037851 | Ga0207705_100378512 | 331 |
| 367 | 3300025909 | Ga0207705_10069596 | Ga0207705_100695962 | 331 |
| 368 | 3300025909 | Ga0207705_10082255 | Ga0207705_100822552 | 331 |
| 369 | 3300025909 | Ga0207705_10235943 | Ga0207705_102359432 | 331 |
| 370 | 3300025912 | Ga0207707_10040945 | Ga0207707_100409453 | 331 |
| 371 | 3300025912 | Ga0207707_10057411 | Ga0207707_100574113 | 331 |
| 372 | 3300025913 | Ga0207695_10056378 | Ga0207695_100563784 | 331 |
| 373 | 3300025913 | Ga0207695_10070812 | Ga0207695_100708122 | 331 |
| 374 | 3300025914 | Ga0207671_10079812 | Ga0207671_100798122 | 331 |
| 375 | 3300025917 | Ga0207660_10001743 | Ga0207660_1000174314 | 331 |
| 376 | 3300025917 | Ga0207660_10004736 | Ga0207660_100047363 | 331 |
| 377 | 3300025917 | Ga0207660_10006043 | Ga0207660_100060439 | 331 |
| 378 | 3300025917 | Ga0207660_10099768 | Ga0207660_100997682 | 331 |
| 379 | 3300025918 | Ga0207662_10216651 | Ga0207662_102166512 | 331 |
| 380 | 3300025919 | Ga0207657_10004404 | Ga0207657_100044044 | 331 |
| 381 | 3300025919 | Ga0207657_10011948 | Ga0207657_100119486 | 331 |
| 382 | 3300025919 | Ga0207657_10012981 | Ga0207657_100129815 | 331 |
| 383 | 3300025919 | Ga0207657_10015907 | Ga0207657_100159078 | 331 |
| 384 | 3300025919 | Ga0207657_10019078 | Ga0207657_100190786 | 331 |
| 385 | 3300025919 | Ga0207657_10019876 | Ga0207657_100198765 | 331 |
| 386 | 3300025919 | Ga0207657_10023714 | Ga0207657_100237144 | 331 |
| 387 | 3300025919 | Ga0207657_10038176 | Ga0207657_100381764 | 331 |
| 388 | 3300025919 | Ga0207657_10039209 | Ga0207657_100392097 | 331 |
| 389 | 3300025919 | Ga0207657_10042112 | Ga0207657_100421125 | 331 |
| 390 | 3300025919 | Ga0207657_10143192 | Ga0207657_101431923 | 331 |
| 391 | 3300025920 | Ga0207649_10015900 | Ga0207649_100159004 | 331 |
| 392 | 3300025920 | Ga0207649_10025413 | Ga0207649_100254132 | 331 |
| 393 | 3300025920 | Ga0207649_10044076 | Ga0207649_100440763 | 331 |
| 394 | 3300025920 | Ga0207649_10066421 | Ga0207649_100664212 | 331 |
| 395 | 3300025921 | Ga0207652_10040482 | Ga0207652_100404824 | 331 |
| 396 | 3300025921 | Ga0207652_10183828 | Ga0207652_101838282 | 331 |
| 397 | 3300025921 | Ga0207652_10264398 | Ga0207652_102643982 | 331 |
| 398 | 3300025921 | Ga0207652_10499115 | Ga0207652_104991151 | 331 |
| 399 | 3300025923 | Ga0207681_10012914 | Ga0207681_100129144 | 331 |
| 400 | 3300025923 | Ga0207681_10017563 | Ga0207681_100175632 | 331 |
| 401 | 3300025925 | Ga0207650_10135642 | Ga0207650_101356422 | 331 |
| 402 | 3300025925 | Ga0207650_10145563 | Ga0207650_101455632 | 331 |
| 403 | 3300025927 | Ga0207687_10128836 | Ga0207687_101288362 | 331 |
| 404 | 3300025927 | Ga0207687_10188842 | Ga0207687_101888422 | 331 |
| 405 | 3300025931 | Ga0207644_10000153 | Ga0207644_1000015349 | 331 |
| 406 | 3300025931 | Ga0207644_10004564 | Ga0207644_1000456410 | 331 |
| 407 | 3300025931 | Ga0207644_10020800 | Ga0207644_100208002 | 331 |
| 408 | 3300025931 | Ga0207644_10023167 | Ga0207644_100231672 | 331 |
| 409 | 3300025931 | Ga0207644_10023234 | Ga0207644_100232343 | 331 |
| 410 | 3300025931 | Ga0207644_10072573 | Ga0207644_100725731 | 331 |
| 411 | 3300025932 | Ga0207690_10013795 | Ga0207690_100137955 | 331 |
| 412 | 3300025932 | Ga0207690_10021169 | Ga0207690_100211691 | 331 |
| 413 | 3300025932 | Ga0207690_10069543 | Ga0207690_100695432 | 331 |
| 414 | 3300025932 | Ga0207690_10118311 | Ga0207690_101183112 | 331 |
| 415 | 3300025932 | Ga0207690_10165112 | Ga0207690_101651121 | 331 |
| 416 | 3300025933 | Ga0207706_10002737 | Ga0207706_100027374 | 331 |
| 417 | 3300025933 | Ga0207706_10009999 | Ga0207706_100099995 | 331 |
| 418 | 3300025933 | Ga0207706_10010165 | Ga0207706_100101656 | 331 |
| 419 | 3300025933 | Ga0207706_10014148 | Ga0207706_100141482 | 331 |
| 420 | 3300025933 | Ga0207706_10027134 | Ga0207706_100271343 | 331 |
| 421 | 3300025933 | Ga0207706_10053170 | Ga0207706_100531702 | 331 |
| 422 | 3300025933 | Ga0207706_10139024 | Ga0207706_101390242 | 331 |
| 423 | 3300025933 | Ga0207706_10244373 | Ga0207706_102443732 | 331 |
| 424 | 3300025935 | Ga0207709_10196004 | Ga0207709_101960042 | 331 |
| 425 | 3300025937 | Ga0207669_10053892 | Ga0207669_100538922 | 331 |
| 426 | 3300025937 | Ga0207669_10062607 | Ga0207669_100626073 | 331 |
| 427 | 3300025937 | Ga0207669_10085336 | Ga0207669_100853362 | 331 |
| 428 | 3300025938 | Ga0207704_10005375 | Ga0207704_100053754 | 331 |
| 429 | 3300025938 | Ga0207704_10008678 | Ga0207704_100086784 | 331 |
| 430 | 3300025940 | Ga0207691_10004092 | Ga0207691_100040924 | 331 |
| 431 | 3300025940 | Ga0207691_10010479 | Ga0207691_100104795 | 331 |
| 432 | 3300025940 | Ga0207691_10029187 | Ga0207691_100291874 | 331 |
| 433 | 3300025940 | Ga0207691_10060016 | Ga0207691_100600163 | 331 |
| 434 | 3300025940 | Ga0207691_10077274 | Ga0207691_100772743 | 331 |
| 435 | 3300025941 | Ga0207711_10007169 | Ga0207711_100071698 | 331 |
| 436 | 3300025941 | Ga0207711_10008538 | Ga0207711_100085383 | 331 |
| 437 | 3300025941 | Ga0207711_10020375 | Ga0207711_100203757 | 331 |
| 438 | 3300025941 | Ga0207711_10020755 | Ga0207711_100207553 | 331 |
| 439 | 3300025941 | Ga0207711_10023811 | Ga0207711_100238115 | 331 |
| 440 | 3300025942 | Ga0207689_10000092 | Ga0207689_1000009269 | 331 |
| 441 | 3300025942 | Ga0207689_10023438 | Ga0207689_100234382 | 331 |
| 442 | 3300025942 | Ga0207689_10027769 | Ga0207689_100277693 | 331 |
| 443 | 3300025944 | Ga0207661_10009424 | Ga0207661_100094247 | 331 |
| 444 | 3300025944 | Ga0207661_10202318 | Ga0207661_102023182 | 331 |
| 445 | 3300025944 | Ga0207661_10359845 | Ga0207661_103598452 | 331 |
| 446 | 3300025945 | Ga0207679_10002819 | Ga0207679_100028197 | 331 |
| 447 | 3300025945 | Ga0207679_10082288 | Ga0207679_100822883 | 331 |
| 448 | 3300025945 | Ga0207679_10423381 | Ga0207679_104233811 | 331 |
| 449 | 3300025949 | Ga0207667_10006268 | Ga0207667_100062688 | 331 |
| 450 | 3300025949 | Ga0207667_10025488 | Ga0207667_100254887 | 331 |
| 451 | 3300025949 | Ga0207667_10048537 | Ga0207667_100485372 | 331 |
| 452 | 3300025949 | Ga0207667_10082593 | Ga0207667_100825932 | 331 |
| 453 | 3300025949 | Ga0207667_10112286 | Ga0207667_101122862 | 331 |
| 454 | 3300025949 | Ga0207667_10198370 | Ga0207667_101983703 | 331 |
| 455 | 3300025949 | Ga0207667_10283539 | Ga0207667_102835392 | 331 |
| 456 | 3300025960 | Ga0207651_10002376 | Ga0207651_100023765 | 331 |
| 457 | 3300025960 | Ga0207651_10003515 | Ga0207651_100035156 | 331 |
| 458 | 3300025960 | Ga0207651_10012776 | Ga0207651_100127763 | 331 |
| 459 | 3300025960 | Ga0207651_10018449 | Ga0207651_100184494 | 331 |
| 460 | 3300025972 | Ga0207668_10000080 | Ga0207668_100000807 | 331 |
| 461 | 3300025981 | Ga0207640_10002379 | Ga0207640_100023798 | 331 |
| 462 | 3300025981 | Ga0207640_10007257 | Ga0207640_100072574 | 331 |
| 463 | 3300025981 | Ga0207640_10015780 | Ga0207640_100157804 | 331 |
| 464 | 3300025981 | Ga0207640_10117183 | Ga0207640_101171831 | 331 |
| 465 | 3300025981 | Ga0207640_10149232 | Ga0207640_101492322 | 331 |
| 466 | 3300025986 | Ga0207658_10001711 | Ga0207658_100017113 | 331 |
| 467 | 3300025986 | Ga0207658_10006240 | Ga0207658_100062405 | 331 |
| 468 | 3300025986 | Ga0207658_10014044 | Ga0207658_100140446 | 331 |
| 469 | 3300025986 | Ga0207658_10032329 | Ga0207658_100323295 | 331 |
| 470 | 3300025986 | Ga0207658_10050772 | Ga0207658_100507724 | 331 |
| 471 | 3300026023 | Ga0207677_10000733 | Ga0207677_1000073319 | 331 |
| 472 | 3300026023 | Ga0207677_10063023 | Ga0207677_100630233 | 331 |
| 473 | 3300026023 | Ga0207677_10122028 | Ga0207677_101220282 | 331 |
| 474 | 3300026035 | Ga0207703_10000515 | Ga0207703_100005152 | 331 |
| 475 | 3300026035 | Ga0207703_10017291 | Ga0207703_100172913 | 331 |
| 476 | 3300026035 | Ga0207703_10063513 | Ga0207703_100635132 | 331 |
| 477 | 3300026041 | Ga0207639_10017222 | Ga0207639_100172225 | 331 |
| 478 | 3300026041 | Ga0207639_10060980 | Ga0207639_100609802 | 331 |
| 479 | 3300026041 | Ga0207639_10063498 | Ga0207639_100634982 | 331 |
| 480 | 3300026041 | Ga0207639_10080287 | Ga0207639_100802872 | 331 |
| 481 | 3300026067 | Ga0207678_10004875 | Ga0207678_100048755 | 331 |
| 482 | 3300026067 | Ga0207678_10007245 | Ga0207678_100072456 | 331 |
| 483 | 3300026067 | Ga0207678_10059335 | Ga0207678_100593352 | 331 |
| 484 | 3300026067 | Ga0207678_10063839 | Ga0207678_100638391 | 331 |
| 485 | 3300026067 | Ga0207678_10094578 | Ga0207678_100945782 | 331 |
| 486 | 3300026067 | Ga0207678_10143803 | Ga0207678_101438031 | 331 |
| 487 | 3300026067 | Ga0207678_10237001 | Ga0207678_102370012 | 331 |
| 488 | 3300026078 | Ga0207702_10028488 | Ga0207702_100284882 | 331 |
| 489 | 3300026078 | Ga0207702_10087179 | Ga0207702_100871792 | 331 |
| 490 | 3300026078 | Ga0207702_10242035 | Ga0207702_102420352 | 331 |
| 491 | 3300026088 | Ga0207641_10010778 | Ga0207641_100107782 | 331 |
| 492 | 3300026088 | Ga0207641_10014516 | Ga0207641_100145167 | 331 |
| 493 | 3300026088 | Ga0207641_10047927 | Ga0207641_100479272 | 331 |
| 494 | 3300026088 | Ga0207641_10059137 | Ga0207641_100591372 | 331 |
| 495 | 3300026089 | Ga0207648_10002626 | Ga0207648_1000262616 | 331 |
| 496 | 3300026089 | Ga0207648_10006757 | Ga0207648_1000675713 | 331 |
| 497 | 3300026089 | Ga0207648_10018279 | Ga0207648_100182792 | 331 |
| 498 | 3300026089 | Ga0207648_10018472 | Ga0207648_100184726 | 331 |
| 499 | 3300026089 | Ga0207648_10029114 | Ga0207648_100291147 | 331 |
| 500 | 3300026095 | Ga0207676_10003682 | Ga0207676_100036822 | 331 |
| 501 | 3300026095 | Ga0207676_10005853 | Ga0207676_100058539 | 331 |
| 502 | 3300026095 | Ga0207676_10011738 | Ga0207676_100117383 | 331 |
| 503 | 3300026095 | Ga0207676_10129511 | Ga0207676_101295112 | 331 |
| 504 | 3300026116 | Ga0207674_10001784 | Ga0207674_1000178422 | 331 |
| 505 | 3300026116 | Ga0207674_10002505 | Ga0207674_1000250514 | 331 |
| 506 | 3300026116 | Ga0207674_10003685 | Ga0207674_100036854 | 331 |
| 507 | 3300026116 | Ga0207674_10018948 | Ga0207674_100189487 | 331 |
| 508 | 3300026116 | Ga0207674_10021860 | Ga0207674_100218606 | 331 |
| 509 | 3300026116 | Ga0207674_10034021 | Ga0207674_100340213 | 331 |
| 510 | 3300026121 | Ga0207683_10003191 | Ga0207683_1000319113 | 331 |
| 511 | 3300026121 | Ga0207683_10050341 | Ga0207683_100503412 | 331 |
| 512 | 3300026121 | Ga0207683_10082985 | Ga0207683_100829852 | 331 |
| 513 | 3300026142 | Ga0207698_10005458 | Ga0207698_100054587 | 331 |
| 514 | 3300026142 | Ga0207698_10017741 | Ga0207698_100177413 | 331 |
| 515 | 3300026142 | Ga0207698_10022833 | Ga0207698_100228337 | 331 |
| 516 | 3300026142 | Ga0207698_10045685 | Ga0207698_100456854 | 331 |
| 517 | 3300026142 | Ga0207698_10177794 | Ga0207698_101777942 | 331 |
| 518 | 3300028379 | Ga0268266_10000433 | Ga0268266_100004332 | 331 |
| 519 | 3300028379 | Ga0268266_10005198 | Ga0268266_100051983 | 331 |
| 520 | 3300028379 | Ga0268266_10012721 | Ga0268266_100127216 | 331 |
| 521 | 3300028379 | Ga0268266_10063100 | Ga0268266_100631002 | 331 |
| 522 | 3300028380 | Ga0268265_10002272 | Ga0268265_100022729 | 331 |
| 523 | 3300028381 | Ga0268264_10002562 | Ga0268264_100025626 | 331 |
| 524 | 3300028381 | Ga0268264_10003515 | Ga0268264_100035158 | 331 |
| 525 | 3300031548 | Ga0307408_100043360 | Ga0307408_1000433602 | 331 |
| 526 | 3300031824 | Ga0307413_10064011 | Ga0307413_100640112 | 331 |
| 527 | 3300031852 | Ga0307410_10011339 | Ga0307410_100113394 | 331 |
| 528 | 3300031901 | Ga0307406_10043320 | Ga0307406_100433202 | 331 |
| 529 | 3300031911 | Ga0307412_10091776 | Ga0307412_100917762 | 331 |
| 530 | 3300031995 | Ga0307409_100005874 | Ga0307409_1000058742 | 331 |
| 531 | 3300031995 | Ga0307409_100024886 | Ga0307409_1000248862 | 331 |
| 532 | 3300032002 | Ga0307416_100083426 | Ga0307416_1000834263 | 331 |
| 533 | 3300032004 | Ga0307414_10069185 | Ga0307414_100691853 | 331 |
| 534 | 3300032004 | Ga0307414_10072168 | Ga0307414_100721682 | 331 |
| 535 | 3300032005 | Ga0307411_10021693 | Ga0307411_100216935 | 331 |
| 536 | 3300032126 | Ga0307415_100054113 | Ga0307415_1000541132 | 331 |
| 537 | 3300035692 | Ga0373935_0005904 | Ga0373935_0005904_6031_7026 | 331 |
| 538 | 3300037068 | Ga0373925_0010559 | Ga0373925_0010559_5323_6318 | 331 |
| 539 | 3300037312 | Ga0395899_0016904 | Ga0395899_0016904_604_1599 | 331 |
| 540 | 3300037312 | Ga0395899_0017289 | Ga0395899_0017289_4023_5018 | 331 |
| 541 | 3300037312 | Ga0395899_0035672 | Ga0395899_0035672_2506_3501 | 331 |
| 542 | 3300037312 | Ga0395899_0049097 | Ga0395899_0049097_763_1788 | 331 |
| 543 | 3300037418 | Ga0395900_0012032 | Ga0395900_0012032_4989_5984 | 331 |
| 544 | 3300037418 | Ga0395900_0054909 | Ga0395900_0054909_2790_3815 | 331 |
| 545 | 3300037418 | Ga0395900_0065541 | Ga0395900_0065541_745_1740 | 331 |
| 546 | 3300037418 | Ga0395900_0070302 | Ga0395900_0070302_266_1261 | 331 |
| 547 | 3300037418 | Ga0395900_0089615 | Ga0395900_0089615_219_1241 | 331 |
| 548 | 3300037418 | Ga0395900_0095674 | Ga0395900_0095674_976_1998 | 331 |
| 549 | 3300037418 | Ga0395900_0166232 | Ga0395900_0166232_737_1732 | 331 |
| 550 | 3300037418 | Ga0395900_0187842 | Ga0395900_0187842_647_1642 | 331 |
| 551 | 3300037466 | Ga0395898_0022042 | Ga0395898_0022042_2861_3856 | 331 |
| 552 | 3300037466 | Ga0395898_0026382 | Ga0395898_0026382_471_1466 | 331 |
| 553 | 3300037471 | Ga0395905_0004302 | Ga0395905_0004302_7106_8119 | 331 |
| 554 | 3300037471 | Ga0395905_0018718 | Ga0395905_0018718_216_1235 | 331 |
| 555 | 3300037471 | Ga0395905_0037569 | Ga0395905_0037569_654_1649 | 331 |
| 556 | 3300037471 | Ga0395905_0053843 | Ga0395905_0053843_2506_3501 | 331 |
| 557 | 3300037471 | Ga0395905_0064154 | Ga0395905_0064154_2263_3285 | 331 |
| 558 | 3300037471 | Ga0395905_0066420 | Ga0395905_0066420_240_1235 | 331 |
| 559 | 3300037471 | Ga0395905_0075397 | Ga0395905_0075397_1797_2792 | 331 |
| 560 | 3300037471 | Ga0395905_0093567 | Ga0395905_0093567_1709_2704 | 331 |
| 561 | 3300037471 | Ga0395905_0113870 | Ga0395905_0113870_1194_2189 | 331 |
| 562 | 3300037471 | Ga0395905_0169875 | Ga0395905_0169875_834_1829 | 331 |
| 563 | 3300037471 | Ga0395905_0189345 | Ga0395905_0189345_233_1228 | 331 |
| 564 | 3300037471 | Ga0395905_0251675 | Ga0395905_0251675_246_1271 | 331 |
| 565 | 3300037471 | Ga0395905_0373658 | Ga0395905_0373658_176_1243 | 331 |
| 566 | 3300038443 | Ga0395901_0015055 | Ga0395901_0015055_5343_6338 | 331 |
| 567 | 3300038443 | Ga0395901_0048641 | Ga0395901_0048641_3089_4084 | 331 |
| 568 | 3300038443 | Ga0395901_0089415 | Ga0395901_0089415_1605_2600 | 331 |
| 569 | 3300038443 | Ga0395901_0184946 | Ga0395901_0184946_602_1627 | 331 |
| 570 | 3300038443 | Ga0395901_0211793 | Ga0395901_0211793_222_1217 | 331 |
| 571 | 3300044693 | Ga0466961_0037195 | Ga0466961_0037195_1115_2140 | 331 |
| 572 | 3300044694 | Ga0466963_0018676 | Ga0466963_0018676_1041_2036 | 331 |
| 573 | 3300044694 | Ga0466963_0035719 | Ga0466963_0035719_1079_2104 | 331 |
| 574 | 3300044694 | Ga0466963_0106239 | Ga0466963_0106239_154_1179 | 331 |
| 575 | 3300044694 | Ga0466963_0184899 | Ga0466963_0184899_89_1111 | 331 |
| 576 | 3300044842 | Ga0466957_0016211 | Ga0466957_0016211_771_1796 | 331 |
| 577 | 3300044842 | Ga0466957_0095653 | Ga0466957_0095653_852_1853 | 331 |
| 578 | 3300045836 | Ga0466958_0199101 | Ga0466958_0199101_149_1144 | 331 |
| 579 | 3300045976 | Ga0466967_0144153 | Ga0466967_0144153_150_1172 | 331 |
| 580 | 3300045976 | Ga0466967_0253731 | Ga0466967_0253731_641_1666 | 331 |
| 581 | 3300046525 | Ga0495663_0003309 | Ga0495663_0003309_1150_2175 | 331 |
| 582 | 3300046537 | Ga0495598_0003508 | Ga0495598_0003508_1200_2195 | 331 |
| 583 | 3300046539 | Ga0495621_0000094 | Ga0495621_0000094_9249_10244 | 331 |
| 584 | 3300046539 | Ga0495621_0043596 | Ga0495621_0043596_255_1280 | 331 |
| 585 | 3300046616 | Ga0495668_0087038 | Ga0495668_0087038_438_1433 | 331 |
| 586 | 3300046684 | Ga0495669_0000617 | Ga0495669_0000617_2736_3761 | 331 |
| 587 | 3300046684 | Ga0495669_0008270 | Ga0495669_0008270_739_1734 | 331 |
| 588 | 3300046684 | Ga0495669_0008952 | Ga0495669_0008952_1968_2963 | 331 |
| 589 | 3300046684 | Ga0495669_0035828 | Ga0495669_0035828_269_1264 | 331 |
| 590 | 3300046691 | Ga0495670_0004793 | Ga0495670_0004793_2257_3252 | 331 |
| 591 | 3300047445 | Ga0495677_0003141 | Ga0495677_0003141_2544_3569 | 331 |
| 592 | 3300048903 | Ga0496100_0004507 | Ga0496100_0004507_3989_5011 | 331 |
| 593 | 3300048904 | Ga0496101_0000589 | Ga0496101_0000589_17403_18425 | 331 |
| 594 | 3300048904 | Ga0496101_0055076 | Ga0496101_0055076_1808_2803 | 331 |
| 595 | 3300048904 | Ga0496101_0123775 | Ga0496101_0123775_407_1402 | 331 |
| 596 | 3300048906 | Ga0496103_0032088 | Ga0496103_0032088_2147_3142 | 331 |
| 597 | 3300048906 | Ga0496103_0050519 | Ga0496103_0050519_640_1662 | 331 |
| 598 | 3300048907 | Ga0496104_0011224 | Ga0496104_0011224_537_1559 | 331 |
| 599 | 3300048907 | Ga0496104_0360524 | Ga0496104_0360524_308_1303 | 331 |
| 600 | 3300048908 | Ga0496105_0010283 | Ga0496105_0010283_2083_3105 | 331 |
| 601 | 3300048909 | Ga0496106_0007644 | Ga0496106_0007644_5221_6216 | 331 |
| 602 | 3300048909 | Ga0496106_0023948 | Ga0496106_0023948_2519_3541 | 331 |
| 603 | 3300048910 | Ga0496107_0000429 | Ga0496107_0000429_2927_3922 | 331 |
| 604 | 3300048910 | Ga0496107_0000990 | Ga0496107_0000990_13364_14386 | 331 |
| 605 | 3300048911 | Ga0496108_0005046 | Ga0496108_0005046_7265_8287 | 331 |
| 606 | 3300048911 | Ga0496108_0012375 | Ga0496108_0012375_4037_5032 | 331 |
| 607 | 3300048911 | Ga0496108_0036270 | Ga0496108_0036270_2693_3760 | 331 |
| 608 | 3300048912 | Ga0496109_0009634 | Ga0496109_0009634_2531_3526 | 331 |
| 609 | 3300048912 | Ga0496109_0038803 | Ga0496109_0038803_2299_3321 | 331 |
| 610 | 3300048912 | Ga0496109_0064365 | Ga0496109_0064365_1912_2907 | 331 |
| 611 | 3300048913 | Ga0496110_0011777 | Ga0496110_0011777_1336_2331 | 331 |
| 612 | 3300048913 | Ga0496110_0012497 | Ga0496110_0012497_1964_2959 | 331 |
| 613 | 3300048913 | Ga0496110_0036060 | Ga0496110_0036060_2285_3307 | 331 |
| 614 | 3300048913 | Ga0496110_0231641 | Ga0496110_0231641_142_1137 | 331 |
| 615 | 3300048914 | Ga0496111_0000459 | Ga0496111_0000459_2584_3606 | 331 |
| 616 | 3300048914 | Ga0496111_0008661 | Ga0496111_0008661_2008_3003 | 331 |
| 617 | 3300048915 | Ga0496112_0000707 | Ga0496112_0000707_2298_3320 | 331 |
| 618 | 3300048915 | Ga0496112_0002279 | Ga0496112_0002279_2791_3786 | 331 |
| 619 | 3300048915 | Ga0496112_0034103 | Ga0496112_0034103_1731_2726 | 331 |
| 620 | 3300048915 | Ga0496112_0084543 | Ga0496112_0084543_232_1227 | 331 |
| 621 | 3300048915 | Ga0496112_0282443 | Ga0496112_0282443_76_1098 | 331 |
| 622 | 3300048916 | Ga0496113_0000431 | Ga0496113_0000431_17073_18095 | 331 |
| 623 | 3300048916 | Ga0496113_0005916 | Ga0496113_0005916_4560_5555 | 331 |
| 624 | 3300048916 | Ga0496113_0073611 | Ga0496113_0073611_1049_2044 | 331 |
| 625 | 3300048917 | Ga0496114_0036791 | Ga0496114_0036791_1558_2580 | 331 |
| 626 | 3300048917 | Ga0496114_0060031 | Ga0496114_0060031_1443_2468 | 331 |
| 627 | 3300048918 | Ga0496115_0010000 | Ga0496115_0010000_3378_4403 | 331 |
| 628 | 3300049742 | Ga0501080_0414030 | Ga0501080_0414030_29_1024 | 331 |
| 629 | 3300053087 | Ga0500643_000244 | Ga0500643_000244_38051_39046 | 331 |
| 630 | 3300053134 | Ga0500658_0000152 | Ga0500658_0000152_16515_17510 | 331 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7rpw-assembly1.cif.gz_E | archaeal dna ligase and heterotrimeric pcna in complex with adenylated dna | 0.7888 | 1 | 191 |
| 3vnn-assembly1.cif.gz_A | crystal structure of a sub-domain of the nucleotidyltransferase (adenylation) domain of human dna ligase iv | 0.7387 | 18 | 144 |
| 7l35-assembly1.cif.gz_A | human dna ligase 1 - r771w nicked dna complex | 0.7272 | 1 | 315 |
| 6p0d-assembly1.cif.gz_A | human dna ligase 1 (e346a/e592a) bound to an adenylated, hydroxyl terminated dna nick | 0.722 | 11 | 315 |
| 6q1v-assembly1.cif.gz_A | human dna ligase 1 (e592r) bound to an adenylated, hydroxyl terminated dna nick | 0.7097 | 11 | 315 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_L0TDE1_8_201_3.30.470.30 | Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;DNA ligase/mRNA capping enzyme | 0.9447 | 1 | 188 | 3.30.470.30 |
| af_L0TDE1_8_201_3.30.470.30 | Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;DNA ligase/mRNA capping enzyme | 0.9117 | 1 | 188 | 3.30.470.30 |
| af_L0TDE1_203_339_2.40.50.140 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.8466 | 191 | 313 | 2.40.50.140 |
| af_P9WNV3_639_759_2.40.50.140 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.8421 | 191 | 312 | 2.40.50.140 |
| af_P9WNV5_183_380_3.30.470.30 | Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;DNA ligase/mRNA capping enzyme | 0.8246 | 3 | 188 | 3.30.470.30 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A436S515-F1-model_v4 | ATP-dependent DNA ligase | 0.9693 | 1 | 145 |
GO:0003910
GO:0005524 GO:0006281 GO:0006310 |
| AF-A0A2V8HRN8-F1-model_v4 | ATP-dependent DNA ligase | 0.9692 | 1 | 152 |
GO:0003910
GO:0005524 GO:0006281 GO:0006310 |
| AF-A0A535WW92-F1-model_v4 | ATP-dependent DNA ligase (EC 6.5.1.1) | 0.9688 | 18 | 114 |
GO:0003910
GO:0005524 GO:0006281 GO:0006310 |
| AF-A0A2V5P8F7-F1-model_v4 | ATP-dependent DNA ligase | 0.9644 | 1 | 109 |
GO:0003910
GO:0005524 GO:0006281 GO:0006310 |
| AF-A0A7V9NFQ0-F1-model_v4 | ATP-dependent DNA ligase family profile domain-containing protein | 0.9631 | 1 | 119 |
GO:0003910
GO:0005524 GO:0006281 GO:0006310 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar