F470734

General Info

Members Datasets Scaffolds Average Seq Length
629 185 1258 384

Family's Representative Sequence

Representative Sequence 3300013104|Ga0157370_10132854|Ga0157370_101328542
Length 376
Sequence MWDRLLVDCNIATLEERPGNPLGLIENGAIAIADGKILRVGKRTELAGFRAKSVDALGGAWVTPGLIDCHTHLIFGGTRADEHAMRRAGATYDEIAQSGGGIASTVELIEQSRHRLHALMRGGCTTIEIKSGYGLDPASELRLVKIASEVGEGEAVRIIPTLLALHAVPADQRDRRAHYVSEIVDKLIPAAAKQGIATSIDAFCDTIAFVRLHAEQLSNQHGAALAAEYRALSADHLEYLDEAGAKAMAAAGTVGVLLPGAFYALQEKKKPPVALLRKHNVPIAIATDCNPGTSPLLSPTLAMNMACTLFGLTPEEAIGGMTINAARALALAHAVGSIAAGKQADLCAWRIESLAELGYWIGLPGPERRIFNGVDT

Samples

Sample ID Description Type Environment
1 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
39 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
43 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
44 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
45 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
50 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
54 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
55 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
56 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
57 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
58 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
59 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
60 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
61 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
62 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
64 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
65 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
66 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
67 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
68 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
69 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
70 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
71 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
72 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
73 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
74 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
75 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
76 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
77 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
78 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
133 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
134 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
135 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
136 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
137 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
138 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
139 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
140 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
141 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
142 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
143 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
144 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
145 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
146 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
147 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
148 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
149 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
150 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
151 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
152 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
153 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
154 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
155 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
156 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
157 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
158 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
159 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
160 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
161 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
162 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
163 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
164 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
165 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
166 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
167 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
168 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
169 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
170 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
171 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
172 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
173 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
174 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
175 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
176 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
177 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
178 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
179 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
180 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
181 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
182 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
183 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
184 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
185 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 5.09
Rhizosphere 94.75
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157370_10132854 3300013104 Bacteria 2321
2 JGI24740J21852_10001441 3300001979 Bacteria 10908
3 JGI24740J21852_10018625 3300001979 Bacteria 2456
4 JGI24739J22299_10002134 3300001989 Bacteria 7581
5 JGI24737J22298_10000598 3300001990 Bacteria 12680
6 JGI24737J22298_10008553 3300001990 Bacteria 3422
7 JGI24737J22298_10012437 3300001990 Bacteria 2775
8 JGI24735J21928_10013755 3300002067 Bacteria 2538
9 JGI24738J21930_10000859 3300002075 Bacteria 8719
10 Ga0070658_10009030 3300005327 Bacteria 8019
11 Ga0070658_10021986 3300005327 Bacteria 5115
12 Ga0070658_10025024 3300005327 Bacteria 4785
13 Ga0070658_10164165 3300005327 Bacteria 1864
14 Ga0070658_10204281 3300005327 Bacteria 1668
15 Ga0070676_10006115 3300005328 Bacteria 6428
16 Ga0070683_100003508 3300005329 Bacteria 12758
17 Ga0070683_100006593 3300005329 Bacteria 9751
18 Ga0070683_100087365 3300005329 Bacteria 2924
19 Ga0070683_100216111 3300005329 Bacteria 1822
20 Ga0070670_100094568 3300005331 Bacteria 2570
21 Ga0070677_10019520 3300005333 Bacteria 2456
22 Ga0068869_100001036 3300005334 Bacteria 16179
23 Ga0070666_10005130 3300005335 Bacteria 8018
24 Ga0070666_10012027 3300005335 Bacteria 5448
25 Ga0070666_10016352 3300005335 Bacteria 4745
26 Ga0070680_100001341 3300005336 Bacteria 17830
27 Ga0070680_100005354 3300005336 Bacteria 9708
28 Ga0070680_100008123 3300005336 Bacteria 8015
29 Ga0070680_100051334 3300005336 Bacteria 3365
30 Ga0070680_100077579 3300005336 Bacteria 2736
31 Ga0068868_100000156 3300005338 Bacteria 44526
32 Ga0068868_100001262 3300005338 Bacteria 17407
33 Ga0068868_100024090 3300005338 Bacteria 4614
34 Ga0068868_100047823 3300005338 Bacteria 3354
35 Ga0070660_100007624 3300005339 Bacteria 7544
36 Ga0070660_100020885 3300005339 Bacteria 4820
37 Ga0070660_100022970 3300005339 Bacteria 4617
38 Ga0070660_100052544 3300005339 Bacteria 3141
39 Ga0070660_100058585 3300005339 Bacteria 2985
40 Ga0070689_100046946 3300005340 Bacteria 3329
41 Ga0070661_100027360 3300005344 Bacteria 4105
42 Ga0070661_100028498 3300005344 Bacteria 4029
43 Ga0070661_100028810 3300005344 Bacteria 4006
44 Ga0070661_100081356 3300005344 Bacteria 2391
45 Ga0070661_100142569 3300005344 Bacteria 1807
46 Ga0070661_100166355 3300005344 Bacteria 1673
47 Ga0070692_10019522 3300005345 Bacteria 3271
48 Ga0070668_100002631 3300005347 Bacteria 13189
49 Ga0070668_100023056 3300005347 Bacteria 4706
50 Ga0070669_100000383 3300005353 Bacteria 33931
51 Ga0070669_100024819 3300005353 Bacteria 4302
52 Ga0070669_100032611 3300005353 Bacteria 3763
53 Ga0070669_100044572 3300005353 Bacteria 3231
54 Ga0070675_100025387 3300005354 Bacteria 4751
55 Ga0070671_100000722 3300005355 Bacteria 23671
56 Ga0070671_100004138 3300005355 Bacteria 11451
57 Ga0070671_100005598 3300005355 Bacteria 10003
58 Ga0070671_100007731 3300005355 Bacteria 8586
59 Ga0070671_100043947 3300005355 Bacteria 3713
60 Ga0070671_100111469 3300005355 Bacteria 2298
61 Ga0070674_100084773 3300005356 Bacteria 2273
62 Ga0070673_100004316 3300005364 Bacteria 8981
63 Ga0070673_100033723 3300005364 Bacteria 3869
64 Ga0070673_100057784 3300005364 Bacteria 3066
65 Ga0070673_100066291 3300005364 Bacteria 2884
66 Ga0070673_100071036 3300005364 Bacteria 2796
67 Ga0070673_100105301 3300005364 Bacteria 2330
68 Ga0070673_100195493 3300005364 Bacteria 1739
69 Ga0070659_100001501 3300005366 Bacteria 16815
70 Ga0070659_100003340 3300005366 Bacteria 11421
71 Ga0070659_100023083 3300005366 Bacteria 4756
72 Ga0070659_100024411 3300005366 Bacteria 4634
73 Ga0070659_100062691 3300005366 Bacteria 2939
74 Ga0070659_100065838 3300005366 Bacteria 2870
75 Ga0070659_100078151 3300005366 Bacteria 2639
76 Ga0070659_100108370 3300005366 Bacteria 2241
77 Ga0070659_100264576 3300005366 Bacteria 1427
78 Ga0070667_100001584 3300005367 Bacteria 20376
79 Ga0070667_100112376 3300005367 Bacteria 2363
80 Ga0070667_100130483 3300005367 Bacteria 2193
81 Ga0070713_100039648 3300005436 Bacteria 3824
82 Ga0070663_100080054 3300005455 Bacteria 2398
83 Ga0070663_100152499 3300005455 Bacteria 1773
84 Ga0070678_100001905 3300005456 Bacteria 11243
85 Ga0070678_100018220 3300005456 Bacteria 4547
86 Ga0070662_100002134 3300005457 Bacteria 12131
87 Ga0070662_100006491 3300005457 Bacteria 7544
88 Ga0070662_100017314 3300005457 Bacteria 4857
89 Ga0070662_100018006 3300005457 Bacteria 4772
90 Ga0070662_100033950 3300005457 Bacteria 3595
91 Ga0070662_100081637 3300005457 Bacteria 2409
92 Ga0070681_10066309 3300005458 Bacteria 3578
93 Ga0070681_10088742 3300005458 Bacteria 3044
94 Ga0070681_10140238 3300005458 Bacteria 2347
95 Ga0068867_100000388 3300005459 Bacteria 29345
96 Ga0068867_100005540 3300005459 Bacteria 8940
97 Ga0068867_100009725 3300005459 Bacteria 6781
98 Ga0068867_100031620 3300005459 Bacteria 3823
99 Ga0068867_100063469 3300005459 Bacteria 2745
100 Ga0070679_100069841 3300005530 Bacteria 3504
101 Ga0070684_100005655 3300005535 Bacteria 9603
102 Ga0070684_100099176 3300005535 Bacteria 2599
103 Ga0070684_100116735 3300005535 Bacteria 2397
104 Ga0068853_100005993 3300005539 Bacteria 9612
105 Ga0068853_100007774 3300005539 Bacteria 8597
106 Ga0068853_100138241 3300005539 Bacteria 2186
107 Ga0070672_100007886 3300005543 Bacteria 7267
108 Ga0070672_100008121 3300005543 Bacteria 7173
109 Ga0070672_100061622 3300005543 Bacteria 2958
110 Ga0070672_100062052 3300005543 Bacteria 2948
111 Ga0070672_100072425 3300005543 Bacteria 2743
112 Ga0070672_100186069 3300005543 Bacteria 1732
113 Ga0070672_100291976 3300005543 Bacteria 1380
114 Ga0070686_100023717 3300005544 Bacteria 3671
115 Ga0070693_100013333 3300005547 Bacteria 4186
116 Ga0070665_100001571 3300005548 Bacteria 26343
117 Ga0070665_100007242 3300005548 Bacteria 11272
118 Ga0070665_100013020 3300005548 Bacteria 8377
119 Ga0068855_100009539 3300005563 Bacteria 11722
120 Ga0068855_100203242 3300005563 Bacteria 2229
121 Ga0070664_100016051 3300005564 Bacteria 6136
122 Ga0070664_100024575 3300005564 Bacteria 4985
123 Ga0070664_100035279 3300005564 Bacteria 4199
124 Ga0070664_100038053 3300005564 Bacteria 4048
125 Ga0070664_100109173 3300005564 Bacteria 2413
126 Ga0070664_100137077 3300005564 Bacteria 2153
127 Ga0070664_100233554 3300005564 Bacteria 1649
128 Ga0068857_100000282 3300005577 Bacteria 34844
129 Ga0068857_100009874 3300005577 Bacteria 8288
130 Ga0068857_100027348 3300005577 Bacteria 5032
131 Ga0068857_100027678 3300005577 Bacteria 5001
132 Ga0068854_100022246 3300005578 Bacteria 4315
133 Ga0068854_100026466 3300005578 Bacteria 3987
134 Ga0068854_100042012 3300005578 Bacteria 3233
135 Ga0068854_100065513 3300005578 Bacteria 2641
136 Ga0068856_100012187 3300005614 Bacteria 8331
137 Ga0068856_100100626 3300005614 Bacteria 2882
138 Ga0068856_100152584 3300005614 Bacteria 2319
139 Ga0068856_100394976 3300005614 Bacteria 1403
140 Ga0068852_100003202 3300005616 Bacteria 11431
141 Ga0068852_100013855 3300005616 Bacteria 6184
142 Ga0068852_100029606 3300005616 Bacteria 4500
143 Ga0068852_100042069 3300005616 Bacteria 3866
144 Ga0068852_100111247 3300005616 Bacteria 2490
145 Ga0068852_100112703 3300005616 Bacteria 2475
146 Ga0068859_100003896 3300005617 Bacteria 15228
147 Ga0068859_100206897 3300005617 Bacteria 2048
148 Ga0068859_100470522 3300005617 Bacteria 1352
149 Ga0068864_100003284 3300005618 Bacteria 13357
150 Ga0068864_100025892 3300005618 Bacteria 4943
151 Ga0068864_100034391 3300005618 Bacteria 4310
152 Ga0068864_100069250 3300005618 Bacteria 3068
153 Ga0068864_100110620 3300005618 Bacteria 2447
154 Ga0068861_100101721 3300005719 Bacteria 2286
155 Ga0068861_100178259 3300005719 Bacteria 1767
156 Ga0068851_10086243 3300005834 Bacteria 1647
157 Ga0068863_100006044 3300005841 Bacteria 11881
158 Ga0068863_100013758 3300005841 Bacteria 7798
159 Ga0068863_100016756 3300005841 Bacteria 7031
160 Ga0068863_100034088 3300005841 Bacteria 4850
161 Ga0068863_100045290 3300005841 Bacteria 4175
162 Ga0068863_100106234 3300005841 Bacteria 2671
163 Ga0068858_100001945 3300005842 Bacteria 21060
164 Ga0068858_100010707 3300005842 Bacteria 8676
165 Ga0068858_100017694 3300005842 Bacteria 6679
166 Ga0068858_100058736 3300005842 Bacteria 3556
167 Ga0068860_100005032 3300005843 Bacteria 13450
168 Ga0068860_100012889 3300005843 Bacteria 8217
169 Ga0068860_100061365 3300005843 Bacteria 3572
170 Ga0068862_100020312 3300005844 Bacteria 5547
171 Ga0068862_100022996 3300005844 Bacteria 5219
172 Ga0068862_100099723 3300005844 Bacteria 2539
173 Ga0081539_10040258 3300005985 Bacteria 2745
174 Ga0070717_10085354 3300006028 Bacteria 2657
175 Ga0070712_100010341 3300006175 Bacteria 5884
176 Ga0070712_100022495 3300006175 Bacteria 4154
177 Ga0068871_100007055 3300006358 Bacteria 8006
178 Ga0068871_100024877 3300006358 Bacteria 4649
179 Ga0075428_100170090 3300006844 Bacteria 2363
180 Ga0075433_10047402 3300006852 Bacteria 3737
181 Ga0068865_100018640 3300006881 Bacteria 4481
182 Ga0068865_100027112 3300006881 Bacteria 3782
183 Ga0068865_100149715 3300006881 Bacteria 1769
184 Ga0097620_100003896 3300006931 Bacteria 15228
185 Ga0097620_100206907 3300006931 Bacteria 2048
186 Ga0097620_100470520 3300006931 Bacteria 1352
187 Ga0105240_10032415 3300009093 Bacteria 6764
188 Ga0105245_10001904 3300009098 Bacteria 18963
189 Ga0105245_10053627 3300009098 Bacteria 3619
190 Ga0105245_10231477 3300009098 Bacteria 1787
191 Ga0105248_10000516 3300009177 Bacteria 43895
192 Ga0105248_10002422 3300009177 Bacteria 20691
193 Ga0105248_10005728 3300009177 Bacteria 13638
194 Ga0105248_10053470 3300009177 Bacteria 4531
195 Ga0105248_10102243 3300009177 Bacteria 3230
196 Ga0105248_10104520 3300009177 Bacteria 3193
197 Ga0105248_10334654 3300009177 Bacteria 1705
198 Ga0105238_10161013 3300009551 Bacteria 2220
199 Ga0105249_10004824 3300009553 Bacteria 11639
200 Ga0105249_10061746 3300009553 Bacteria 3439
201 Ga0105246_10094079 3300011119 Bacteria 2166
202 Ga0157373_10017810 3300013100 Bacteria 5173
203 Ga0157373_10020643 3300013100 Bacteria 4785
204 Ga0157373_10048072 3300013100 Bacteria 3042
205 Ga0157373_10058580 3300013100 Bacteria 2731
206 Ga0157371_10004234 3300013102 Bacteria 12616
207 Ga0157371_10019060 3300013102 Bacteria 5065
208 Ga0157371_10020598 3300013102 Bacteria 4853
209 Ga0157371_10031974 3300013102 Bacteria 3789
210 Ga0157371_10089123 3300013102 Bacteria 2185
211 Ga0157371_10090644 3300013102 Bacteria 2166
212 Ga0157370_10006602 3300013104 Bacteria 12755
213 Ga0157370_10038474 3300013104 Bacteria 4627
214 Ga0157370_10075727 3300013104 Bacteria 3171
215 Ga0157370_10090188 3300013104 Bacteria 2879
216 Ga0157370_10125362 3300013104 Bacteria 2397
217 Ga0157370_10231918 3300013104 Bacteria 1708
218 Ga0157370_10326516 3300013104 Bacteria 1415
219 Ga0157369_10007273 3300013105 Bacteria 12742
220 Ga0157369_10021589 3300013105 Bacteria 7200
221 Ga0157369_10030813 3300013105 Bacteria 5913
222 Ga0157369_10148732 3300013105 Bacteria 2476
223 Ga0157369_10202751 3300013105 Bacteria 2082
224 Ga0157369_10344150 3300013105 Bacteria 1549
225 Ga0157374_10037272 3300013296 Bacteria 4461
226 Ga0157374_10255340 3300013296 Bacteria 1725
227 Ga0157378_10001240 3300013297 Bacteria 23084
228 Ga0157378_10022089 3300013297 Bacteria 5598
229 Ga0163162_10015262 3300013306 Bacteria 7503
230 Ga0163162_10030689 3300013306 Bacteria 5326
231 Ga0163162_10061172 3300013306 Bacteria 3804
232 Ga0157372_10030441 3300013307 Bacteria 5906
233 Ga0157372_10069315 3300013307 Bacteria 3966
234 Ga0157375_10005824 3300013308 Bacteria 10723
235 Ga0157375_10061461 3300013308 Bacteria 3730
236 Ga0157375_10076272 3300013308 Bacteria 3378
237 Ga0157375_10312020 3300013308 Bacteria 1737
238 Ga0207673_1000614 3300025290 Bacteria 3802
239 Ga0207697_10000727 3300025315 Bacteria 18712
240 Ga0207697_10020139 3300025315 Bacteria 2732
241 Ga0207697_10027261 3300025315 Bacteria 2336
242 Ga0207697_10073644 3300025315 Bacteria 1434
243 Ga0207656_10052787 3300025321 Bacteria 1761
244 Ga0207642_10063302 3300025899 Bacteria 1729
245 Ga0207688_10003780 3300025901 Bacteria 8253
246 Ga0207688_10015012 3300025901 Bacteria 4202
247 Ga0207680_10000361 3300025903 Bacteria 21828
248 Ga0207680_10008252 3300025903 Bacteria 5106
249 Ga0207647_10005880 3300025904 Bacteria 8940
250 Ga0207647_10008412 3300025904 Bacteria 7399
251 Ga0207647_10011466 3300025904 Bacteria 6216
252 Ga0207647_10015643 3300025904 Bacteria 5194
253 Ga0207647_10017770 3300025904 Bacteria 4827
254 Ga0207647_10066605 3300025904 Bacteria 2183
255 Ga0207699_10022305 3300025906 Bacteria 3428
256 Ga0207699_10071215 3300025906 Bacteria 2125
257 Ga0207645_10003176 3300025907 Bacteria 12577
258 Ga0207645_10009510 3300025907 Bacteria 6719
259 Ga0207645_10058972 3300025907 Bacteria 2451
260 Ga0207705_10005709 3300025909 Bacteria 9295
261 Ga0207705_10009056 3300025909 Bacteria 7254
262 Ga0207705_10021335 3300025909 Bacteria 4621
263 Ga0207705_10031770 3300025909 Bacteria 3770
264 Ga0207705_10051461 3300025909 Bacteria 2964
265 Ga0207705_10066603 3300025909 Bacteria 2605
266 Ga0207705_10100696 3300025909 Bacteria 2125
267 Ga0207707_10028261 3300025912 Bacteria 4903
268 Ga0207707_10110053 3300025912 Bacteria 2408
269 Ga0207695_10043495 3300025913 Bacteria 4786
270 Ga0207693_10053828 3300025915 Bacteria 3158
271 Ga0207693_10127334 3300025915 Bacteria 2002
272 Ga0207660_10001743 3300025917 Bacteria 14578
273 Ga0207660_10006043 3300025917 Bacteria 7859
274 Ga0207660_10007353 3300025917 Bacteria 7127
275 Ga0207660_10114094 3300025917 Bacteria 2037
276 Ga0207657_10001905 3300025919 Bacteria 22543
277 Ga0207657_10004404 3300025919 Bacteria 14894
278 Ga0207657_10011948 3300025919 Bacteria 8593
279 Ga0207657_10016345 3300025919 Bacteria 7158
280 Ga0207657_10023268 3300025919 Bacteria 5772
281 Ga0207657_10035159 3300025919 Bacteria 4497
282 Ga0207657_10050410 3300025919 Bacteria 3623
283 Ga0207657_10061982 3300025919 Bacteria 3203
284 Ga0207657_10065727 3300025919 Bacteria 3090
285 Ga0207657_10122506 3300025919 Bacteria 2139
286 Ga0207649_10039249 3300025920 Bacteria 2869
287 Ga0207652_10012092 3300025921 Bacteria 6969
288 Ga0207652_10017192 3300025921 Bacteria 5917
289 Ga0207652_10049303 3300025921 Bacteria 3604
290 Ga0207652_10070926 3300025921 Bacteria 3026
291 Ga0207681_10001646 3300025923 Bacteria 14399
292 Ga0207681_10017563 3300025923 Bacteria 4494
293 Ga0207681_10028762 3300025923 Bacteria 3603
294 Ga0207681_10075993 3300025923 Bacteria 2357
295 Ga0207694_10096521 3300025924 Bacteria 2338
296 Ga0207650_10022864 3300025925 Bacteria 4429
297 Ga0207650_10084208 3300025925 Bacteria 2417
298 Ga0207659_10004157 3300025926 Bacteria 8737
299 Ga0207687_10178755 3300025927 Bacteria 1642
300 Ga0207687_10218313 3300025927 Bacteria 1500
301 Ga0207700_10268445 3300025928 Bacteria 1464
302 Ga0207664_10072650 3300025929 Bacteria 2774
303 Ga0207644_10000153 3300025931 Bacteria 49585
304 Ga0207644_10001903 3300025931 Bacteria 13541
305 Ga0207644_10004564 3300025931 Bacteria 9003
306 Ga0207644_10009123 3300025931 Bacteria 6503
307 Ga0207690_10000983 3300025932 Bacteria 18257
308 Ga0207690_10014413 3300025932 Bacteria 4775
309 Ga0207690_10015992 3300025932 Bacteria 4559
310 Ga0207690_10041420 3300025932 Bacteria 3018
311 Ga0207690_10078583 3300025932 Bacteria 2297
312 Ga0207690_10082058 3300025932 Bacteria 2254
313 Ga0207690_10084710 3300025932 Bacteria 2223
314 Ga0207690_10146806 3300025932 Bacteria 1744
315 Ga0207706_10002737 3300025933 Bacteria 17167
316 Ga0207706_10005009 3300025933 Bacteria 12372
317 Ga0207706_10010165 3300025933 Bacteria 8614
318 Ga0207706_10011518 3300025933 Bacteria 8055
319 Ga0207706_10027695 3300025933 Bacteria 5066
320 Ga0207706_10029655 3300025933 Bacteria 4883
321 Ga0207706_10046307 3300025933 Bacteria 3851
322 Ga0207706_10105304 3300025933 Bacteria 2482
323 Ga0207706_10204896 3300025933 Bacteria 1730
324 Ga0207669_10020834 3300025937 Bacteria 3447
325 Ga0207669_10031124 3300025937 Bacteria 2977
326 Ga0207704_10008678 3300025938 Bacteria 4874
327 Ga0207691_10010479 3300025940 Bacteria 8892
328 Ga0207691_10056568 3300025940 Bacteria 3573
329 Ga0207691_10073014 3300025940 Bacteria 3094
330 Ga0207691_10097608 3300025940 Bacteria 2626
331 Ga0207711_10007169 3300025941 Bacteria 9346
332 Ga0207711_10008538 3300025941 Bacteria 8569
333 Ga0207711_10025359 3300025941 Bacteria 4974
334 Ga0207711_10038868 3300025941 Bacteria 4046
335 Ga0207711_10222740 3300025941 Bacteria 1726
336 Ga0207711_10299260 3300025941 Bacteria 1483
337 Ga0207689_10000092 3300025942 Bacteria 73254
338 Ga0207689_10037610 3300025942 Bacteria 4013
339 Ga0207689_10251463 3300025942 Bacteria 1461
340 Ga0207661_10008432 3300025944 Bacteria 7367
341 Ga0207661_10020766 3300025944 Bacteria 4914
342 Ga0207661_10126926 3300025944 Bacteria 2180
343 Ga0207661_10129477 3300025944 Bacteria 2159
344 Ga0207679_10016486 3300025945 Bacteria 4908
345 Ga0207679_10028936 3300025945 Bacteria 3852
346 Ga0207679_10093878 3300025945 Bacteria 2328
347 Ga0207679_10111862 3300025945 Bacteria 2157
348 Ga0207679_10134234 3300025945 Bacteria 1990
349 Ga0207667_10006268 3300025949 Bacteria 14436
350 Ga0207667_10036750 3300025949 Bacteria 5244
351 Ga0207667_10109801 3300025949 Bacteria 2845
352 Ga0207667_10181080 3300025949 Bacteria 2164
353 Ga0207651_10002376 3300025960 Bacteria 8982
354 Ga0207651_10006360 3300025960 Bacteria 6174
355 Ga0207651_10029414 3300025960 Bacteria 3480
356 Ga0207651_10065449 3300025960 Bacteria 2549
357 Ga0207712_10000269 3300025961 Bacteria 50416
358 Ga0207712_10055892 3300025961 Bacteria 2779
359 Ga0207668_10000080 3300025972 Bacteria 72198
360 Ga0207640_10002379 3300025981 Bacteria 10073
361 Ga0207640_10068369 3300025981 Bacteria 2380
362 Ga0207640_10115429 3300025981 Bacteria 1912
363 Ga0207640_10162385 3300025981 Bacteria 1654
364 Ga0207658_10001711 3300025986 Bacteria 16642
365 Ga0207658_10006240 3300025986 Bacteria 8144
366 Ga0207658_10008402 3300025986 Bacteria 7027
367 Ga0207658_10070428 3300025986 Bacteria 2646
368 Ga0207658_10088871 3300025986 Bacteria 2390
369 Ga0207658_10190574 3300025986 Bacteria 1704
370 Ga0207658_10274824 3300025986 Bacteria 1442
371 Ga0207677_10000733 3300026023 Bacteria 19151
372 Ga0207677_10001646 3300026023 Bacteria 11832
373 Ga0207677_10005076 3300026023 Bacteria 7114
374 Ga0207677_10121249 3300026023 Bacteria 1967
375 Ga0207677_10227645 3300026023 Bacteria 1500
376 Ga0207703_10000515 3300026035 Bacteria 39972
377 Ga0207703_10012249 3300026035 Bacteria 6686
378 Ga0207703_10015488 3300026035 Bacteria 5944
379 Ga0207703_10016982 3300026035 Bacteria 5676
380 Ga0207703_10029280 3300026035 Bacteria 4344
381 Ga0207639_10006249 3300026041 Bacteria 8091
382 Ga0207639_10049703 3300026041 Bacteria 3181
383 Ga0207639_10061798 3300026041 Bacteria 2894
384 Ga0207639_10274486 3300026041 Bacteria 1480
385 Ga0207678_10004875 3300026067 Bacteria 12048
386 Ga0207678_10007245 3300026067 Bacteria 9837
387 Ga0207678_10022023 3300026067 Bacteria 5585
388 Ga0207678_10027592 3300026067 Bacteria 4954
389 Ga0207678_10117068 3300026067 Bacteria 2274
390 Ga0207678_10120156 3300026067 Bacteria 2242
391 Ga0207702_10073253 3300026078 Bacteria 2953
392 Ga0207702_10131603 3300026078 Bacteria 2252
393 Ga0207702_10151430 3300026078 Bacteria 2110
394 Ga0207641_10010715 3300026088 Bacteria 7517
395 Ga0207641_10010778 3300026088 Bacteria 7493
396 Ga0207641_10014516 3300026088 Bacteria 6456
397 Ga0207648_10002626 3300026089 Bacteria 19234
398 Ga0207648_10006757 3300026089 Bacteria 11374
399 Ga0207648_10018472 3300026089 Bacteria 6311
400 Ga0207648_10056286 3300026089 Bacteria 3433
401 Ga0207676_10003682 3300026095 Bacteria 10834
402 Ga0207676_10005853 3300026095 Bacteria 8684
403 Ga0207676_10014040 3300026095 Bacteria 5752
404 Ga0207676_10100458 3300026095 Bacteria 2397
405 Ga0207676_10236550 3300026095 Bacteria 1636
406 Ga0207674_10001784 3300026116 Bacteria 27499
407 Ga0207674_10002505 3300026116 Bacteria 23159
408 Ga0207674_10018308 3300026116 Bacteria 7616
409 Ga0207674_10021860 3300026116 Bacteria 6883
410 Ga0207674_10061918 3300026116 Bacteria 3780
411 Ga0207674_10087230 3300026116 Bacteria 3115
412 Ga0207674_10101778 3300026116 Bacteria 2853
413 Ga0207674_10153282 3300026116 Bacteria 2260
414 Ga0207674_10396956 3300026116 Bacteria 1333
415 Ga0207675_100048984 3300026118 Bacteria 3944
416 Ga0207675_100073105 3300026118 Bacteria 3208
417 Ga0207683_10007823 3300026121 Bacteria 9149
418 Ga0207683_10012789 3300026121 Bacteria 7163
419 Ga0207683_10020172 3300026121 Bacteria 5698
420 Ga0207683_10026607 3300026121 Bacteria 4994
421 Ga0207683_10050417 3300026121 Bacteria 3646
422 Ga0207683_10078113 3300026121 Bacteria 2933
423 Ga0207698_10003463 3300026142 Bacteria 9502
424 Ga0207698_10003790 3300026142 Bacteria 9141
425 Ga0207698_10010989 3300026142 Bacteria 5851
426 Ga0207698_10058595 3300026142 Bacteria 2985
427 Ga0207698_10076729 3300026142 Bacteria 2676
428 Ga0207698_10124260 3300026142 Bacteria 2191
429 Ga0268266_10000433 3300028379 Bacteria 62887
430 Ga0268266_10005198 3300028379 Bacteria 12252
431 Ga0268266_10025254 3300028379 Bacteria 5057
432 Ga0268266_10084016 3300028379 Bacteria 2779
433 Ga0268266_10155679 3300028379 Bacteria 2064
434 Ga0268265_10002272 3300028380 Bacteria 14633
435 Ga0268265_10024733 3300028380 Bacteria 4253
436 Ga0268264_10002562 3300028381 Bacteria 15931
437 Ga0268264_10003515 3300028381 Bacteria 13504
438 Ga0268264_10012288 3300028381 Bacteria 7047
439 Ga0268264_10032365 3300028381 Bacteria 4290
440 Ga0307406_10019627 3300031901 Bacteria 3970
441 Ga0307407_10016269 3300031903 Bacteria 3699
442 Ga0307409_100005874 3300031995 Bacteria 7128
443 Ga0307409_100051888 3300031995 Bacteria 3141
444 Ga0307416_100003477 3300032002 Bacteria 9253
445 Ga0307416_100426667 3300032002 Bacteria 1372
446 Ga0373954_0008884 3300035118 Bacteria 4422
447 Ga0373955_0004137 3300035172 Bacteria 6402
448 Ga0373937_0014740 3300036401 Bacteria 6901
449 Ga0395899_0000706 3300037312 Bacteria 33556
450 Ga0395899_0005437 3300037312 Bacteria 9884
451 Ga0395899_0008620 3300037312 Bacteria 7844
452 Ga0395899_0024405 3300037312 Bacteria 4570
453 Ga0395899_0027244 3300037312 Bacteria 4309
454 Ga0395899_0075129 3300037312 Bacteria 2468
455 Ga0395899_0075418 3300037312 Bacteria 2463
456 Ga0395899_0075899 3300037312 Bacteria 2454
457 Ga0395899_0083963 3300037312 Bacteria 2315
458 Ga0395899_0087077 3300037312 Bacteria 2267
459 Ga0395899_0087866 3300037312 Bacteria 2255
460 Ga0395899_0088912 3300037312 Bacteria 2241
461 Ga0395899_0104614 3300037312 Bacteria 2040
462 Ga0395899_0118703 3300037312 Bacteria 1896
463 Ga0395899_0153943 3300037312 Bacteria 1628
464 Ga0395899_0154509 3300037312 Bacteria 1624
465 Ga0395899_0155328 3300037312 Bacteria 1619
466 Ga0395900_0001237 3300037418 Bacteria 31404
467 Ga0395900_0002997 3300037418 Bacteria 18375
468 Ga0395900_0004081 3300037418 Bacteria 15571
469 Ga0395900_0005357 3300037418 Bacteria 13445
470 Ga0395900_0007032 3300037418 Bacteria 11654
471 Ga0395900_0007268 3300037418 Bacteria 11468
472 Ga0395900_0012032 3300037418 Bacteria 8844
473 Ga0395900_0012293 3300037418 Bacteria 8756
474 Ga0395900_0073991 3300037418 Bacteria 3503
475 Ga0395900_0083515 3300037418 Bacteria 3281
476 Ga0395900_0094856 3300037418 Bacteria 3065
477 Ga0395900_0108321 3300037418 Bacteria 2854
478 Ga0395900_0129721 3300037418 Bacteria 2584
479 Ga0395900_0160727 3300037418 Bacteria 2291
480 Ga0395900_0206853 3300037418 Bacteria 1983
481 Ga0395900_0266859 3300037418 Bacteria 1708
482 Ga0395900_0302780 3300037418 Bacteria 1584
483 Ga0395900_0333013 3300037418 Bacteria 1495
484 Ga0395900_0359041 3300037418 Bacteria 1429
485 Ga0395898_0000937 3300037466 Bacteria 46531
486 Ga0395898_0006634 3300037466 Bacteria 12340
487 Ga0395898_0076502 3300037466 Bacteria 3232
488 Ga0395898_0109853 3300037466 Bacteria 2643
489 Ga0395898_0113536 3300037466 Bacteria 2596
490 Ga0395898_0153739 3300037466 Bacteria 2201
491 Ga0395898_0162016 3300037466 Bacteria 2139
492 Ga0395898_0171622 3300037466 Bacteria 2073
493 Ga0395898_0191324 3300037466 Bacteria 1955
494 Ga0395898_0198939 3300037466 Bacteria 1914
495 Ga0395898_0225461 3300037466 Bacteria 1787
496 Ga0395898_0227600 3300037466 Bacteria 1778
497 Ga0395898_0241864 3300037466 Bacteria 1721
498 Ga0395898_0251361 3300037466 Bacteria 1686
499 Ga0395905_0000120 3300037471 Bacteria 130865
500 Ga0395905_0002237 3300037471 Bacteria 21801
501 Ga0395905_0002679 3300037471 Bacteria 19517
502 Ga0395905_0003693 3300037471 Bacteria 16206
503 Ga0395905_0005904 3300037471 Bacteria 12418
504 Ga0395905_0007956 3300037471 Bacteria 10482
505 Ga0395905_0009666 3300037471 Bacteria 9414
506 Ga0395905_0013407 3300037471 Bacteria 7855
507 Ga0395905_0018718 3300037471 Bacteria 6570
508 Ga0395905_0022685 3300037471 Bacteria 5933
509 Ga0395905_0031262 3300037471 Bacteria 5013
510 Ga0395905_0031293 3300037471 Bacteria 5010
511 Ga0395905_0037380 3300037471 Bacteria 4558
512 Ga0395905_0039909 3300037471 Bacteria 4404
513 Ga0395905_0041848 3300037471 Bacteria 4299
514 Ga0395905_0046021 3300037471 Bacteria 4092
515 Ga0395905_0049662 3300037471 Bacteria 3931
516 Ga0395905_0051076 3300037471 Bacteria 3872
517 Ga0395905_0059336 3300037471 Bacteria 3576
518 Ga0395905_0073779 3300037471 Bacteria 3199
519 Ga0395905_0101755 3300037471 Bacteria 2697
520 Ga0395905_0104779 3300037471 Bacteria 2655
521 Ga0395905_0110976 3300037471 Bacteria 2575
522 Ga0395905_0116273 3300037471 Bacteria 2514
523 Ga0395905_0117714 3300037471 Bacteria 2497
524 Ga0395905_0124572 3300037471 Bacteria 2423
525 Ga0395905_0147494 3300037471 Bacteria 2213
526 Ga0395905_0150514 3300037471 Bacteria 2189
527 Ga0395905_0157930 3300037471 Bacteria 2132
528 Ga0395905_0221207 3300037471 Bacteria 1772
529 Ga0395905_0229880 3300037471 Bacteria 1734
530 Ga0395905_0240296 3300037471 Bacteria 1692
531 Ga0395905_0248812 3300037471 Bacteria 1660
532 Ga0395905_0360231 3300037471 Bacteria 1347
533 Ga0395901_0002363 3300038443 Bacteria 19190
534 Ga0395901_0004251 3300038443 Bacteria 14447
535 Ga0395901_0005625 3300038443 Bacteria 12681
536 Ga0395901_0005832 3300038443 Bacteria 12466
537 Ga0395901_0006418 3300038443 Bacteria 11917
538 Ga0395901_0008510 3300038443 Bacteria 10368
539 Ga0395901_0008648 3300038443 Bacteria 10287
540 Ga0395901_0009083 3300038443 Bacteria 10062
541 Ga0395901_0015055 3300038443 Bacteria 7865
542 Ga0395901_0048641 3300038443 Bacteria 4404
543 Ga0395901_0052909 3300038443 Bacteria 4220
544 Ga0395901_0060613 3300038443 Bacteria 3937
545 Ga0395901_0086630 3300038443 Bacteria 3275
546 Ga0395901_0112615 3300038443 Bacteria 2857
547 Ga0395901_0121897 3300038443 Bacteria 2740
548 Ga0395901_0132751 3300038443 Bacteria 2616
549 Ga0395901_0139553 3300038443 Bacteria 2547
550 Ga0395901_0210533 3300038443 Bacteria 2035
551 Ga0395901_0251764 3300038443 Bacteria 1840
552 Ga0436365_1693069 3300039437 Bacteria 3319
553 Ga0439449_0042658 3300042007 Bacteria 1685
554 Ga0450889_001235 3300042144 Bacteria 2663
555 Ga0439458_0000501 3300042157 Bacteria 10006
556 Ga0466969_0024376 3300044656 Bacteria 3112
557 Ga0466969_0095446 3300044656 Bacteria 1405
558 Ga0466966_0025794 3300044684 Bacteria 3839
559 Ga0466966_0103069 3300044684 Bacteria 1763
560 Ga0466961_0029382 3300044693 Bacteria 3534
561 Ga0466963_0023401 3300044694 Bacteria 3923
562 Ga0466963_0039254 3300044694 Bacteria 3100
563 Ga0466963_0040123 3300044694 Bacteria 3068
564 Ga0466963_0108471 3300044694 Bacteria 1904
565 Ga0466971_0024978 3300044719 Bacteria 2668
566 Ga0466970_0089851 3300044765 Bacteria 1667
567 Ga0466970_0118290 3300044765 Bacteria 1450
568 Ga0466957_0003192 3300044842 Bacteria 8953
569 Ga0466957_0077835 3300044842 Bacteria 2061
570 Ga0466959_0076156 3300045049 Bacteria 2423
571 Ga0466958_0026548 3300045836 Bacteria 3423
572 Ga0466958_0127295 3300045836 Bacteria 1597
573 Ga0466967_0025075 3300045976 Bacteria 4912
574 Ga0466967_0028201 3300045976 Bacteria 4684
575 Ga0466967_0031254 3300045976 Bacteria 4480
576 Ga0466967_0036125 3300045976 Bacteria 4215
577 Ga0466967_0045264 3300045976 Bacteria 3823
578 Ga0466967_0100523 3300045976 Bacteria 2642
579 Ga0466967_0211435 3300045976 Bacteria 1840
580 Ga0466967_0357283 3300045976 Bacteria 1415
581 Ga0495629_0119550 3300046459 Bacteria 1836
582 Ga0495663_0012333 3300046525 Bacteria 2381
583 Ga0495598_0000877 3300046537 Bacteria 5802
584 Ga0495621_0000094 3300046539 Bacteria 18073
585 Ga0495621_0020378 3300046539 Bacteria 2176
586 Ga0495668_0004511 3300046616 Bacteria 9854
587 Ga0495623_0037453 3300046679 Bacteria 3103
588 Ga0495669_0011431 3300046684 Bacteria 3768
589 Ga0495669_0034084 3300046684 Bacteria 2243
590 Ga0495670_0045652 3300046691 Bacteria 2187
591 Ga0495677_0064194 3300047445 Bacteria 1364
592 Ga0495602_0024600 3300048088 Bacteria 5841
593 Ga0496100_0009869 3300048903 Bacteria 5381
594 Ga0496101_0000589 3300048904 Bacteria 22135
595 Ga0496101_0126528 3300048904 Bacteria 1937
596 Ga0496101_0203116 3300048904 Bacteria 1533
597 Ga0496102_0047827 3300048905 Bacteria 3889
598 Ga0496103_0033263 3300048906 Bacteria 3150
599 Ga0496104_0011224 3300048907 Bacteria 8018
600 Ga0496104_0102738 3300048907 Bacteria 2738
601 Ga0496106_0007644 3300048909 Bacteria 7995
602 Ga0496107_0000990 3300048910 Bacteria 16900
603 Ga0496107_0023284 3300048910 Bacteria 4379
604 Ga0496108_0005046 3300048911 Bacteria 10663
605 Ga0496108_0010642 3300048911 Bacteria 7461
606 Ga0496108_0010746 3300048911 Bacteria 7433
607 Ga0496109_0118078 3300048912 Bacteria 2469
608 Ga0496109_0131461 3300048912 Bacteria 2336
609 Ga0496109_0151374 3300048912 Bacteria 2172
610 Ga0496109_0303383 3300048912 Bacteria 1506
611 Ga0496110_0006374 3300048913 Bacteria 9329
612 Ga0496110_0027430 3300048913 Bacteria 4883
613 Ga0496111_0000459 3300048914 Bacteria 20678
614 Ga0496111_0029032 3300048914 Bacteria 3924
615 Ga0496111_0237922 3300048914 Bacteria 1352
616 Ga0496112_0000707 3300048915 Bacteria 23147
617 Ga0496112_0002279 3300048915 Bacteria 15342
618 Ga0496112_0031853 3300048915 Bacteria 5116
619 Ga0496112_0124331 3300048915 Bacteria 2550
620 Ga0496112_0170560 3300048915 Bacteria 2141
621 Ga0496113_0000431 3300048916 Bacteria 20368
622 Ga0496113_0203971 3300048916 Bacteria 1572
623 Ga0496114_0002576 3300048917 Bacteria 13855
624 Ga0496114_0152995 3300048917 Bacteria 2001
625 Ga0501067_0050915 3300049583 Bacteria 2296
626 Ga0501068_0048856 3300049584 Bacteria 2555
627 Ga0501080_0011438 3300049742 Bacteria 8127
628 Ga0466962_0023255 3300061719 Bacteria 2978
629 Ga0466962_0073264 3300061719 Bacteria 1636
630 Ga0157370_10132854
631 JGI24740J21852_10001441
632 JGI24740J21852_10018625
633 JGI24739J22299_10002134
634 JGI24737J22298_10000598
635 JGI24737J22298_10008553
636 JGI24737J22298_10012437
637 JGI24735J21928_10013755
638 JGI24738J21930_10000859
639 Ga0070658_10009030
640 Ga0070658_10021986
641 Ga0070658_10025024
642 Ga0070658_10164165
643 Ga0070658_10204281
644 Ga0070676_10006115
645 Ga0070683_100003508
646 Ga0070683_100006593
647 Ga0070683_100087365
648 Ga0070683_100216111
649 Ga0070670_100094568
650 Ga0070677_10019520
651 Ga0068869_100001036
652 Ga0070666_10005130
653 Ga0070666_10012027
654 Ga0070666_10016352
655 Ga0070680_100001341
656 Ga0070680_100005354
657 Ga0070680_100008123
658 Ga0070680_100051334
659 Ga0070680_100077579
660 Ga0068868_100000156
661 Ga0068868_100001262
662 Ga0068868_100024090
663 Ga0068868_100047823
664 Ga0070660_100007624
665 Ga0070660_100020885
666 Ga0070660_100022970
667 Ga0070660_100052544
668 Ga0070660_100058585
669 Ga0070689_100046946
670 Ga0070661_100027360
671 Ga0070661_100028498
672 Ga0070661_100028810
673 Ga0070661_100081356
674 Ga0070661_100142569
675 Ga0070661_100166355
676 Ga0070692_10019522
677 Ga0070668_100002631
678 Ga0070668_100023056
679 Ga0070669_100000383
680 Ga0070669_100024819
681 Ga0070669_100032611
682 Ga0070669_100044572
683 Ga0070675_100025387
684 Ga0070671_100000722
685 Ga0070671_100004138
686 Ga0070671_100005598
687 Ga0070671_100007731
688 Ga0070671_100043947
689 Ga0070671_100111469
690 Ga0070674_100084773
691 Ga0070673_100004316
692 Ga0070673_100033723
693 Ga0070673_100057784
694 Ga0070673_100066291
695 Ga0070673_100071036
696 Ga0070673_100105301
697 Ga0070673_100195493
698 Ga0070659_100001501
699 Ga0070659_100003340
700 Ga0070659_100023083
701 Ga0070659_100024411
702 Ga0070659_100062691
703 Ga0070659_100065838
704 Ga0070659_100078151
705 Ga0070659_100108370
706 Ga0070659_100264576
707 Ga0070667_100001584
708 Ga0070667_100112376
709 Ga0070667_100130483
710 Ga0070713_100039648
711 Ga0070663_100080054
712 Ga0070663_100152499
713 Ga0070678_100001905
714 Ga0070678_100018220
715 Ga0070662_100002134
716 Ga0070662_100006491
717 Ga0070662_100017314
718 Ga0070662_100018006
719 Ga0070662_100033950
720 Ga0070662_100081637
721 Ga0070681_10066309
722 Ga0070681_10088742
723 Ga0070681_10140238
724 Ga0068867_100000388
725 Ga0068867_100005540
726 Ga0068867_100009725
727 Ga0068867_100031620
728 Ga0068867_100063469
729 Ga0070679_100069841
730 Ga0070684_100005655
731 Ga0070684_100099176
732 Ga0070684_100116735
733 Ga0068853_100005993
734 Ga0068853_100007774
735 Ga0068853_100138241
736 Ga0070672_100007886
737 Ga0070672_100008121
738 Ga0070672_100061622
739 Ga0070672_100062052
740 Ga0070672_100072425
741 Ga0070672_100186069
742 Ga0070672_100291976
743 Ga0070686_100023717
744 Ga0070693_100013333
745 Ga0070665_100001571
746 Ga0070665_100007242
747 Ga0070665_100013020
748 Ga0068855_100009539
749 Ga0068855_100203242
750 Ga0070664_100016051
751 Ga0070664_100024575
752 Ga0070664_100035279
753 Ga0070664_100038053
754 Ga0070664_100109173
755 Ga0070664_100137077
756 Ga0070664_100233554
757 Ga0068857_100000282
758 Ga0068857_100009874
759 Ga0068857_100027348
760 Ga0068857_100027678
761 Ga0068854_100022246
762 Ga0068854_100026466
763 Ga0068854_100042012
764 Ga0068854_100065513
765 Ga0068856_100012187
766 Ga0068856_100100626
767 Ga0068856_100152584
768 Ga0068856_100394976
769 Ga0068852_100003202
770 Ga0068852_100013855
771 Ga0068852_100029606
772 Ga0068852_100042069
773 Ga0068852_100111247
774 Ga0068852_100112703
775 Ga0068859_100003896
776 Ga0068859_100206897
777 Ga0068859_100470522
778 Ga0068864_100003284
779 Ga0068864_100025892
780 Ga0068864_100034391
781 Ga0068864_100069250
782 Ga0068864_100110620
783 Ga0068861_100101721
784 Ga0068861_100178259
785 Ga0068851_10086243
786 Ga0068863_100006044
787 Ga0068863_100013758
788 Ga0068863_100016756
789 Ga0068863_100034088
790 Ga0068863_100045290
791 Ga0068863_100106234
792 Ga0068858_100001945
793 Ga0068858_100010707
794 Ga0068858_100017694
795 Ga0068858_100058736
796 Ga0068860_100005032
797 Ga0068860_100012889
798 Ga0068860_100061365
799 Ga0068862_100020312
800 Ga0068862_100022996
801 Ga0068862_100099723
802 Ga0081539_10040258
803 Ga0070717_10085354
804 Ga0070712_100010341
805 Ga0070712_100022495
806 Ga0068871_100007055
807 Ga0068871_100024877
808 Ga0075428_100170090
809 Ga0075433_10047402
810 Ga0068865_100018640
811 Ga0068865_100027112
812 Ga0068865_100149715
813 Ga0097620_100003896
814 Ga0097620_100206907
815 Ga0097620_100470520
816 Ga0105240_10032415
817 Ga0105245_10001904
818 Ga0105245_10053627
819 Ga0105245_10231477
820 Ga0105248_10000516
821 Ga0105248_10002422
822 Ga0105248_10005728
823 Ga0105248_10053470
824 Ga0105248_10102243
825 Ga0105248_10104520
826 Ga0105248_10334654
827 Ga0105238_10161013
828 Ga0105249_10004824
829 Ga0105249_10061746
830 Ga0105246_10094079
831 Ga0157373_10017810
832 Ga0157373_10020643
833 Ga0157373_10048072
834 Ga0157373_10058580
835 Ga0157371_10004234
836 Ga0157371_10019060
837 Ga0157371_10020598
838 Ga0157371_10031974
839 Ga0157371_10089123
840 Ga0157371_10090644
841 Ga0157370_10006602
842 Ga0157370_10038474
843 Ga0157370_10075727
844 Ga0157370_10090188
845 Ga0157370_10125362
846 Ga0157370_10231918
847 Ga0157370_10326516
848 Ga0157369_10007273
849 Ga0157369_10021589
850 Ga0157369_10030813
851 Ga0157369_10148732
852 Ga0157369_10202751
853 Ga0157369_10344150
854 Ga0157374_10037272
855 Ga0157374_10255340
856 Ga0157378_10001240
857 Ga0157378_10022089
858 Ga0163162_10015262
859 Ga0163162_10030689
860 Ga0163162_10061172
861 Ga0157372_10030441
862 Ga0157372_10069315
863 Ga0157375_10005824
864 Ga0157375_10061461
865 Ga0157375_10076272
866 Ga0157375_10312020
867 Ga0207673_1000614
868 Ga0207697_10000727
869 Ga0207697_10020139
870 Ga0207697_10027261
871 Ga0207697_10073644
872 Ga0207656_10052787
873 Ga0207642_10063302
874 Ga0207688_10003780
875 Ga0207688_10015012
876 Ga0207680_10000361
877 Ga0207680_10008252
878 Ga0207647_10005880
879 Ga0207647_10008412
880 Ga0207647_10011466
881 Ga0207647_10015643
882 Ga0207647_10017770
883 Ga0207647_10066605
884 Ga0207699_10022305
885 Ga0207699_10071215
886 Ga0207645_10003176
887 Ga0207645_10009510
888 Ga0207645_10058972
889 Ga0207705_10005709
890 Ga0207705_10009056
891 Ga0207705_10021335
892 Ga0207705_10031770
893 Ga0207705_10051461
894 Ga0207705_10066603
895 Ga0207705_10100696
896 Ga0207707_10028261
897 Ga0207707_10110053
898 Ga0207695_10043495
899 Ga0207693_10053828
900 Ga0207693_10127334
901 Ga0207660_10001743
902 Ga0207660_10006043
903 Ga0207660_10007353
904 Ga0207660_10114094
905 Ga0207657_10001905
906 Ga0207657_10004404
907 Ga0207657_10011948
908 Ga0207657_10016345
909 Ga0207657_10023268
910 Ga0207657_10035159
911 Ga0207657_10050410
912 Ga0207657_10061982
913 Ga0207657_10065727
914 Ga0207657_10122506
915 Ga0207649_10039249
916 Ga0207652_10012092
917 Ga0207652_10017192
918 Ga0207652_10049303
919 Ga0207652_10070926
920 Ga0207681_10001646
921 Ga0207681_10017563
922 Ga0207681_10028762
923 Ga0207681_10075993
924 Ga0207694_10096521
925 Ga0207650_10022864
926 Ga0207650_10084208
927 Ga0207659_10004157
928 Ga0207687_10178755
929 Ga0207687_10218313
930 Ga0207700_10268445
931 Ga0207664_10072650
932 Ga0207644_10000153
933 Ga0207644_10001903
934 Ga0207644_10004564
935 Ga0207644_10009123
936 Ga0207690_10000983
937 Ga0207690_10014413
938 Ga0207690_10015992
939 Ga0207690_10041420
940 Ga0207690_10078583
941 Ga0207690_10082058
942 Ga0207690_10084710
943 Ga0207690_10146806
944 Ga0207706_10002737
945 Ga0207706_10005009
946 Ga0207706_10010165
947 Ga0207706_10011518
948 Ga0207706_10027695
949 Ga0207706_10029655
950 Ga0207706_10046307
951 Ga0207706_10105304
952 Ga0207706_10204896
953 Ga0207669_10020834
954 Ga0207669_10031124
955 Ga0207704_10008678
956 Ga0207691_10010479
957 Ga0207691_10056568
958 Ga0207691_10073014
959 Ga0207691_10097608
960 Ga0207711_10007169
961 Ga0207711_10008538
962 Ga0207711_10025359
963 Ga0207711_10038868
964 Ga0207711_10222740
965 Ga0207711_10299260
966 Ga0207689_10000092
967 Ga0207689_10037610
968 Ga0207689_10251463
969 Ga0207661_10008432
970 Ga0207661_10020766
971 Ga0207661_10126926
972 Ga0207661_10129477
973 Ga0207679_10016486
974 Ga0207679_10028936
975 Ga0207679_10093878
976 Ga0207679_10111862
977 Ga0207679_10134234
978 Ga0207667_10006268
979 Ga0207667_10036750
980 Ga0207667_10109801
981 Ga0207667_10181080
982 Ga0207651_10002376
983 Ga0207651_10006360
984 Ga0207651_10029414
985 Ga0207651_10065449
986 Ga0207712_10000269
987 Ga0207712_10055892
988 Ga0207668_10000080
989 Ga0207640_10002379
990 Ga0207640_10068369
991 Ga0207640_10115429
992 Ga0207640_10162385
993 Ga0207658_10001711
994 Ga0207658_10006240
995 Ga0207658_10008402
996 Ga0207658_10070428
997 Ga0207658_10088871
998 Ga0207658_10190574
999 Ga0207658_10274824
1000 Ga0207677_10000733
1001 Ga0207677_10001646
1002 Ga0207677_10005076
1003 Ga0207677_10121249
1004 Ga0207677_10227645
1005 Ga0207703_10000515
1006 Ga0207703_10012249
1007 Ga0207703_10015488
1008 Ga0207703_10016982
1009 Ga0207703_10029280
1010 Ga0207639_10006249
1011 Ga0207639_10049703
1012 Ga0207639_10061798
1013 Ga0207639_10274486
1014 Ga0207678_10004875
1015 Ga0207678_10007245
1016 Ga0207678_10022023
1017 Ga0207678_10027592
1018 Ga0207678_10117068
1019 Ga0207678_10120156
1020 Ga0207702_10073253
1021 Ga0207702_10131603
1022 Ga0207702_10151430
1023 Ga0207641_10010715
1024 Ga0207641_10010778
1025 Ga0207641_10014516
1026 Ga0207648_10002626
1027 Ga0207648_10006757
1028 Ga0207648_10018472
1029 Ga0207648_10056286
1030 Ga0207676_10003682
1031 Ga0207676_10005853
1032 Ga0207676_10014040
1033 Ga0207676_10100458
1034 Ga0207676_10236550
1035 Ga0207674_10001784
1036 Ga0207674_10002505
1037 Ga0207674_10018308
1038 Ga0207674_10021860
1039 Ga0207674_10061918
1040 Ga0207674_10087230
1041 Ga0207674_10101778
1042 Ga0207674_10153282
1043 Ga0207674_10396956
1044 Ga0207675_100048984
1045 Ga0207675_100073105
1046 Ga0207683_10007823
1047 Ga0207683_10012789
1048 Ga0207683_10020172
1049 Ga0207683_10026607
1050 Ga0207683_10050417
1051 Ga0207683_10078113
1052 Ga0207698_10003463
1053 Ga0207698_10003790
1054 Ga0207698_10010989
1055 Ga0207698_10058595
1056 Ga0207698_10076729
1057 Ga0207698_10124260
1058 Ga0268266_10000433
1059 Ga0268266_10005198
1060 Ga0268266_10025254
1061 Ga0268266_10084016
1062 Ga0268266_10155679
1063 Ga0268265_10002272
1064 Ga0268265_10024733
1065 Ga0268264_10002562
1066 Ga0268264_10003515
1067 Ga0268264_10012288
1068 Ga0268264_10032365
1069 Ga0307406_10019627
1070 Ga0307407_10016269
1071 Ga0307409_100005874
1072 Ga0307409_100051888
1073 Ga0307416_100003477
1074 Ga0307416_100426667
1075 Ga0373954_0008884
1076 Ga0373955_0004137
1077 Ga0373937_0014740
1078 Ga0395899_0000706
1079 Ga0395899_0005437
1080 Ga0395899_0008620
1081 Ga0395899_0024405
1082 Ga0395899_0027244
1083 Ga0395899_0075129
1084 Ga0395899_0075418
1085 Ga0395899_0075899
1086 Ga0395899_0083963
1087 Ga0395899_0087077
1088 Ga0395899_0087866
1089 Ga0395899_0088912
1090 Ga0395899_0104614
1091 Ga0395899_0118703
1092 Ga0395899_0153943
1093 Ga0395899_0154509
1094 Ga0395899_0155328
1095 Ga0395900_0001237
1096 Ga0395900_0002997
1097 Ga0395900_0004081
1098 Ga0395900_0005357
1099 Ga0395900_0007032
1100 Ga0395900_0007268
1101 Ga0395900_0012032
1102 Ga0395900_0012293
1103 Ga0395900_0073991
1104 Ga0395900_0083515
1105 Ga0395900_0094856
1106 Ga0395900_0108321
1107 Ga0395900_0129721
1108 Ga0395900_0160727
1109 Ga0395900_0206853
1110 Ga0395900_0266859
1111 Ga0395900_0302780
1112 Ga0395900_0333013
1113 Ga0395900_0359041
1114 Ga0395898_0000937
1115 Ga0395898_0006634
1116 Ga0395898_0076502
1117 Ga0395898_0109853
1118 Ga0395898_0113536
1119 Ga0395898_0153739
1120 Ga0395898_0162016
1121 Ga0395898_0171622
1122 Ga0395898_0191324
1123 Ga0395898_0198939
1124 Ga0395898_0225461
1125 Ga0395898_0227600
1126 Ga0395898_0241864
1127 Ga0395898_0251361
1128 Ga0395905_0000120
1129 Ga0395905_0002237
1130 Ga0395905_0002679
1131 Ga0395905_0003693
1132 Ga0395905_0005904
1133 Ga0395905_0007956
1134 Ga0395905_0009666
1135 Ga0395905_0013407
1136 Ga0395905_0018718
1137 Ga0395905_0022685
1138 Ga0395905_0031262
1139 Ga0395905_0031293
1140 Ga0395905_0037380
1141 Ga0395905_0039909
1142 Ga0395905_0041848
1143 Ga0395905_0046021
1144 Ga0395905_0049662
1145 Ga0395905_0051076
1146 Ga0395905_0059336
1147 Ga0395905_0073779
1148 Ga0395905_0101755
1149 Ga0395905_0104779
1150 Ga0395905_0110976
1151 Ga0395905_0116273
1152 Ga0395905_0117714
1153 Ga0395905_0124572
1154 Ga0395905_0147494
1155 Ga0395905_0150514
1156 Ga0395905_0157930
1157 Ga0395905_0221207
1158 Ga0395905_0229880
1159 Ga0395905_0240296
1160 Ga0395905_0248812
1161 Ga0395905_0360231
1162 Ga0395901_0002363
1163 Ga0395901_0004251
1164 Ga0395901_0005625
1165 Ga0395901_0005832
1166 Ga0395901_0006418
1167 Ga0395901_0008510
1168 Ga0395901_0008648
1169 Ga0395901_0009083
1170 Ga0395901_0015055
1171 Ga0395901_0048641
1172 Ga0395901_0052909
1173 Ga0395901_0060613
1174 Ga0395901_0086630
1175 Ga0395901_0112615
1176 Ga0395901_0121897
1177 Ga0395901_0132751
1178 Ga0395901_0139553
1179 Ga0395901_0210533
1180 Ga0395901_0251764
1181 Ga0436365_1693069
1182 Ga0439449_0042658
1183 Ga0450889_001235
1184 Ga0439458_0000501
1185 Ga0466969_0024376
1186 Ga0466969_0095446
1187 Ga0466966_0025794
1188 Ga0466966_0103069
1189 Ga0466961_0029382
1190 Ga0466963_0023401
1191 Ga0466963_0039254
1192 Ga0466963_0040123
1193 Ga0466963_0108471
1194 Ga0466971_0024978
1195 Ga0466970_0089851
1196 Ga0466970_0118290
1197 Ga0466957_0003192
1198 Ga0466957_0077835
1199 Ga0466959_0076156
1200 Ga0466958_0026548
1201 Ga0466958_0127295
1202 Ga0466967_0025075
1203 Ga0466967_0028201
1204 Ga0466967_0031254
1205 Ga0466967_0036125
1206 Ga0466967_0045264
1207 Ga0466967_0100523
1208 Ga0466967_0211435
1209 Ga0466967_0357283
1210 Ga0495629_0119550
1211 Ga0495663_0012333
1212 Ga0495598_0000877
1213 Ga0495621_0000094
1214 Ga0495621_0020378
1215 Ga0495668_0004511
1216 Ga0495623_0037453
1217 Ga0495669_0011431
1218 Ga0495669_0034084
1219 Ga0495670_0045652
1220 Ga0495677_0064194
1221 Ga0495602_0024600
1222 Ga0496100_0009869
1223 Ga0496101_0000589
1224 Ga0496101_0126528
1225 Ga0496101_0203116
1226 Ga0496102_0047827
1227 Ga0496103_0033263
1228 Ga0496104_0011224
1229 Ga0496104_0102738
1230 Ga0496106_0007644
1231 Ga0496107_0000990
1232 Ga0496107_0023284
1233 Ga0496108_0005046
1234 Ga0496108_0010642
1235 Ga0496108_0010746
1236 Ga0496109_0118078
1237 Ga0496109_0131461
1238 Ga0496109_0151374
1239 Ga0496109_0303383
1240 Ga0496110_0006374
1241 Ga0496110_0027430
1242 Ga0496111_0000459
1243 Ga0496111_0029032
1244 Ga0496111_0237922
1245 Ga0496112_0000707
1246 Ga0496112_0002279
1247 Ga0496112_0031853
1248 Ga0496112_0124331
1249 Ga0496112_0170560
1250 Ga0496113_0000431
1251 Ga0496113_0203971
1252 Ga0496114_0002576
1253 Ga0496114_0152995
1254 Ga0501067_0050915
1255 Ga0501068_0048856
1256 Ga0501080_0011438
1257 Ga0466962_0023255
1258 Ga0466962_0073264

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07969

Amidohydro_3

Amidohydrolase family

113

355

0.81

PF01979

Amidohydro_1

Amidohydrolase family

61

361

0.63

Structural Annotation

Top 5 Hits

ID Description Score Start End
6n9m-assembly1.cif.gz_A crystal structure of adenosine deaminase from salmonella typhimurium with pentostatin (deoxycoformycin) 0.7233 93 333
6n91-assembly1.cif.gz_B crystal structure of adenosine deaminase from vibrio cholerae complexed with pentostatin (deoxycoformycin) 0.7196 105 332
6j23-assembly1.cif.gz_A crystal structure of arabidopsis adal complexed with gmp 0.7116 105 327
6j4t-assembly1.cif.gz_A crystal structure of arabidopsis adal complexed with imp 0.701 105 327
2g3f-assembly1.cif.gz_A crystal structure of imidazolonepropionase complexed with imidazole-4-acetic acid sodium salt, a substrate homologue 0.692 5 332
ID Description Score Start End Superfamily
af_Q4CLJ4_1_196_3.20.20.140 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.8944 142 335 3.20.20.140
af_Q4CLJ4_1_196_3.20.20.140 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.8815 142 335 3.20.20.140
2g3fA02 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.7987 65 335 3.20.20.140
af_Q22419_88_385_3.20.20.140 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.7784 65 331 3.20.20.140
2q09A02 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.7762 65 335 3.20.20.140
ID Description Score Start End GO Terms
AF-A0A3M5AYK0-F1-model_v4 deleted 0.9768 221 323
AF-A0A2P7P1B7-F1-model_v4 deleted 0.9665 223 305
AF-A0A090R2F4-F1-model_v4 Imidazolonepropionase (EC 3.5.2.7) 0.9585 207 331 GO:0005737
GO:0019556
GO:0046872
GO:0050480
AF-A0A526V4I6-F1-model_v4 Imidazolonepropionase 0.9573 180 335 GO:0005737
GO:0019556
GO:0046872
GO:0050480
AF-A0A0J1JC88-F1-model_v4 Imidazolonepropionase 0.9483 181 276 GO:0005737
GO:0019556
GO:0046872
GO:0050480

Map