F470713
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 629 | 269 | 1258 | 145 |
Family's Representative Sequence
| Representative Sequence | 3300005435|Ga0070714_100600610|Ga0070714_1006006102 |
| Length | 138 |
| Sequence | MPVPAQYAIFPVINASLNGASTVLLLVGRWFISQRRIAAHRATMITAVVTSALFLTSYLYYHAHVGSVHFQGTGWSRPLYFTLLISHVLLAIVITLTRALRERFDRHRAIARWTFPLWLYVSVTGVLVYFMLYHWFAV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 2 | 2162886012 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 | Metagenome | Rhizosphere |
| 3 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 4 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 5 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 6 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 9 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 11 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 12 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 14 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 16 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 17 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 19 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 38 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 39 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 45 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 48 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 50 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 56 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 58 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 59 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 60 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 62 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 63 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 64 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 65 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 66 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 67 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 68 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 69 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 70 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 71 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 72 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 74 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 75 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 76 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 78 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 79 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 80 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 81 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 82 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 84 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 109 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 113 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 114 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 115 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 117 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 177 | 3300031018 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 178 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 179 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 180 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 181 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 182 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 183 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 184 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 185 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 186 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 187 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 188 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 189 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 190 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 191 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 192 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 193 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 194 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 195 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 196 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 197 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 198 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 199 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 200 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 201 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 202 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 203 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 204 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 205 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 206 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 207 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 208 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 209 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 210 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 211 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 212 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 213 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 214 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 215 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 216 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 217 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 218 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 219 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 220 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 221 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 222 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 248 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 249 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 250 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 251 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 252 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 253 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 254 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 255 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 256 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 257 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 258 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 259 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 260 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 261 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 262 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 263 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 264 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 265 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 266 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 267 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 268 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.68 |
| Metatranscriptomes | 0.32 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 7.15 |
| Rhizosphere | 91.57 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 33.55 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070714_100600610 | 3300005435 | Bacteria | 1057 |
| 2 | MBSR1b_contig_2190678 | 2162886012 | Unclassified | 1052 |
| 3 | MBSR1b_contig_3904799 | 2162886012 | Bacteria | 1001 |
| 4 | rootH1_10376184 | 3300003323 | Unclassified | 1701 |
| 5 | Ga0065712_10114404 | 3300005290 | Bacteria | 1763 |
| 6 | Ga0065715_10225510 | 3300005293 | Unclassified | 1254 |
| 7 | Ga0070676_10041193 | 3300005328 | Unclassified | 2677 |
| 8 | Ga0070683_100061135 | 3300005329 | Bacteria | 3502 |
| 9 | Ga0070690_100005791 | 3300005330 | Bacteria | 6961 |
| 10 | Ga0070690_100070525 | 3300005330 | Unclassified | 2269 |
| 11 | Ga0070690_100151103 | 3300005330 | Bacteria | 1585 |
| 12 | Ga0070677_10304308 | 3300005333 | Bacteria | 811 |
| 13 | Ga0068869_100001662 | 3300005334 | Bacteria | 13287 |
| 14 | Ga0068869_100125000 | 3300005334 | Unclassified | 1971 |
| 15 | Ga0070680_100089406 | 3300005336 | Bacteria | 2548 |
| 16 | Ga0070682_100882074 | 3300005337 | Unclassified | 733 |
| 17 | Ga0068868_100001388 | 3300005338 | Bacteria | 16720 |
| 18 | Ga0068868_100059864 | 3300005338 | Bacteria | 3013 |
| 19 | Ga0068868_100082544 | 3300005338 | Bacteria | 2578 |
| 20 | Ga0070660_100006387 | 3300005339 | Bacteria | 8170 |
| 21 | Ga0070689_100252173 | 3300005340 | Bacteria | 1456 |
| 22 | Ga0070691_10075503 | 3300005341 | Unclassified | 1642 |
| 23 | Ga0070661_100013353 | 3300005344 | Bacteria | 5765 |
| 24 | Ga0070692_10432210 | 3300005345 | Bacteria | 838 |
| 25 | Ga0070668_100044886 | 3300005347 | Bacteria | 3391 |
| 26 | Ga0070675_100167505 | 3300005354 | Unclassified | 1893 |
| 27 | Ga0070675_101598374 | 3300005354 | Unclassified | 601 |
| 28 | Ga0070671_100303127 | 3300005355 | Bacteria | 1360 |
| 29 | Ga0070671_101148744 | 3300005355 | Bacteria | 683 |
| 30 | Ga0070674_100298065 | 3300005356 | Bacteria | 1284 |
| 31 | Ga0070673_100542018 | 3300005364 | Bacteria | 1056 |
| 32 | Ga0070659_100017607 | 3300005366 | Bacteria | 5381 |
| 33 | Ga0070659_100102405 | 3300005366 | Bacteria | 2305 |
| 34 | Ga0070667_100060743 | 3300005367 | Bacteria | 3198 |
| 35 | Ga0070667_100160758 | 3300005367 | Unclassified | 1978 |
| 36 | Ga0070667_100978188 | 3300005367 | Unclassified | 789 |
| 37 | Ga0070709_10064008 | 3300005434 | Unclassified | 2350 |
| 38 | Ga0070709_10106736 | 3300005434 | Bacteria | 1875 |
| 39 | Ga0070709_10129489 | 3300005434 | Bacteria | 1721 |
| 40 | Ga0070709_10226545 | 3300005434 | Bacteria | 1335 |
| 41 | Ga0070709_10242718 | 3300005434 | Bacteria | 1294 |
| 42 | Ga0070714_100002082 | 3300005435 | Bacteria | 14656 |
| 43 | Ga0070714_100070692 | 3300005435 | Bacteria | 3017 |
| 44 | Ga0070714_100081772 | 3300005435 | Unclassified | 2813 |
| 45 | Ga0070714_100877836 | 3300005435 | Unclassified | 870 |
| 46 | Ga0070713_100001170 | 3300005436 | Bacteria | 16769 |
| 47 | Ga0070713_100041393 | 3300005436 | Unclassified | 3753 |
| 48 | Ga0070713_100053651 | 3300005436 | Bacteria | 3341 |
| 49 | Ga0070713_100085962 | 3300005436 | Bacteria | 2695 |
| 50 | Ga0070713_100115254 | 3300005436 | Unclassified | 2348 |
| 51 | Ga0070713_100149931 | 3300005436 | Bacteria | 2073 |
| 52 | Ga0070713_100155486 | 3300005436 | Bacteria | 2038 |
| 53 | Ga0070713_100215311 | 3300005436 | Bacteria | 1741 |
| 54 | Ga0070713_100254257 | 3300005436 | Unclassified | 1604 |
| 55 | Ga0070713_100478045 | 3300005436 | Unclassified | 1173 |
| 56 | Ga0070713_100530545 | 3300005436 | Unclassified | 1113 |
| 57 | Ga0070713_100632519 | 3300005436 | Bacteria | 1018 |
| 58 | Ga0070710_10199946 | 3300005437 | Bacteria | 1261 |
| 59 | Ga0070710_11523605 | 3300005437 | Unclassified | 503 |
| 60 | Ga0070701_10712957 | 3300005438 | Unclassified | 676 |
| 61 | Ga0070711_100003108 | 3300005439 | Bacteria | 9606 |
| 62 | Ga0070711_100006478 | 3300005439 | Bacteria | 7061 |
| 63 | Ga0070711_100089177 | 3300005439 | Bacteria | 2218 |
| 64 | Ga0070711_100146764 | 3300005439 | Unclassified | 1775 |
| 65 | Ga0070705_100080322 | 3300005440 | Bacteria | 2000 |
| 66 | Ga0070705_100649900 | 3300005440 | Unclassified | 822 |
| 67 | Ga0070694_100002781 | 3300005444 | Bacteria | 10387 |
| 68 | Ga0070694_100105575 | 3300005444 | Unclassified | 1999 |
| 69 | Ga0070694_100457083 | 3300005444 | Bacteria | 1009 |
| 70 | Ga0070708_100000263 | 3300005445 | Bacteria | 39351 |
| 71 | Ga0070708_100002949 | 3300005445 | Bacteria | 13227 |
| 72 | Ga0070708_100003924 | 3300005445 | Bacteria | 11681 |
| 73 | Ga0070708_100022080 | 3300005445 | Bacteria | 5394 |
| 74 | Ga0070708_100113948 | 3300005445 | Bacteria | 2487 |
| 75 | Ga0070708_100495932 | 3300005445 | Bacteria | 1152 |
| 76 | Ga0070663_100028694 | 3300005455 | Bacteria | 3792 |
| 77 | Ga0070678_100023075 | 3300005456 | Bacteria | 4139 |
| 78 | Ga0070678_100196038 | 3300005456 | Unclassified | 1664 |
| 79 | Ga0070662_100002426 | 3300005457 | Bacteria | 11463 |
| 80 | Ga0070681_10032433 | 3300005458 | Bacteria | 5242 |
| 81 | Ga0070681_10267513 | 3300005458 | Bacteria | 1621 |
| 82 | Ga0070681_10689449 | 3300005458 | Unclassified | 937 |
| 83 | Ga0068867_100017844 | 3300005459 | Bacteria | 5040 |
| 84 | Ga0070685_10229445 | 3300005466 | Unclassified | 1220 |
| 85 | Ga0070685_10309365 | 3300005466 | Unclassified | 1067 |
| 86 | Ga0070685_10357492 | 3300005466 | Unclassified | 1000 |
| 87 | Ga0070706_100001289 | 3300005467 | Bacteria | 26742 |
| 88 | Ga0070706_100011557 | 3300005467 | Bacteria | 8202 |
| 89 | Ga0070706_101101674 | 3300005467 | Unclassified | 731 |
| 90 | Ga0070707_100010726 | 3300005468 | Bacteria | 8534 |
| 91 | Ga0070707_100140495 | 3300005468 | Bacteria | 2350 |
| 92 | Ga0070707_100175140 | 3300005468 | Bacteria | 2091 |
| 93 | Ga0070698_100000456 | 3300005471 | Bacteria | 43335 |
| 94 | Ga0070698_100226784 | 3300005471 | Bacteria | 1801 |
| 95 | Ga0070698_100782121 | 3300005471 | Unclassified | 898 |
| 96 | Ga0070699_100001799 | 3300005518 | Bacteria | 19484 |
| 97 | Ga0070699_100011106 | 3300005518 | Bacteria | 7785 |
| 98 | Ga0070699_100659643 | 3300005518 | Bacteria | 955 |
| 99 | Ga0070679_100085876 | 3300005530 | Bacteria | 3134 |
| 100 | Ga0070679_100114065 | 3300005530 | Bacteria | 2687 |
| 101 | Ga0070679_100185696 | 3300005530 | Unclassified | 2050 |
| 102 | Ga0070679_100609836 | 3300005530 | Bacteria | 1035 |
| 103 | Ga0070684_100007536 | 3300005535 | Bacteria | 8472 |
| 104 | Ga0070684_100042554 | 3300005535 | Bacteria | 3922 |
| 105 | Ga0070697_100000496 | 3300005536 | Bacteria | 29902 |
| 106 | Ga0070697_100001425 | 3300005536 | Bacteria | 18173 |
| 107 | Ga0070697_100012017 | 3300005536 | Bacteria | 6777 |
| 108 | Ga0070697_100133441 | 3300005536 | Unclassified | 2084 |
| 109 | Ga0070697_100274661 | 3300005536 | Bacteria | 1445 |
| 110 | Ga0070697_100646421 | 3300005536 | Bacteria | 931 |
| 111 | Ga0070697_101174303 | 3300005536 | Unclassified | 684 |
| 112 | Ga0068853_100004992 | 3300005539 | Bacteria | 10340 |
| 113 | Ga0068853_100093998 | 3300005539 | Bacteria | 2641 |
| 114 | Ga0070672_100284088 | 3300005543 | Bacteria | 1400 |
| 115 | Ga0070672_100466070 | 3300005543 | Bacteria | 1090 |
| 116 | Ga0070686_100000633 | 3300005544 | Bacteria | 20506 |
| 117 | Ga0070686_100015085 | 3300005544 | Bacteria | 4467 |
| 118 | Ga0070686_100577302 | 3300005544 | Unclassified | 883 |
| 119 | Ga0070695_100061937 | 3300005545 | Bacteria | 2428 |
| 120 | Ga0070695_100606262 | 3300005545 | Bacteria | 860 |
| 121 | Ga0070696_100289030 | 3300005546 | Bacteria | 1252 |
| 122 | Ga0070693_100153242 | 3300005547 | Bacteria | 1461 |
| 123 | Ga0070693_100218845 | 3300005547 | Unclassified | 1246 |
| 124 | Ga0070665_100204252 | 3300005548 | Unclassified | 1976 |
| 125 | Ga0070704_100013181 | 3300005549 | Bacteria | 5123 |
| 126 | Ga0070704_100832958 | 3300005549 | Bacteria | 826 |
| 127 | Ga0068855_100058865 | 3300005563 | Bacteria | 4497 |
| 128 | Ga0068855_100259717 | 3300005563 | Bacteria | 1935 |
| 129 | Ga0068855_101304626 | 3300005563 | Bacteria | 751 |
| 130 | Ga0070664_100104985 | 3300005564 | Bacteria | 2460 |
| 131 | Ga0070664_100203726 | 3300005564 | Unclassified | 1766 |
| 132 | Ga0068857_100044015 | 3300005577 | Bacteria | 3959 |
| 133 | Ga0068857_100083866 | 3300005577 | Bacteria | 2848 |
| 134 | Ga0068854_100086725 | 3300005578 | Unclassified | 2321 |
| 135 | Ga0068854_100102988 | 3300005578 | Bacteria | 2142 |
| 136 | Ga0068854_100132729 | 3300005578 | Bacteria | 1903 |
| 137 | Ga0068856_100005519 | 3300005614 | Bacteria | 12457 |
| 138 | Ga0068856_100085984 | 3300005614 | Bacteria | 3124 |
| 139 | Ga0068856_100113969 | 3300005614 | Bacteria | 2702 |
| 140 | Ga0068856_100543427 | 3300005614 | Bacteria | 1183 |
| 141 | Ga0068856_101556336 | 3300005614 | Unclassified | 675 |
| 142 | Ga0070702_100831871 | 3300005615 | Bacteria | 717 |
| 143 | Ga0068852_100015752 | 3300005616 | Bacteria | 5877 |
| 144 | Ga0068859_100016880 | 3300005617 | Bacteria | 7327 |
| 145 | Ga0068859_100054585 | 3300005617 | Bacteria | 4019 |
| 146 | Ga0068864_100088024 | 3300005618 | Bacteria | 2735 |
| 147 | Ga0068866_10038699 | 3300005718 | Unclassified | 2350 |
| 148 | Ga0068861_100288922 | 3300005719 | Unclassified | 1415 |
| 149 | Ga0068861_100589762 | 3300005719 | Bacteria | 1018 |
| 150 | Ga0068851_10018270 | 3300005834 | Bacteria | 3377 |
| 151 | Ga0068851_10811982 | 3300005834 | Unclassified | 582 |
| 152 | Ga0068863_100021802 | 3300005841 | Bacteria | 6114 |
| 153 | Ga0068863_100057211 | 3300005841 | Unclassified | 3691 |
| 154 | Ga0068858_100009222 | 3300005842 | Bacteria | 9421 |
| 155 | Ga0068858_100039198 | 3300005842 | Bacteria | 4394 |
| 156 | Ga0068858_100257833 | 3300005842 | Bacteria | 1657 |
| 157 | Ga0068858_100885206 | 3300005842 | Bacteria | 873 |
| 158 | Ga0068860_100055729 | 3300005843 | Bacteria | 3758 |
| 159 | Ga0068860_100222843 | 3300005843 | Unclassified | 1831 |
| 160 | Ga0068860_100392847 | 3300005843 | Bacteria | 1371 |
| 161 | Ga0068860_101311283 | 3300005843 | Bacteria | 745 |
| 162 | Ga0068862_100082071 | 3300005844 | Unclassified | 2797 |
| 163 | Ga0068862_100150397 | 3300005844 | Unclassified | 2072 |
| 164 | Ga0081540_1050975 | 3300005983 | Bacteria | 2050 |
| 165 | Ga0070717_10002245 | 3300006028 | Bacteria | 13546 |
| 166 | Ga0070717_10007223 | 3300006028 | Bacteria | 8240 |
| 167 | Ga0070717_10012058 | 3300006028 | Bacteria | 6584 |
| 168 | Ga0070717_10091269 | 3300006028 | Bacteria | 2572 |
| 169 | Ga0070717_10128373 | 3300006028 | Bacteria | 2178 |
| 170 | Ga0070717_10174963 | 3300006028 | Bacteria | 1868 |
| 171 | Ga0070717_10259412 | 3300006028 | Bacteria | 1537 |
| 172 | Ga0070717_10310932 | 3300006028 | Bacteria | 1402 |
| 173 | Ga0070717_10716656 | 3300006028 | Unclassified | 909 |
| 174 | Ga0070717_10732223 | 3300006028 | Unclassified | 899 |
| 175 | Ga0070715_10332396 | 3300006163 | Unclassified | 824 |
| 176 | Ga0070716_100000526 | 3300006173 | Bacteria | 16009 |
| 177 | Ga0070716_100006587 | 3300006173 | Bacteria | 5677 |
| 178 | Ga0070716_100045220 | 3300006173 | Bacteria | 2471 |
| 179 | Ga0070716_100046064 | 3300006173 | Bacteria | 2452 |
| 180 | Ga0070716_100084109 | 3300006173 | Bacteria | 1907 |
| 181 | Ga0070716_100108924 | 3300006173 | Bacteria | 1713 |
| 182 | Ga0070716_100171595 | 3300006173 | Unclassified | 1416 |
| 183 | Ga0070716_100414168 | 3300006173 | Unclassified | 973 |
| 184 | Ga0070716_100637364 | 3300006173 | Unclassified | 806 |
| 185 | Ga0070712_100000550 | 3300006175 | Bacteria | 21698 |
| 186 | Ga0070712_100000969 | 3300006175 | Bacteria | 17281 |
| 187 | Ga0070712_100008020 | 3300006175 | Bacteria | 6623 |
| 188 | Ga0070712_100008354 | 3300006175 | Bacteria | 6510 |
| 189 | Ga0070712_100049310 | 3300006175 | Unclassified | 2923 |
| 190 | Ga0070712_100309169 | 3300006175 | Bacteria | 1282 |
| 191 | Ga0070712_100635342 | 3300006175 | Unclassified | 906 |
| 192 | Ga0070712_100678283 | 3300006175 | Unclassified | 877 |
| 193 | Ga0097621_100013116 | 3300006237 | Bacteria | 6164 |
| 194 | Ga0097621_100022304 | 3300006237 | Unclassified | 4913 |
| 195 | Ga0097621_100199949 | 3300006237 | Unclassified | 1734 |
| 196 | Ga0097621_100250655 | 3300006237 | Bacteria | 1550 |
| 197 | Ga0097621_100341767 | 3300006237 | Bacteria | 1329 |
| 198 | Ga0097621_101344316 | 3300006237 | Unclassified | 676 |
| 199 | Ga0068871_100030754 | 3300006358 | Bacteria | 4231 |
| 200 | Ga0068871_100047582 | 3300006358 | Bacteria | 3459 |
| 201 | Ga0068871_100061868 | 3300006358 | Bacteria | 3059 |
| 202 | Ga0068871_100601320 | 3300006358 | Bacteria | 1000 |
| 203 | Ga0075433_10005454 | 3300006852 | Bacteria | 9995 |
| 204 | Ga0075434_100000416 | 3300006871 | Bacteria | 31534 |
| 205 | Ga0075434_100321418 | 3300006871 | Bacteria | 1568 |
| 206 | Ga0068865_100024800 | 3300006881 | Bacteria | 3939 |
| 207 | Ga0068865_100067294 | 3300006881 | Unclassified | 2530 |
| 208 | Ga0075436_100006264 | 3300006914 | Bacteria | 8150 |
| 209 | Ga0075436_100049284 | 3300006914 | Bacteria | 2906 |
| 210 | Ga0075436_100063044 | 3300006914 | Unclassified | 2562 |
| 211 | Ga0097620_100016880 | 3300006931 | Bacteria | 7327 |
| 212 | Ga0097620_100054586 | 3300006931 | Bacteria | 4019 |
| 213 | Ga0075435_100018943 | 3300007076 | Bacteria | 5246 |
| 214 | Ga0075435_100025747 | 3300007076 | Bacteria | 4582 |
| 215 | Ga0075435_100445630 | 3300007076 | Bacteria | 1116 |
| 216 | Ga0105250_10281540 | 3300009092 | Unclassified | 716 |
| 217 | Ga0105240_10009649 | 3300009093 | Bacteria | 13651 |
| 218 | Ga0105240_10067816 | 3300009093 | Bacteria | 4421 |
| 219 | Ga0111539_11096966 | 3300009094 | Unclassified | 925 |
| 220 | Ga0105245_10068422 | 3300009098 | Bacteria | 3217 |
| 221 | Ga0105245_10132404 | 3300009098 | Bacteria | 2340 |
| 222 | Ga0105245_10431470 | 3300009098 | Bacteria | 1323 |
| 223 | Ga0105245_10821238 | 3300009098 | Unclassified | 968 |
| 224 | Ga0105247_10013079 | 3300009101 | Bacteria | 4977 |
| 225 | Ga0105247_10078385 | 3300009101 | Unclassified | 2078 |
| 226 | Ga0105247_10121480 | 3300009101 | Bacteria | 1693 |
| 227 | Ga0114129_10150815 | 3300009147 | Bacteria | 3181 |
| 228 | Ga0105241_10006514 | 3300009174 | Bacteria | 8607 |
| 229 | Ga0105241_10022680 | 3300009174 | Bacteria | 4651 |
| 230 | Ga0105241_10161139 | 3300009174 | Bacteria | 1844 |
| 231 | Ga0105241_10555812 | 3300009174 | Bacteria | 1031 |
| 232 | Ga0105242_10116161 | 3300009176 | Bacteria | 2289 |
| 233 | Ga0105248_10006081 | 3300009177 | Bacteria | 13248 |
| 234 | Ga0105248_10102641 | 3300009177 | Bacteria | 3223 |
| 235 | Ga0105248_10161215 | 3300009177 | Bacteria | 2529 |
| 236 | Ga0105237_10027226 | 3300009545 | Bacteria | 5838 |
| 237 | Ga0105237_10036130 | 3300009545 | Unclassified | 4998 |
| 238 | Ga0105237_10201447 | 3300009545 | Bacteria | 1991 |
| 239 | Ga0105237_10217528 | 3300009545 | Unclassified | 1910 |
| 240 | Ga0105237_10401644 | 3300009545 | Bacteria | 1375 |
| 241 | Ga0105238_10022710 | 3300009551 | Bacteria | 6394 |
| 242 | Ga0105238_10023137 | 3300009551 | Bacteria | 6336 |
| 243 | Ga0105238_10140412 | 3300009551 | Bacteria | 2393 |
| 244 | Ga0105238_10155261 | 3300009551 | Bacteria | 2264 |
| 245 | Ga0105238_10240384 | 3300009551 | Bacteria | 1788 |
| 246 | Ga0105249_10004117 | 3300009553 | Bacteria | 12556 |
| 247 | Ga0105239_10014150 | 3300010375 | Bacteria | 8852 |
| 248 | Ga0105239_10135233 | 3300010375 | Bacteria | 2744 |
| 249 | Ga0105246_10037404 | 3300011119 | Unclassified | 3258 |
| 250 | Ga0157373_10145969 | 3300013100 | Bacteria | 1664 |
| 251 | Ga0157373_10147417 | 3300013100 | Bacteria | 1655 |
| 252 | Ga0157371_10011857 | 3300013102 | Bacteria | 6690 |
| 253 | Ga0157371_10180333 | 3300013102 | Bacteria | 1511 |
| 254 | Ga0157371_10464865 | 3300013102 | Unclassified | 931 |
| 255 | Ga0157370_10158132 | 3300013104 | Unclassified | 2108 |
| 256 | Ga0157370_10246814 | 3300013104 | Unclassified | 1651 |
| 257 | Ga0157370_10347078 | 3300013104 | Bacteria | 1368 |
| 258 | Ga0157369_10042263 | 3300013105 | Bacteria | 4973 |
| 259 | Ga0157369_10101196 | 3300013105 | Bacteria | 3071 |
| 260 | Ga0157369_10427651 | 3300013105 | Unclassified | 1373 |
| 261 | Ga0157374_10001092 | 3300013296 | Bacteria | 23356 |
| 262 | Ga0157374_10002984 | 3300013296 | Bacteria | 14164 |
| 263 | Ga0157374_10008704 | 3300013296 | Bacteria | 8680 |
| 264 | Ga0157374_10019060 | 3300013296 | Bacteria | 6070 |
| 265 | Ga0157374_10154667 | 3300013296 | Bacteria | 2231 |
| 266 | Ga0157374_10483781 | 3300013296 | Unclassified | 1241 |
| 267 | Ga0157378_10000151 | 3300013297 | Bacteria | 65215 |
| 268 | Ga0157378_10040368 | 3300013297 | Bacteria | 4138 |
| 269 | Ga0157378_10128829 | 3300013297 | Bacteria | 2340 |
| 270 | Ga0157378_10262763 | 3300013297 | Bacteria | 1657 |
| 271 | Ga0157378_11361619 | 3300013297 | Unclassified | 752 |
| 272 | Ga0163162_10002065 | 3300013306 | Bacteria | 18873 |
| 273 | Ga0163162_10019988 | 3300013306 | Bacteria | 6577 |
| 274 | Ga0163162_10179078 | 3300013306 | Bacteria | 2246 |
| 275 | Ga0157372_10001206 | 3300013307 | Bacteria | 27941 |
| 276 | Ga0157372_10028555 | 3300013307 | Bacteria | 6089 |
| 277 | Ga0157372_10051345 | 3300013307 | Unclassified | 4589 |
| 278 | Ga0157372_10199253 | 3300013307 | Bacteria | 2319 |
| 279 | Ga0157372_10207642 | 3300013307 | Bacteria | 2269 |
| 280 | Ga0157372_10941870 | 3300013307 | Bacteria | 1001 |
| 281 | Ga0157372_12710549 | 3300013307 | Bacteria | 569 |
| 282 | Ga0157375_10214888 | 3300013308 | Unclassified | 2081 |
| 283 | Ga0163163_10123035 | 3300014325 | Bacteria | 2629 |
| 284 | Ga0182008_10145511 | 3300014497 | Bacteria | 1187 |
| 285 | Ga0157377_10086543 | 3300014745 | Bacteria | 1842 |
| 286 | Ga0157379_10006291 | 3300014968 | Bacteria | 10224 |
| 287 | Ga0157379_10015074 | 3300014968 | Bacteria | 6780 |
| 288 | Ga0157379_10016233 | 3300014968 | Bacteria | 6552 |
| 289 | Ga0157379_10099315 | 3300014968 | Unclassified | 2613 |
| 290 | Ga0157376_10122549 | 3300014969 | Bacteria | 2307 |
| 291 | Ga0157376_10382079 | 3300014969 | Unclassified | 1357 |
| 292 | Ga0157376_10699791 | 3300014969 | Unclassified | 1018 |
| 293 | Ga0182006_1018783 | 3300015261 | Bacteria | 2916 |
| 294 | Ga0182007_10021918 | 3300015262 | Bacteria | 2262 |
| 295 | Ga0182005_1009501 | 3300015265 | Bacteria | 2829 |
| 296 | Ga0163161_10487205 | 3300017792 | Unclassified | 1002 |
| 297 | Ga0213874_10174301 | 3300021377 | Bacteria | 762 |
| 298 | Ga0207697_10162063 | 3300025315 | Unclassified | 976 |
| 299 | Ga0207656_10041404 | 3300025321 | Unclassified | 1957 |
| 300 | Ga0207692_10005206 | 3300025898 | Bacteria | 5192 |
| 301 | Ga0207692_10241497 | 3300025898 | Bacteria | 1079 |
| 302 | Ga0207692_10301561 | 3300025898 | Bacteria | 975 |
| 303 | Ga0207680_10041482 | 3300025903 | Bacteria | 2685 |
| 304 | Ga0207647_10007186 | 3300025904 | Bacteria | 8069 |
| 305 | Ga0207685_10206560 | 3300025905 | Bacteria | 926 |
| 306 | Ga0207685_10237773 | 3300025905 | Bacteria | 875 |
| 307 | Ga0207699_10026236 | 3300025906 | Bacteria | 3208 |
| 308 | Ga0207699_10030164 | 3300025906 | Unclassified | 3032 |
| 309 | Ga0207699_10051162 | 3300025906 | Bacteria | 2440 |
| 310 | Ga0207699_10281665 | 3300025906 | Bacteria | 1155 |
| 311 | Ga0207699_10363977 | 3300025906 | Unclassified | 1023 |
| 312 | Ga0207699_10578759 | 3300025906 | Unclassified | 816 |
| 313 | Ga0207699_10907489 | 3300025906 | Unclassified | 650 |
| 314 | Ga0207645_10022895 | 3300025907 | Bacteria | 4060 |
| 315 | Ga0207684_10001754 | 3300025910 | Bacteria | 22933 |
| 316 | Ga0207684_10013315 | 3300025910 | Bacteria | 7115 |
| 317 | Ga0207654_10004043 | 3300025911 | Bacteria | 7383 |
| 318 | Ga0207654_10009332 | 3300025911 | Bacteria | 4980 |
| 319 | Ga0207654_10016406 | 3300025911 | Bacteria | 3857 |
| 320 | Ga0207654_10147618 | 3300025911 | Bacteria | 1506 |
| 321 | Ga0207654_10347267 | 3300025911 | Unclassified | 1021 |
| 322 | Ga0207654_10492266 | 3300025911 | Bacteria | 865 |
| 323 | Ga0207707_10731299 | 3300025912 | Unclassified | 829 |
| 324 | Ga0207695_10045992 | 3300025913 | Bacteria | 4628 |
| 325 | Ga0207695_10460380 | 3300025913 | Bacteria | 1155 |
| 326 | Ga0207695_10991980 | 3300025913 | Unclassified | 720 |
| 327 | Ga0207671_10052188 | 3300025914 | Bacteria | 3030 |
| 328 | Ga0207671_10287990 | 3300025914 | Unclassified | 1296 |
| 329 | Ga0207693_10000362 | 3300025915 | Bacteria | 41574 |
| 330 | Ga0207693_10000457 | 3300025915 | Bacteria | 37236 |
| 331 | Ga0207693_10003882 | 3300025915 | Bacteria | 12729 |
| 332 | Ga0207693_10037771 | 3300025915 | Unclassified | 3805 |
| 333 | Ga0207693_10037868 | 3300025915 | Bacteria | 3801 |
| 334 | Ga0207693_10387258 | 3300025915 | Unclassified | 1093 |
| 335 | Ga0207693_10536329 | 3300025915 | Unclassified | 913 |
| 336 | Ga0207663_10004317 | 3300025916 | Bacteria | 7055 |
| 337 | Ga0207663_10005278 | 3300025916 | Bacteria | 6504 |
| 338 | Ga0207663_10031765 | 3300025916 | Unclassified | 3128 |
| 339 | Ga0207663_10170414 | 3300025916 | Bacteria | 1546 |
| 340 | Ga0207663_10246187 | 3300025916 | Unclassified | 1314 |
| 341 | Ga0207660_10105507 | 3300025917 | Bacteria | 2112 |
| 342 | Ga0207657_10000246 | 3300025919 | Bacteria | 57698 |
| 343 | Ga0207657_10001266 | 3300025919 | Bacteria | 26953 |
| 344 | Ga0207649_10194019 | 3300025920 | Bacteria | 1430 |
| 345 | Ga0207649_10799065 | 3300025920 | Unclassified | 736 |
| 346 | Ga0207652_10070448 | 3300025921 | Bacteria | 3037 |
| 347 | Ga0207652_10225325 | 3300025921 | Unclassified | 1689 |
| 348 | Ga0207646_10002216 | 3300025922 | Bacteria | 23136 |
| 349 | Ga0207646_10812080 | 3300025922 | Unclassified | 832 |
| 350 | Ga0207681_10306667 | 3300025923 | Bacteria | 1258 |
| 351 | Ga0207694_10137574 | 3300025924 | Bacteria | 1963 |
| 352 | Ga0207694_10260560 | 3300025924 | Bacteria | 1420 |
| 353 | Ga0207694_10808101 | 3300025924 | Unclassified | 792 |
| 354 | Ga0207650_10847915 | 3300025925 | Bacteria | 775 |
| 355 | Ga0207687_10011229 | 3300025927 | Bacteria | 5850 |
| 356 | Ga0207687_10329372 | 3300025927 | Unclassified | 1238 |
| 357 | Ga0207687_10567599 | 3300025927 | Unclassified | 953 |
| 358 | Ga0207700_10000528 | 3300025928 | Bacteria | 22511 |
| 359 | Ga0207700_10030361 | 3300025928 | Unclassified | 3827 |
| 360 | Ga0207700_10136256 | 3300025928 | Bacteria | 2011 |
| 361 | Ga0207700_10177585 | 3300025928 | Unclassified | 1780 |
| 362 | Ga0207700_10195776 | 3300025928 | Bacteria | 1701 |
| 363 | Ga0207700_10339977 | 3300025928 | Unclassified | 1305 |
| 364 | Ga0207700_10651653 | 3300025928 | Unclassified | 939 |
| 365 | Ga0207700_11115995 | 3300025928 | Unclassified | 705 |
| 366 | Ga0207664_10068294 | 3300025929 | Unclassified | 2855 |
| 367 | Ga0207664_10081835 | 3300025929 | Bacteria | 2629 |
| 368 | Ga0207664_10455043 | 3300025929 | Unclassified | 1143 |
| 369 | Ga0207664_10466375 | 3300025929 | Unclassified | 1128 |
| 370 | Ga0207664_10641495 | 3300025929 | Unclassified | 954 |
| 371 | Ga0207664_10885864 | 3300025929 | Unclassified | 802 |
| 372 | Ga0207644_10183242 | 3300025931 | Bacteria | 1642 |
| 373 | Ga0207644_10980717 | 3300025931 | Unclassified | 709 |
| 374 | Ga0207690_10010651 | 3300025932 | Bacteria | 5478 |
| 375 | Ga0207706_10000139 | 3300025933 | Bacteria | 79096 |
| 376 | Ga0207686_10089477 | 3300025934 | Bacteria | 2029 |
| 377 | Ga0207709_10171480 | 3300025935 | Unclassified | 1523 |
| 378 | Ga0207670_10086519 | 3300025936 | Unclassified | 2206 |
| 379 | Ga0207704_10195188 | 3300025938 | Unclassified | 1476 |
| 380 | Ga0207665_10000281 | 3300025939 | Bacteria | 35365 |
| 381 | Ga0207665_10002897 | 3300025939 | Bacteria | 11511 |
| 382 | Ga0207665_10060910 | 3300025939 | Bacteria | 2557 |
| 383 | Ga0207665_10067516 | 3300025939 | Bacteria | 2435 |
| 384 | Ga0207665_10146092 | 3300025939 | Unclassified | 1690 |
| 385 | Ga0207665_10148243 | 3300025939 | Unclassified | 1678 |
| 386 | Ga0207665_10155654 | 3300025939 | Unclassified | 1640 |
| 387 | Ga0207665_10756454 | 3300025939 | Bacteria | 766 |
| 388 | Ga0207665_10917858 | 3300025939 | Bacteria | 695 |
| 389 | Ga0207691_10459555 | 3300025940 | Bacteria | 1083 |
| 390 | Ga0207691_10521745 | 3300025940 | Bacteria | 1008 |
| 391 | Ga0207711_10011787 | 3300025941 | Bacteria | 7263 |
| 392 | Ga0207711_10189569 | 3300025941 | Bacteria | 1873 |
| 393 | Ga0207711_10319858 | 3300025941 | Bacteria | 1434 |
| 394 | Ga0207711_11335610 | 3300025941 | Bacteria | 659 |
| 395 | Ga0207689_10001053 | 3300025942 | Bacteria | 26527 |
| 396 | Ga0207689_10064306 | 3300025942 | Unclassified | 3019 |
| 397 | Ga0207679_10027166 | 3300025945 | Bacteria | 3955 |
| 398 | Ga0207679_10040898 | 3300025945 | Bacteria | 3321 |
| 399 | Ga0207667_10004029 | 3300025949 | Bacteria | 18047 |
| 400 | Ga0207667_10311841 | 3300025949 | Bacteria | 1607 |
| 401 | Ga0207667_10524786 | 3300025949 | Unclassified | 1199 |
| 402 | Ga0207667_11118186 | 3300025949 | Bacteria | 770 |
| 403 | Ga0207651_10657041 | 3300025960 | Bacteria | 921 |
| 404 | Ga0207712_10024542 | 3300025961 | Bacteria | 3995 |
| 405 | Ga0207668_10454113 | 3300025972 | Unclassified | 1094 |
| 406 | Ga0207640_10036120 | 3300025981 | Bacteria | 3099 |
| 407 | Ga0207640_10078421 | 3300025981 | Unclassified | 2248 |
| 408 | Ga0207640_10218202 | 3300025981 | Bacteria | 1458 |
| 409 | Ga0207658_10041406 | 3300025986 | Bacteria | 3335 |
| 410 | Ga0207658_10496255 | 3300025986 | Unclassified | 1087 |
| 411 | Ga0207658_10873932 | 3300025986 | Bacteria | 818 |
| 412 | Ga0207677_10005049 | 3300026023 | Bacteria | 7132 |
| 413 | Ga0207677_10057478 | 3300026023 | Bacteria | 2671 |
| 414 | Ga0207677_10372891 | 3300026023 | Unclassified | 1202 |
| 415 | Ga0207703_10001863 | 3300026035 | Bacteria | 18753 |
| 416 | Ga0207703_10160535 | 3300026035 | Unclassified | 1968 |
| 417 | Ga0207703_10166493 | 3300026035 | Bacteria | 1935 |
| 418 | Ga0207639_10200155 | 3300026041 | Bacteria | 1712 |
| 419 | Ga0207639_10223963 | 3300026041 | Bacteria | 1626 |
| 420 | Ga0207639_10325450 | 3300026041 | Unclassified | 1366 |
| 421 | Ga0207678_10004676 | 3300026067 | Bacteria | 12295 |
| 422 | Ga0207678_10283047 | 3300026067 | Bacteria | 1423 |
| 423 | Ga0207702_10014881 | 3300026078 | Bacteria | 6453 |
| 424 | Ga0207702_10016745 | 3300026078 | Bacteria | 6067 |
| 425 | Ga0207702_10028337 | 3300026078 | Bacteria | 4655 |
| 426 | Ga0207702_10097171 | 3300026078 | Bacteria | 2592 |
| 427 | Ga0207702_10145508 | 3300026078 | Bacteria | 2150 |
| 428 | Ga0207702_10847822 | 3300026078 | Bacteria | 904 |
| 429 | Ga0207702_12191879 | 3300026078 | Unclassified | 541 |
| 430 | Ga0207641_10026028 | 3300026088 | Bacteria | 4827 |
| 431 | Ga0207641_10078652 | 3300026088 | Unclassified | 2857 |
| 432 | Ga0207641_10875878 | 3300026088 | Unclassified | 891 |
| 433 | Ga0207648_10003612 | 3300026089 | Bacteria | 16172 |
| 434 | Ga0207676_10114539 | 3300026095 | Bacteria | 2262 |
| 435 | Ga0207674_10009505 | 3300026116 | Bacteria | 11102 |
| 436 | Ga0207674_10049003 | 3300026116 | Bacteria | 4322 |
| 437 | Ga0207675_100112550 | 3300026118 | Unclassified | 2569 |
| 438 | Ga0207675_100246773 | 3300026118 | Bacteria | 1727 |
| 439 | Ga0207675_100252047 | 3300026118 | Bacteria | 1709 |
| 440 | Ga0207683_10121435 | 3300026121 | Unclassified | 2346 |
| 441 | Ga0207683_10554141 | 3300026121 | Bacteria | 1063 |
| 442 | Ga0207683_11497712 | 3300026121 | Bacteria | 623 |
| 443 | Ga0207698_10044147 | 3300026142 | Bacteria | 3346 |
| 444 | Ga0268266_10120411 | 3300028379 | Unclassified | 2335 |
| 445 | Ga0268265_10063459 | 3300028380 | Unclassified | 2842 |
| 446 | Ga0268265_10079197 | 3300028380 | Unclassified | 2587 |
| 447 | Ga0268264_10106135 | 3300028381 | Unclassified | 2451 |
| 448 | Ga0268264_10242987 | 3300028381 | Unclassified | 1668 |
| 449 | Ga0265338_10038645 | 3300028800 | Unclassified | 4517 |
| 450 | Ga0265338_10142086 | 3300028800 | Bacteria | 1879 |
| 451 | Ga0265773_1022057 | 3300031018 | Unclassified | 634 |
| 452 | Ga0265760_10066621 | 3300031090 | Unclassified | 1100 |
| 453 | Ga0265330_10044813 | 3300031235 | Bacteria | 1952 |
| 454 | Ga0265320_10282780 | 3300031240 | Unclassified | 735 |
| 455 | Ga0265325_10002327 | 3300031241 | Bacteria | 12890 |
| 456 | Ga0265325_10156088 | 3300031241 | Bacteria | 1076 |
| 457 | Ga0265316_10026020 | 3300031344 | Bacteria | 4875 |
| 458 | Ga0307408_100203117 | 3300031548 | Bacteria | 1605 |
| 459 | Ga0265314_10233646 | 3300031711 | Bacteria | 1065 |
| 460 | Ga0307405_10191915 | 3300031731 | Bacteria | 1476 |
| 461 | Ga0307410_10117580 | 3300031852 | Bacteria | 1933 |
| 462 | Ga0307406_10040090 | 3300031901 | Unclassified | 2910 |
| 463 | Ga0307407_10043039 | 3300031903 | Bacteria | 2536 |
| 464 | Ga0307411_10020125 | 3300032005 | Unclassified | 3873 |
| 465 | Ga0307415_100147613 | 3300032126 | Bacteria | 1805 |
| 466 | Ga0373928_0011668 | 3300035084 | Bacteria | 1744 |
| 467 | Ga0373951_0031557 | 3300035091 | Bacteria | 1250 |
| 468 | Ga0373936_0016526 | 3300035113 | Bacteria | 2839 |
| 469 | Ga0373936_0039064 | 3300035113 | Bacteria | 1898 |
| 470 | Ga0373936_0161853 | 3300035113 | Bacteria | 975 |
| 471 | Ga0373941_0506490 | 3300035115 | Unclassified | 514 |
| 472 | Ga0373945_0039365 | 3300035116 | Bacteria | 1704 |
| 473 | Ga0373945_0100915 | 3300035116 | Unclassified | 1129 |
| 474 | Ga0373943_0013463 | 3300035170 | Bacteria | 3695 |
| 475 | Ga0373943_0085500 | 3300035170 | Bacteria | 1625 |
| 476 | Ga0373943_0114633 | 3300035170 | Bacteria | 1426 |
| 477 | Ga0373943_0797339 | 3300035170 | Unclassified | 562 |
| 478 | Ga0373946_0079993 | 3300035171 | Bacteria | 1429 |
| 479 | Ga0373955_0247267 | 3300035172 | Bacteria | 1069 |
| 480 | Ga0373961_0228491 | 3300035241 | Unclassified | 666 |
| 481 | Ga0373962_0197863 | 3300035242 | Bacteria | 679 |
| 482 | Ga0373931_0052209 | 3300035691 | Unclassified | 2179 |
| 483 | Ga0373931_0064157 | 3300035691 | Bacteria | 1987 |
| 484 | Ga0373931_0246544 | 3300035691 | Bacteria | 1085 |
| 485 | Ga0373935_0016193 | 3300035692 | Bacteria | 4512 |
| 486 | Ga0373935_0034720 | 3300035692 | Bacteria | 3145 |
| 487 | Ga0373927_0016852 | 3300035695 | Unclassified | 4818 |
| 488 | Ga0373927_0117903 | 3300035695 | Unclassified | 1732 |
| 489 | Ga0373927_1039742 | 3300035695 | Unclassified | 540 |
| 490 | Ga0373933_0253547 | 3300035724 | Unclassified | 1133 |
| 491 | Ga0373933_0256573 | 3300035724 | Unclassified | 1127 |
| 492 | Ga0373947_0025855 | 3300035725 | Bacteria | 3425 |
| 493 | Ga0373947_0121902 | 3300035725 | Unclassified | 1657 |
| 494 | Ga0373937_0035986 | 3300036401 | Bacteria | 4510 |
| 495 | Ga0373937_0138139 | 3300036401 | Bacteria | 2279 |
| 496 | Ga0373937_0241999 | 3300036401 | Bacteria | 1700 |
| 497 | Ga0373937_0378841 | 3300036401 | Unclassified | 1342 |
| 498 | Ga0373937_0721102 | 3300036401 | Bacteria | 944 |
| 499 | Ga0373925_0001086 | 3300037068 | Bacteria | 24439 |
| 500 | Ga0373925_0031457 | 3300037068 | Unclassified | 3900 |
| 501 | Ga0373925_0414160 | 3300037068 | Unclassified | 1100 |
| 502 | Ga0373925_0688099 | 3300037068 | Unclassified | 843 |
| 503 | Ga0373925_1113030 | 3300037068 | Unclassified | 650 |
| 504 | Ga0395898_0302118 | 3300037466 | Bacteria | 1527 |
| 505 | Ga0395898_0337093 | 3300037466 | Bacteria | 1438 |
| 506 | Ga0395905_1201646 | 3300037471 | Unclassified | 662 |
| 507 | Ga0436364_0731791 | 3300037853 | Unclassified | 1375 |
| 508 | Ga0395901_1265249 | 3300038443 | Unclassified | 701 |
| 509 | Ga0395901_1581680 | 3300038443 | Unclassified | 609 |
| 510 | Ga0436365_0870896 | 3300039437 | Unclassified | 745 |
| 511 | Ga0436360_1079114 | 3300039438 | Bacteria | 569 |
| 512 | Ga0436363_0581010 | 3300039450 | Bacteria | 1417 |
| 513 | Ga0436363_0701884 | 3300039450 | Bacteria | 3611 |
| 514 | Ga0436363_1291424 | 3300039450 | Unclassified | 1559 |
| 515 | Ga0436362_0501176 | 3300039453 | Bacteria | 513 |
| 516 | Ga0451853_1623157 | 3300041512 | Bacteria | 1096 |
| 517 | Ga0451577_0000157 | 3300042876 | Bacteria | 151953 |
| 518 | Ga0451577_1083076 | 3300042876 | Unclassified | 718 |
| 519 | Ga0453683_0036319 | 3300044673 | Bacteria | 3101 |
| 520 | Ga0453684_0000686 | 3300044712 | Bacteria | 120659 |
| 521 | Ga0453684_1251295 | 3300044712 | Unclassified | 777 |
| 522 | Ga0451576_0065280 | 3300045051 | Bacteria | 3790 |
| 523 | Ga0451576_0236473 | 3300045051 | Unclassified | 1908 |
| 524 | Ga0451576_0279170 | 3300045051 | Bacteria | 1747 |
| 525 | Ga0466967_0032045 | 3300045976 | Bacteria | 4434 |
| 526 | Ga0495603_0377504 | 3300046455 | Unclassified | 813 |
| 527 | Ga0495629_0107727 | 3300046459 | Bacteria | 1944 |
| 528 | Ga0495641_0429074 | 3300046461 | Unclassified | 600 |
| 529 | Ga0495580_0003182 | 3300046472 | Bacteria | 14071 |
| 530 | Ga0495580_0005751 | 3300046472 | Bacteria | 10184 |
| 531 | Ga0495580_0008637 | 3300046472 | Bacteria | 8080 |
| 532 | Ga0495580_0015718 | 3300046472 | Bacteria | 5703 |
| 533 | Ga0495580_0037477 | 3300046472 | Bacteria | 3480 |
| 534 | Ga0495580_0318257 | 3300046472 | Unclassified | 1058 |
| 535 | Ga0495580_0357905 | 3300046472 | Bacteria | 988 |
| 536 | Ga0495580_0635978 | 3300046472 | Unclassified | 703 |
| 537 | Ga0495580_0962831 | 3300046472 | Unclassified | 546 |
| 538 | Ga0495582_0001766 | 3300046473 | Bacteria | 12202 |
| 539 | Ga0495582_0018863 | 3300046473 | Bacteria | 3772 |
| 540 | Ga0495582_0031347 | 3300046473 | Unclassified | 2922 |
| 541 | Ga0495639_0075273 | 3300046475 | Bacteria | 1565 |
| 542 | Ga0495662_0076804 | 3300046476 | Unclassified | 1622 |
| 543 | Ga0495662_0273111 | 3300046476 | Unclassified | 832 |
| 544 | Ga0495618_0600212 | 3300046514 | Unclassified | 655 |
| 545 | Ga0495630_0523832 | 3300046517 | Unclassified | 909 |
| 546 | Ga0495630_0866496 | 3300046517 | Bacteria | 688 |
| 547 | Ga0495666_0213362 | 3300046526 | Unclassified | 885 |
| 548 | Ga0495665_0010815 | 3300046531 | Unclassified | 4938 |
| 549 | Ga0495665_0080543 | 3300046531 | Bacteria | 1713 |
| 550 | Ga0495665_0320919 | 3300046531 | Bacteria | 791 |
| 551 | Ga0495586_0002383 | 3300046535 | Bacteria | 10201 |
| 552 | Ga0495586_0450178 | 3300046535 | Unclassified | 742 |
| 553 | Ga0495667_0256731 | 3300046559 | Bacteria | 1112 |
| 554 | Ga0495634_0351602 | 3300046642 | Unclassified | 882 |
| 555 | Ga0495659_0011691 | 3300046664 | Unclassified | 2830 |
| 556 | Ga0495659_0168692 | 3300046664 | Bacteria | 887 |
| 557 | Ga0495623_0024206 | 3300046679 | Bacteria | 3916 |
| 558 | Ga0495623_0076913 | 3300046679 | Bacteria | 2071 |
| 559 | Ga0495658_0028030 | 3300046683 | Unclassified | 3036 |
| 560 | Ga0495658_0862375 | 3300046683 | Bacteria | 579 |
| 561 | Ga0495669_0245136 | 3300046684 | Bacteria | 860 |
| 562 | Ga0495613_0139230 | 3300046689 | Unclassified | 1735 |
| 563 | Ga0495613_0160396 | 3300046689 | Unclassified | 1600 |
| 564 | Ga0495624_0389335 | 3300046690 | Unclassified | 837 |
| 565 | Ga0495624_0746062 | 3300046690 | Unclassified | 580 |
| 566 | Ga0495649_0680449 | 3300046694 | Bacteria | 505 |
| 567 | Ga0495581_0028314 | 3300047315 | Unclassified | 3248 |
| 568 | Ga0495674_0071711 | 3300047319 | Unclassified | 2989 |
| 569 | Ga0495674_0557278 | 3300047319 | Bacteria | 912 |
| 570 | Ga0495675_0039141 | 3300047444 | Bacteria | 3019 |
| 571 | Ga0495602_0055511 | 3300048088 | Bacteria | 3488 |
| 572 | Ga0495602_0120440 | 3300048088 | Bacteria | 2112 |
| 573 | Ga0496100_0003857 | 3300048903 | Bacteria | 7862 |
| 574 | Ga0496100_0130159 | 3300048903 | Bacteria | 1772 |
| 575 | Ga0496101_0003461 | 3300048904 | Bacteria | 9848 |
| 576 | Ga0496101_0421128 | 3300048904 | Bacteria | 1053 |
| 577 | Ga0496101_0514226 | 3300048904 | Unclassified | 946 |
| 578 | Ga0496101_1239157 | 3300048904 | Unclassified | 584 |
| 579 | Ga0496102_0000537 | 3300048905 | Bacteria | 40994 |
| 580 | Ga0496102_0048587 | 3300048905 | Bacteria | 3858 |
| 581 | Ga0496102_0348965 | 3300048905 | Unclassified | 1393 |
| 582 | Ga0496103_0010438 | 3300048906 | Bacteria | 5496 |
| 583 | Ga0496103_0011600 | 3300048906 | Bacteria | 5225 |
| 584 | Ga0496103_0053924 | 3300048906 | Unclassified | 2492 |
| 585 | Ga0496104_0035988 | 3300048907 | Bacteria | 4625 |
| 586 | Ga0496104_0043663 | 3300048907 | Bacteria | 4210 |
| 587 | Ga0496104_0050923 | 3300048907 | Bacteria | 3907 |
| 588 | Ga0496104_0305183 | 3300048907 | Unclassified | 1504 |
| 589 | Ga0496104_0425768 | 3300048907 | Bacteria | 1239 |
| 590 | Ga0496104_0863524 | 3300048907 | Unclassified | 810 |
| 591 | Ga0496105_0031508 | 3300048908 | Unclassified | 4347 |
| 592 | Ga0496105_0114955 | 3300048908 | Bacteria | 2220 |
| 593 | Ga0496106_0062827 | 3300048909 | Unclassified | 2821 |
| 594 | Ga0496106_0097339 | 3300048909 | Unclassified | 2278 |
| 595 | Ga0496106_0113740 | 3300048909 | Bacteria | 2110 |
| 596 | Ga0496106_0196932 | 3300048909 | Unclassified | 1603 |
| 597 | Ga0496107_0227295 | 3300048910 | Unclassified | 1388 |
| 598 | Ga0496107_0655022 | 3300048910 | Bacteria | 774 |
| 599 | Ga0496108_0035693 | 3300048911 | Bacteria | 4134 |
| 600 | Ga0496108_0094357 | 3300048911 | Unclassified | 2547 |
| 601 | Ga0496108_0478731 | 3300048911 | Unclassified | 1088 |
| 602 | Ga0496109_0039890 | 3300048912 | Bacteria | 4251 |
| 603 | Ga0496109_0184031 | 3300048912 | Bacteria | 1963 |
| 604 | Ga0496109_0209122 | 3300048912 | Unclassified | 1835 |
| 605 | Ga0496110_0051224 | 3300048913 | Bacteria | 3628 |
| 606 | Ga0496111_0014712 | 3300048914 | Bacteria | 5352 |
| 607 | Ga0496111_0297310 | 3300048914 | Unclassified | 1197 |
| 608 | Ga0496112_0001099 | 3300048915 | Bacteria | 20026 |
| 609 | Ga0496112_0013062 | 3300048915 | Bacteria | 7661 |
| 610 | Ga0496112_0037620 | 3300048915 | Bacteria | 4723 |
| 611 | Ga0496112_0050195 | 3300048915 | Bacteria | 4090 |
| 612 | Ga0496112_0082762 | 3300048915 | Bacteria | 3174 |
| 613 | Ga0496113_0113103 | 3300048916 | Bacteria | 2115 |
| 614 | Ga0496113_0274758 | 3300048916 | Unclassified | 1347 |
| 615 | Ga0496114_0028113 | 3300048917 | Bacteria | 4612 |
| 616 | Ga0496115_0004624 | 3300048918 | Bacteria | 9960 |
| 617 | Ga0496115_0016349 | 3300048918 | Bacteria | 5648 |
| 618 | nmdc:mga05p37_154518_c1 | 3300050507 | Bacteria | 2805 |
| 619 | nmdc:mga0n895_459_c1 | 3300050512 | Bacteria | 27275 |
| 620 | nmdc:mga0rr50_1097345_c1 | 3300050513 | Unclassified | 677 |
| 621 | nmdc:mga0rr50_34917_c1 | 3300050513 | Unclassified | 3606 |
| 622 | nmdc:mga0rr50_392022_c1 | 3300050513 | Unclassified | 1172 |
| 623 | nmdc:mga0rr50_8978_c1 | 3300050513 | Bacteria | 6253 |
| 624 | nmdc:mga08x19_18527_c1 | 3300050514 | Unclassified | 4267 |
| 625 | nmdc:mga08x19_45921_c1 | 3300050514 | Bacteria | 2792 |
| 626 | nmdc:mga08x19_6888_c1 | 3300050514 | Bacteria | 6749 |
| 627 | nmdc:mga0a205_20163_c1 | 3300050515 | Bacteria | 6289 |
| 628 | Ga0495601_0588585 | 3300053077 | Unclassified | 714 |
| 629 | Ga0495595_0119575 | 3300053084 | Bacteria | 1283 |
| 630 | Ga0070714_100600610 | |||
| 631 | MBSR1b_contig_2190678 | |||
| 632 | MBSR1b_contig_3904799 | |||
| 633 | rootH1_10376184 | |||
| 634 | Ga0065712_10114404 | |||
| 635 | Ga0065715_10225510 | |||
| 636 | Ga0070676_10041193 | |||
| 637 | Ga0070683_100061135 | |||
| 638 | Ga0070690_100005791 | |||
| 639 | Ga0070690_100070525 | |||
| 640 | Ga0070690_100151103 | |||
| 641 | Ga0070677_10304308 | |||
| 642 | Ga0068869_100001662 | |||
| 643 | Ga0068869_100125000 | |||
| 644 | Ga0070680_100089406 | |||
| 645 | Ga0070682_100882074 | |||
| 646 | Ga0068868_100001388 | |||
| 647 | Ga0068868_100059864 | |||
| 648 | Ga0068868_100082544 | |||
| 649 | Ga0070660_100006387 | |||
| 650 | Ga0070689_100252173 | |||
| 651 | Ga0070691_10075503 | |||
| 652 | Ga0070661_100013353 | |||
| 653 | Ga0070692_10432210 | |||
| 654 | Ga0070668_100044886 | |||
| 655 | Ga0070675_100167505 | |||
| 656 | Ga0070675_101598374 | |||
| 657 | Ga0070671_100303127 | |||
| 658 | Ga0070671_101148744 | |||
| 659 | Ga0070674_100298065 | |||
| 660 | Ga0070673_100542018 | |||
| 661 | Ga0070659_100017607 | |||
| 662 | Ga0070659_100102405 | |||
| 663 | Ga0070667_100060743 | |||
| 664 | Ga0070667_100160758 | |||
| 665 | Ga0070667_100978188 | |||
| 666 | Ga0070709_10064008 | |||
| 667 | Ga0070709_10106736 | |||
| 668 | Ga0070709_10129489 | |||
| 669 | Ga0070709_10226545 | |||
| 670 | Ga0070709_10242718 | |||
| 671 | Ga0070714_100002082 | |||
| 672 | Ga0070714_100070692 | |||
| 673 | Ga0070714_100081772 | |||
| 674 | Ga0070714_100877836 | |||
| 675 | Ga0070713_100001170 | |||
| 676 | Ga0070713_100041393 | |||
| 677 | Ga0070713_100053651 | |||
| 678 | Ga0070713_100085962 | |||
| 679 | Ga0070713_100115254 | |||
| 680 | Ga0070713_100149931 | |||
| 681 | Ga0070713_100155486 | |||
| 682 | Ga0070713_100215311 | |||
| 683 | Ga0070713_100254257 | |||
| 684 | Ga0070713_100478045 | |||
| 685 | Ga0070713_100530545 | |||
| 686 | Ga0070713_100632519 | |||
| 687 | Ga0070710_10199946 | |||
| 688 | Ga0070710_11523605 | |||
| 689 | Ga0070701_10712957 | |||
| 690 | Ga0070711_100003108 | |||
| 691 | Ga0070711_100006478 | |||
| 692 | Ga0070711_100089177 | |||
| 693 | Ga0070711_100146764 | |||
| 694 | Ga0070705_100080322 | |||
| 695 | Ga0070705_100649900 | |||
| 696 | Ga0070694_100002781 | |||
| 697 | Ga0070694_100105575 | |||
| 698 | Ga0070694_100457083 | |||
| 699 | Ga0070708_100000263 | |||
| 700 | Ga0070708_100002949 | |||
| 701 | Ga0070708_100003924 | |||
| 702 | Ga0070708_100022080 | |||
| 703 | Ga0070708_100113948 | |||
| 704 | Ga0070708_100495932 | |||
| 705 | Ga0070663_100028694 | |||
| 706 | Ga0070678_100023075 | |||
| 707 | Ga0070678_100196038 | |||
| 708 | Ga0070662_100002426 | |||
| 709 | Ga0070681_10032433 | |||
| 710 | Ga0070681_10267513 | |||
| 711 | Ga0070681_10689449 | |||
| 712 | Ga0068867_100017844 | |||
| 713 | Ga0070685_10229445 | |||
| 714 | Ga0070685_10309365 | |||
| 715 | Ga0070685_10357492 | |||
| 716 | Ga0070706_100001289 | |||
| 717 | Ga0070706_100011557 | |||
| 718 | Ga0070706_101101674 | |||
| 719 | Ga0070707_100010726 | |||
| 720 | Ga0070707_100140495 | |||
| 721 | Ga0070707_100175140 | |||
| 722 | Ga0070698_100000456 | |||
| 723 | Ga0070698_100226784 | |||
| 724 | Ga0070698_100782121 | |||
| 725 | Ga0070699_100001799 | |||
| 726 | Ga0070699_100011106 | |||
| 727 | Ga0070699_100659643 | |||
| 728 | Ga0070679_100085876 | |||
| 729 | Ga0070679_100114065 | |||
| 730 | Ga0070679_100185696 | |||
| 731 | Ga0070679_100609836 | |||
| 732 | Ga0070684_100007536 | |||
| 733 | Ga0070684_100042554 | |||
| 734 | Ga0070697_100000496 | |||
| 735 | Ga0070697_100001425 | |||
| 736 | Ga0070697_100012017 | |||
| 737 | Ga0070697_100133441 | |||
| 738 | Ga0070697_100274661 | |||
| 739 | Ga0070697_100646421 | |||
| 740 | Ga0070697_101174303 | |||
| 741 | Ga0068853_100004992 | |||
| 742 | Ga0068853_100093998 | |||
| 743 | Ga0070672_100284088 | |||
| 744 | Ga0070672_100466070 | |||
| 745 | Ga0070686_100000633 | |||
| 746 | Ga0070686_100015085 | |||
| 747 | Ga0070686_100577302 | |||
| 748 | Ga0070695_100061937 | |||
| 749 | Ga0070695_100606262 | |||
| 750 | Ga0070696_100289030 | |||
| 751 | Ga0070693_100153242 | |||
| 752 | Ga0070693_100218845 | |||
| 753 | Ga0070665_100204252 | |||
| 754 | Ga0070704_100013181 | |||
| 755 | Ga0070704_100832958 | |||
| 756 | Ga0068855_100058865 | |||
| 757 | Ga0068855_100259717 | |||
| 758 | Ga0068855_101304626 | |||
| 759 | Ga0070664_100104985 | |||
| 760 | Ga0070664_100203726 | |||
| 761 | Ga0068857_100044015 | |||
| 762 | Ga0068857_100083866 | |||
| 763 | Ga0068854_100086725 | |||
| 764 | Ga0068854_100102988 | |||
| 765 | Ga0068854_100132729 | |||
| 766 | Ga0068856_100005519 | |||
| 767 | Ga0068856_100085984 | |||
| 768 | Ga0068856_100113969 | |||
| 769 | Ga0068856_100543427 | |||
| 770 | Ga0068856_101556336 | |||
| 771 | Ga0070702_100831871 | |||
| 772 | Ga0068852_100015752 | |||
| 773 | Ga0068859_100016880 | |||
| 774 | Ga0068859_100054585 | |||
| 775 | Ga0068864_100088024 | |||
| 776 | Ga0068866_10038699 | |||
| 777 | Ga0068861_100288922 | |||
| 778 | Ga0068861_100589762 | |||
| 779 | Ga0068851_10018270 | |||
| 780 | Ga0068851_10811982 | |||
| 781 | Ga0068863_100021802 | |||
| 782 | Ga0068863_100057211 | |||
| 783 | Ga0068858_100009222 | |||
| 784 | Ga0068858_100039198 | |||
| 785 | Ga0068858_100257833 | |||
| 786 | Ga0068858_100885206 | |||
| 787 | Ga0068860_100055729 | |||
| 788 | Ga0068860_100222843 | |||
| 789 | Ga0068860_100392847 | |||
| 790 | Ga0068860_101311283 | |||
| 791 | Ga0068862_100082071 | |||
| 792 | Ga0068862_100150397 | |||
| 793 | Ga0081540_1050975 | |||
| 794 | Ga0070717_10002245 | |||
| 795 | Ga0070717_10007223 | |||
| 796 | Ga0070717_10012058 | |||
| 797 | Ga0070717_10091269 | |||
| 798 | Ga0070717_10128373 | |||
| 799 | Ga0070717_10174963 | |||
| 800 | Ga0070717_10259412 | |||
| 801 | Ga0070717_10310932 | |||
| 802 | Ga0070717_10716656 | |||
| 803 | Ga0070717_10732223 | |||
| 804 | Ga0070715_10332396 | |||
| 805 | Ga0070716_100000526 | |||
| 806 | Ga0070716_100006587 | |||
| 807 | Ga0070716_100045220 | |||
| 808 | Ga0070716_100046064 | |||
| 809 | Ga0070716_100084109 | |||
| 810 | Ga0070716_100108924 | |||
| 811 | Ga0070716_100171595 | |||
| 812 | Ga0070716_100414168 | |||
| 813 | Ga0070716_100637364 | |||
| 814 | Ga0070712_100000550 | |||
| 815 | Ga0070712_100000969 | |||
| 816 | Ga0070712_100008020 | |||
| 817 | Ga0070712_100008354 | |||
| 818 | Ga0070712_100049310 | |||
| 819 | Ga0070712_100309169 | |||
| 820 | Ga0070712_100635342 | |||
| 821 | Ga0070712_100678283 | |||
| 822 | Ga0097621_100013116 | |||
| 823 | Ga0097621_100022304 | |||
| 824 | Ga0097621_100199949 | |||
| 825 | Ga0097621_100250655 | |||
| 826 | Ga0097621_100341767 | |||
| 827 | Ga0097621_101344316 | |||
| 828 | Ga0068871_100030754 | |||
| 829 | Ga0068871_100047582 | |||
| 830 | Ga0068871_100061868 | |||
| 831 | Ga0068871_100601320 | |||
| 832 | Ga0075433_10005454 | |||
| 833 | Ga0075434_100000416 | |||
| 834 | Ga0075434_100321418 | |||
| 835 | Ga0068865_100024800 | |||
| 836 | Ga0068865_100067294 | |||
| 837 | Ga0075436_100006264 | |||
| 838 | Ga0075436_100049284 | |||
| 839 | Ga0075436_100063044 | |||
| 840 | Ga0097620_100016880 | |||
| 841 | Ga0097620_100054586 | |||
| 842 | Ga0075435_100018943 | |||
| 843 | Ga0075435_100025747 | |||
| 844 | Ga0075435_100445630 | |||
| 845 | Ga0105250_10281540 | |||
| 846 | Ga0105240_10009649 | |||
| 847 | Ga0105240_10067816 | |||
| 848 | Ga0111539_11096966 | |||
| 849 | Ga0105245_10068422 | |||
| 850 | Ga0105245_10132404 | |||
| 851 | Ga0105245_10431470 | |||
| 852 | Ga0105245_10821238 | |||
| 853 | Ga0105247_10013079 | |||
| 854 | Ga0105247_10078385 | |||
| 855 | Ga0105247_10121480 | |||
| 856 | Ga0114129_10150815 | |||
| 857 | Ga0105241_10006514 | |||
| 858 | Ga0105241_10022680 | |||
| 859 | Ga0105241_10161139 | |||
| 860 | Ga0105241_10555812 | |||
| 861 | Ga0105242_10116161 | |||
| 862 | Ga0105248_10006081 | |||
| 863 | Ga0105248_10102641 | |||
| 864 | Ga0105248_10161215 | |||
| 865 | Ga0105237_10027226 | |||
| 866 | Ga0105237_10036130 | |||
| 867 | Ga0105237_10201447 | |||
| 868 | Ga0105237_10217528 | |||
| 869 | Ga0105237_10401644 | |||
| 870 | Ga0105238_10022710 | |||
| 871 | Ga0105238_10023137 | |||
| 872 | Ga0105238_10140412 | |||
| 873 | Ga0105238_10155261 | |||
| 874 | Ga0105238_10240384 | |||
| 875 | Ga0105249_10004117 | |||
| 876 | Ga0105239_10014150 | |||
| 877 | Ga0105239_10135233 | |||
| 878 | Ga0105246_10037404 | |||
| 879 | Ga0157373_10145969 | |||
| 880 | Ga0157373_10147417 | |||
| 881 | Ga0157371_10011857 | |||
| 882 | Ga0157371_10180333 | |||
| 883 | Ga0157371_10464865 | |||
| 884 | Ga0157370_10158132 | |||
| 885 | Ga0157370_10246814 | |||
| 886 | Ga0157370_10347078 | |||
| 887 | Ga0157369_10042263 | |||
| 888 | Ga0157369_10101196 | |||
| 889 | Ga0157369_10427651 | |||
| 890 | Ga0157374_10001092 | |||
| 891 | Ga0157374_10002984 | |||
| 892 | Ga0157374_10008704 | |||
| 893 | Ga0157374_10019060 | |||
| 894 | Ga0157374_10154667 | |||
| 895 | Ga0157374_10483781 | |||
| 896 | Ga0157378_10000151 | |||
| 897 | Ga0157378_10040368 | |||
| 898 | Ga0157378_10128829 | |||
| 899 | Ga0157378_10262763 | |||
| 900 | Ga0157378_11361619 | |||
| 901 | Ga0163162_10002065 | |||
| 902 | Ga0163162_10019988 | |||
| 903 | Ga0163162_10179078 | |||
| 904 | Ga0157372_10001206 | |||
| 905 | Ga0157372_10028555 | |||
| 906 | Ga0157372_10051345 | |||
| 907 | Ga0157372_10199253 | |||
| 908 | Ga0157372_10207642 | |||
| 909 | Ga0157372_10941870 | |||
| 910 | Ga0157372_12710549 | |||
| 911 | Ga0157375_10214888 | |||
| 912 | Ga0163163_10123035 | |||
| 913 | Ga0182008_10145511 | |||
| 914 | Ga0157377_10086543 | |||
| 915 | Ga0157379_10006291 | |||
| 916 | Ga0157379_10015074 | |||
| 917 | Ga0157379_10016233 | |||
| 918 | Ga0157379_10099315 | |||
| 919 | Ga0157376_10122549 | |||
| 920 | Ga0157376_10382079 | |||
| 921 | Ga0157376_10699791 | |||
| 922 | Ga0182006_1018783 | |||
| 923 | Ga0182007_10021918 | |||
| 924 | Ga0182005_1009501 | |||
| 925 | Ga0163161_10487205 | |||
| 926 | Ga0213874_10174301 | |||
| 927 | Ga0207697_10162063 | |||
| 928 | Ga0207656_10041404 | |||
| 929 | Ga0207692_10005206 | |||
| 930 | Ga0207692_10241497 | |||
| 931 | Ga0207692_10301561 | |||
| 932 | Ga0207680_10041482 | |||
| 933 | Ga0207647_10007186 | |||
| 934 | Ga0207685_10206560 | |||
| 935 | Ga0207685_10237773 | |||
| 936 | Ga0207699_10026236 | |||
| 937 | Ga0207699_10030164 | |||
| 938 | Ga0207699_10051162 | |||
| 939 | Ga0207699_10281665 | |||
| 940 | Ga0207699_10363977 | |||
| 941 | Ga0207699_10578759 | |||
| 942 | Ga0207699_10907489 | |||
| 943 | Ga0207645_10022895 | |||
| 944 | Ga0207684_10001754 | |||
| 945 | Ga0207684_10013315 | |||
| 946 | Ga0207654_10004043 | |||
| 947 | Ga0207654_10009332 | |||
| 948 | Ga0207654_10016406 | |||
| 949 | Ga0207654_10147618 | |||
| 950 | Ga0207654_10347267 | |||
| 951 | Ga0207654_10492266 | |||
| 952 | Ga0207707_10731299 | |||
| 953 | Ga0207695_10045992 | |||
| 954 | Ga0207695_10460380 | |||
| 955 | Ga0207695_10991980 | |||
| 956 | Ga0207671_10052188 | |||
| 957 | Ga0207671_10287990 | |||
| 958 | Ga0207693_10000362 | |||
| 959 | Ga0207693_10000457 | |||
| 960 | Ga0207693_10003882 | |||
| 961 | Ga0207693_10037771 | |||
| 962 | Ga0207693_10037868 | |||
| 963 | Ga0207693_10387258 | |||
| 964 | Ga0207693_10536329 | |||
| 965 | Ga0207663_10004317 | |||
| 966 | Ga0207663_10005278 | |||
| 967 | Ga0207663_10031765 | |||
| 968 | Ga0207663_10170414 | |||
| 969 | Ga0207663_10246187 | |||
| 970 | Ga0207660_10105507 | |||
| 971 | Ga0207657_10000246 | |||
| 972 | Ga0207657_10001266 | |||
| 973 | Ga0207649_10194019 | |||
| 974 | Ga0207649_10799065 | |||
| 975 | Ga0207652_10070448 | |||
| 976 | Ga0207652_10225325 | |||
| 977 | Ga0207646_10002216 | |||
| 978 | Ga0207646_10812080 | |||
| 979 | Ga0207681_10306667 | |||
| 980 | Ga0207694_10137574 | |||
| 981 | Ga0207694_10260560 | |||
| 982 | Ga0207694_10808101 | |||
| 983 | Ga0207650_10847915 | |||
| 984 | Ga0207687_10011229 | |||
| 985 | Ga0207687_10329372 | |||
| 986 | Ga0207687_10567599 | |||
| 987 | Ga0207700_10000528 | |||
| 988 | Ga0207700_10030361 | |||
| 989 | Ga0207700_10136256 | |||
| 990 | Ga0207700_10177585 | |||
| 991 | Ga0207700_10195776 | |||
| 992 | Ga0207700_10339977 | |||
| 993 | Ga0207700_10651653 | |||
| 994 | Ga0207700_11115995 | |||
| 995 | Ga0207664_10068294 | |||
| 996 | Ga0207664_10081835 | |||
| 997 | Ga0207664_10455043 | |||
| 998 | Ga0207664_10466375 | |||
| 999 | Ga0207664_10641495 | |||
| 1000 | Ga0207664_10885864 | |||
| 1001 | Ga0207644_10183242 | |||
| 1002 | Ga0207644_10980717 | |||
| 1003 | Ga0207690_10010651 | |||
| 1004 | Ga0207706_10000139 | |||
| 1005 | Ga0207686_10089477 | |||
| 1006 | Ga0207709_10171480 | |||
| 1007 | Ga0207670_10086519 | |||
| 1008 | Ga0207704_10195188 | |||
| 1009 | Ga0207665_10000281 | |||
| 1010 | Ga0207665_10002897 | |||
| 1011 | Ga0207665_10060910 | |||
| 1012 | Ga0207665_10067516 | |||
| 1013 | Ga0207665_10146092 | |||
| 1014 | Ga0207665_10148243 | |||
| 1015 | Ga0207665_10155654 | |||
| 1016 | Ga0207665_10756454 | |||
| 1017 | Ga0207665_10917858 | |||
| 1018 | Ga0207691_10459555 | |||
| 1019 | Ga0207691_10521745 | |||
| 1020 | Ga0207711_10011787 | |||
| 1021 | Ga0207711_10189569 | |||
| 1022 | Ga0207711_10319858 | |||
| 1023 | Ga0207711_11335610 | |||
| 1024 | Ga0207689_10001053 | |||
| 1025 | Ga0207689_10064306 | |||
| 1026 | Ga0207679_10027166 | |||
| 1027 | Ga0207679_10040898 | |||
| 1028 | Ga0207667_10004029 | |||
| 1029 | Ga0207667_10311841 | |||
| 1030 | Ga0207667_10524786 | |||
| 1031 | Ga0207667_11118186 | |||
| 1032 | Ga0207651_10657041 | |||
| 1033 | Ga0207712_10024542 | |||
| 1034 | Ga0207668_10454113 | |||
| 1035 | Ga0207640_10036120 | |||
| 1036 | Ga0207640_10078421 | |||
| 1037 | Ga0207640_10218202 | |||
| 1038 | Ga0207658_10041406 | |||
| 1039 | Ga0207658_10496255 | |||
| 1040 | Ga0207658_10873932 | |||
| 1041 | Ga0207677_10005049 | |||
| 1042 | Ga0207677_10057478 | |||
| 1043 | Ga0207677_10372891 | |||
| 1044 | Ga0207703_10001863 | |||
| 1045 | Ga0207703_10160535 | |||
| 1046 | Ga0207703_10166493 | |||
| 1047 | Ga0207639_10200155 | |||
| 1048 | Ga0207639_10223963 | |||
| 1049 | Ga0207639_10325450 | |||
| 1050 | Ga0207678_10004676 | |||
| 1051 | Ga0207678_10283047 | |||
| 1052 | Ga0207702_10014881 | |||
| 1053 | Ga0207702_10016745 | |||
| 1054 | Ga0207702_10028337 | |||
| 1055 | Ga0207702_10097171 | |||
| 1056 | Ga0207702_10145508 | |||
| 1057 | Ga0207702_10847822 | |||
| 1058 | Ga0207702_12191879 | |||
| 1059 | Ga0207641_10026028 | |||
| 1060 | Ga0207641_10078652 | |||
| 1061 | Ga0207641_10875878 | |||
| 1062 | Ga0207648_10003612 | |||
| 1063 | Ga0207676_10114539 | |||
| 1064 | Ga0207674_10009505 | |||
| 1065 | Ga0207674_10049003 | |||
| 1066 | Ga0207675_100112550 | |||
| 1067 | Ga0207675_100246773 | |||
| 1068 | Ga0207675_100252047 | |||
| 1069 | Ga0207683_10121435 | |||
| 1070 | Ga0207683_10554141 | |||
| 1071 | Ga0207683_11497712 | |||
| 1072 | Ga0207698_10044147 | |||
| 1073 | Ga0268266_10120411 | |||
| 1074 | Ga0268265_10063459 | |||
| 1075 | Ga0268265_10079197 | |||
| 1076 | Ga0268264_10106135 | |||
| 1077 | Ga0268264_10242987 | |||
| 1078 | Ga0265338_10038645 | |||
| 1079 | Ga0265338_10142086 | |||
| 1080 | Ga0265773_1022057 | |||
| 1081 | Ga0265760_10066621 | |||
| 1082 | Ga0265330_10044813 | |||
| 1083 | Ga0265320_10282780 | |||
| 1084 | Ga0265325_10002327 | |||
| 1085 | Ga0265325_10156088 | |||
| 1086 | Ga0265316_10026020 | |||
| 1087 | Ga0307408_100203117 | |||
| 1088 | Ga0265314_10233646 | |||
| 1089 | Ga0307405_10191915 | |||
| 1090 | Ga0307410_10117580 | |||
| 1091 | Ga0307406_10040090 | |||
| 1092 | Ga0307407_10043039 | |||
| 1093 | Ga0307411_10020125 | |||
| 1094 | Ga0307415_100147613 | |||
| 1095 | Ga0373928_0011668 | |||
| 1096 | Ga0373951_0031557 | |||
| 1097 | Ga0373936_0016526 | |||
| 1098 | Ga0373936_0039064 | |||
| 1099 | Ga0373936_0161853 | |||
| 1100 | Ga0373941_0506490 | |||
| 1101 | Ga0373945_0039365 | |||
| 1102 | Ga0373945_0100915 | |||
| 1103 | Ga0373943_0013463 | |||
| 1104 | Ga0373943_0085500 | |||
| 1105 | Ga0373943_0114633 | |||
| 1106 | Ga0373943_0797339 | |||
| 1107 | Ga0373946_0079993 | |||
| 1108 | Ga0373955_0247267 | |||
| 1109 | Ga0373961_0228491 | |||
| 1110 | Ga0373962_0197863 | |||
| 1111 | Ga0373931_0052209 | |||
| 1112 | Ga0373931_0064157 | |||
| 1113 | Ga0373931_0246544 | |||
| 1114 | Ga0373935_0016193 | |||
| 1115 | Ga0373935_0034720 | |||
| 1116 | Ga0373927_0016852 | |||
| 1117 | Ga0373927_0117903 | |||
| 1118 | Ga0373927_1039742 | |||
| 1119 | Ga0373933_0253547 | |||
| 1120 | Ga0373933_0256573 | |||
| 1121 | Ga0373947_0025855 | |||
| 1122 | Ga0373947_0121902 | |||
| 1123 | Ga0373937_0035986 | |||
| 1124 | Ga0373937_0138139 | |||
| 1125 | Ga0373937_0241999 | |||
| 1126 | Ga0373937_0378841 | |||
| 1127 | Ga0373937_0721102 | |||
| 1128 | Ga0373925_0001086 | |||
| 1129 | Ga0373925_0031457 | |||
| 1130 | Ga0373925_0414160 | |||
| 1131 | Ga0373925_0688099 | |||
| 1132 | Ga0373925_1113030 | |||
| 1133 | Ga0395898_0302118 | |||
| 1134 | Ga0395898_0337093 | |||
| 1135 | Ga0395905_1201646 | |||
| 1136 | Ga0436364_0731791 | |||
| 1137 | Ga0395901_1265249 | |||
| 1138 | Ga0395901_1581680 | |||
| 1139 | Ga0436365_0870896 | |||
| 1140 | Ga0436360_1079114 | |||
| 1141 | Ga0436363_0581010 | |||
| 1142 | Ga0436363_0701884 | |||
| 1143 | Ga0436363_1291424 | |||
| 1144 | Ga0436362_0501176 | |||
| 1145 | Ga0451853_1623157 | |||
| 1146 | Ga0451577_0000157 | |||
| 1147 | Ga0451577_1083076 | |||
| 1148 | Ga0453683_0036319 | |||
| 1149 | Ga0453684_0000686 | |||
| 1150 | Ga0453684_1251295 | |||
| 1151 | Ga0451576_0065280 | |||
| 1152 | Ga0451576_0236473 | |||
| 1153 | Ga0451576_0279170 | |||
| 1154 | Ga0466967_0032045 | |||
| 1155 | Ga0495603_0377504 | |||
| 1156 | Ga0495629_0107727 | |||
| 1157 | Ga0495641_0429074 | |||
| 1158 | Ga0495580_0003182 | |||
| 1159 | Ga0495580_0005751 | |||
| 1160 | Ga0495580_0008637 | |||
| 1161 | Ga0495580_0015718 | |||
| 1162 | Ga0495580_0037477 | |||
| 1163 | Ga0495580_0318257 | |||
| 1164 | Ga0495580_0357905 | |||
| 1165 | Ga0495580_0635978 | |||
| 1166 | Ga0495580_0962831 | |||
| 1167 | Ga0495582_0001766 | |||
| 1168 | Ga0495582_0018863 | |||
| 1169 | Ga0495582_0031347 | |||
| 1170 | Ga0495639_0075273 | |||
| 1171 | Ga0495662_0076804 | |||
| 1172 | Ga0495662_0273111 | |||
| 1173 | Ga0495618_0600212 | |||
| 1174 | Ga0495630_0523832 | |||
| 1175 | Ga0495630_0866496 | |||
| 1176 | Ga0495666_0213362 | |||
| 1177 | Ga0495665_0010815 | |||
| 1178 | Ga0495665_0080543 | |||
| 1179 | Ga0495665_0320919 | |||
| 1180 | Ga0495586_0002383 | |||
| 1181 | Ga0495586_0450178 | |||
| 1182 | Ga0495667_0256731 | |||
| 1183 | Ga0495634_0351602 | |||
| 1184 | Ga0495659_0011691 | |||
| 1185 | Ga0495659_0168692 | |||
| 1186 | Ga0495623_0024206 | |||
| 1187 | Ga0495623_0076913 | |||
| 1188 | Ga0495658_0028030 | |||
| 1189 | Ga0495658_0862375 | |||
| 1190 | Ga0495669_0245136 | |||
| 1191 | Ga0495613_0139230 | |||
| 1192 | Ga0495613_0160396 | |||
| 1193 | Ga0495624_0389335 | |||
| 1194 | Ga0495624_0746062 | |||
| 1195 | Ga0495649_0680449 | |||
| 1196 | Ga0495581_0028314 | |||
| 1197 | Ga0495674_0071711 | |||
| 1198 | Ga0495674_0557278 | |||
| 1199 | Ga0495675_0039141 | |||
| 1200 | Ga0495602_0055511 | |||
| 1201 | Ga0495602_0120440 | |||
| 1202 | Ga0496100_0003857 | |||
| 1203 | Ga0496100_0130159 | |||
| 1204 | Ga0496101_0003461 | |||
| 1205 | Ga0496101_0421128 | |||
| 1206 | Ga0496101_0514226 | |||
| 1207 | Ga0496101_1239157 | |||
| 1208 | Ga0496102_0000537 | |||
| 1209 | Ga0496102_0048587 | |||
| 1210 | Ga0496102_0348965 | |||
| 1211 | Ga0496103_0010438 | |||
| 1212 | Ga0496103_0011600 | |||
| 1213 | Ga0496103_0053924 | |||
| 1214 | Ga0496104_0035988 | |||
| 1215 | Ga0496104_0043663 | |||
| 1216 | Ga0496104_0050923 | |||
| 1217 | Ga0496104_0305183 | |||
| 1218 | Ga0496104_0425768 | |||
| 1219 | Ga0496104_0863524 | |||
| 1220 | Ga0496105_0031508 | |||
| 1221 | Ga0496105_0114955 | |||
| 1222 | Ga0496106_0062827 | |||
| 1223 | Ga0496106_0097339 | |||
| 1224 | Ga0496106_0113740 | |||
| 1225 | Ga0496106_0196932 | |||
| 1226 | Ga0496107_0227295 | |||
| 1227 | Ga0496107_0655022 | |||
| 1228 | Ga0496108_0035693 | |||
| 1229 | Ga0496108_0094357 | |||
| 1230 | Ga0496108_0478731 | |||
| 1231 | Ga0496109_0039890 | |||
| 1232 | Ga0496109_0184031 | |||
| 1233 | Ga0496109_0209122 | |||
| 1234 | Ga0496110_0051224 | |||
| 1235 | Ga0496111_0014712 | |||
| 1236 | Ga0496111_0297310 | |||
| 1237 | Ga0496112_0001099 | |||
| 1238 | Ga0496112_0013062 | |||
| 1239 | Ga0496112_0037620 | |||
| 1240 | Ga0496112_0050195 | |||
| 1241 | Ga0496112_0082762 | |||
| 1242 | Ga0496113_0113103 | |||
| 1243 | Ga0496113_0274758 | |||
| 1244 | Ga0496114_0028113 | |||
| 1245 | Ga0496115_0004624 | |||
| 1246 | Ga0496115_0016349 | |||
| 1247 | nmdc:mga05p37_154518_c1 | |||
| 1248 | nmdc:mga0n895_459_c1 | |||
| 1249 | nmdc:mga0rr50_1097345_c1 | |||
| 1250 | nmdc:mga0rr50_34917_c1 | |||
| 1251 | nmdc:mga0rr50_392022_c1 | |||
| 1252 | nmdc:mga0rr50_8978_c1 | |||
| 1253 | nmdc:mga08x19_18527_c1 | |||
| 1254 | nmdc:mga08x19_45921_c1 | |||
| 1255 | nmdc:mga08x19_6888_c1 | |||
| 1256 | nmdc:mga0a205_20163_c1 | |||
| 1257 | Ga0495601_0588585 | |||
| 1258 | Ga0495595_0119575 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7jrq-assembly1.cif.gz_A | crystallographically characterized de novo designed mn-diphenylporphyrin binding protein | 0.7383 | 3 | 143 |
| 8q1b-assembly1.cif.gz_c | iii2-iv1 respiratory supercomplex from s. pombe | 0.7229 | 9 | 140 |
| 7o3e-assembly1.cif.gz_c | murine supercomplex ciii2civ in the intermediate locked conformation | 0.7132 | 9 | 140 |
| 6adq-assembly1.cif.gz_S | respiratory complex ciii2civ2sod2 from mycobacterium smegmatis | 0.7068 | 8 | 139 |
| 7rh5-assembly1.cif.gz_S | mycobacterial ciii2civ2 supercomplex, inhibitor free | 0.7061 | 6 | 139 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q0WRW8_184_365_1.20.120.1770 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); | 0.7087 | 1 | 142 | 1.20.120.1770 |
| af_I1JRZ9_200_386_1.20.120.1770 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); | 0.7057 | 4 | 143 | 1.20.120.1770 |
| af_A0A1D6NFR3_201_388_1.20.120.1770 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); | 0.7011 | 1 | 143 | 1.20.120.1770 |
| af_Q9M363_194_379_1.20.120.1770 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); | 0.6961 | 1 | 142 | 1.20.120.1770 |
| af_Q0WRW8_184_365_1.20.120.1770 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); | 0.6957 | 1 | 142 | 1.20.120.1770 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A5R8KD99-F1-model_v4 | DUF420 domain-containing protein | 0.995 | 5 | 138 |
GO:0016020
|
| AF-A0A372IRR1-F1-model_v4 | DUF420 domain-containing protein | 0.9937 | 7 | 136 |
GO:0016020
|
| AF-A0A7C4UW82-F1-model_v4 | DUF420 domain-containing protein | 0.9928 | 5 | 142 |
GO:0016020
|
| AF-A0A496XTQ9-F1-model_v4 | DUF420 domain-containing protein | 0.9928 | 5 | 140 |
GO:0016020
|
| AF-A0A7C3NIQ9-F1-model_v4 | DUF420 domain-containing protein | 0.9922 | 5 | 137 |
GO:0016020
|