F470713

General Info

Members Datasets Scaffolds Average Seq Length
629 269 1258 145

Family's Representative Sequence

Representative Sequence 3300005435|Ga0070714_100600610|Ga0070714_1006006102
Length 138
Sequence MPVPAQYAIFPVINASLNGASTVLLLVGRWFISQRRIAAHRATMITAVVTSALFLTSYLYYHAHVGSVHFQGTGWSRPLYFTLLISHVLLAIVITLTRALRERFDRHRAIARWTFPLWLYVSVTGVLVYFMLYHWFAV

Samples

Sample ID Description Type Environment
1 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
27 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
28 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
29 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
30 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
31 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
32 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
33 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
40 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
41 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
42 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
43 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
44 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
45 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
46 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
47 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
48 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
49 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
50 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
51 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
52 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
53 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
54 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
55 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
56 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
57 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
58 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
59 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
60 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
61 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
62 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
63 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
64 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
65 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
66 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
67 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
68 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
69 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
70 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
71 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
72 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
73 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
74 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
75 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
76 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
78 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
79 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
80 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
81 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
82 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
84 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
85 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
86 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
87 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
88 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
89 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
90 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
91 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
92 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
93 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
94 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
95 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
96 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
97 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
98 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
99 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
100 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
101 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
102 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
103 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
104 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
105 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
106 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
107 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
108 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
109 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
110 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
111 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
112 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
113 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
114 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
115 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
116 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
117 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
177 3300031018 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
178 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
179 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
180 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
181 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
182 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
183 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
184 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
185 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
186 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
187 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
188 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
189 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
190 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
191 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
192 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
193 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
194 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
195 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
196 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
197 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
198 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
199 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
200 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
201 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
202 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
203 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
204 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
205 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
206 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
207 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
208 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
209 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
210 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
211 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
212 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
213 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
214 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
215 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
216 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
217 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
218 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
219 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
220 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
221 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
222 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
223 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
224 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
225 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
226 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
227 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
228 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
229 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
230 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
231 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
232 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
233 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
234 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
235 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
236 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
237 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
238 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
239 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
240 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
241 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
242 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
243 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
244 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
245 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
246 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
247 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
248 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
249 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
250 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
251 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
252 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
253 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
254 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
255 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
256 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
257 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
258 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
259 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
260 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
261 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
262 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
263 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
264 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
265 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
266 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
267 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
268 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
269 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.68
Metatranscriptomes 0.32
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 7.15
Rhizosphere 91.57
Stem 0
Stem Tuber 0
Unclassified 33.55

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070714_100600610 3300005435 Bacteria 1057
2 MBSR1b_contig_2190678 2162886012 Unclassified 1052
3 MBSR1b_contig_3904799 2162886012 Bacteria 1001
4 rootH1_10376184 3300003323 Unclassified 1701
5 Ga0065712_10114404 3300005290 Bacteria 1763
6 Ga0065715_10225510 3300005293 Unclassified 1254
7 Ga0070676_10041193 3300005328 Unclassified 2677
8 Ga0070683_100061135 3300005329 Bacteria 3502
9 Ga0070690_100005791 3300005330 Bacteria 6961
10 Ga0070690_100070525 3300005330 Unclassified 2269
11 Ga0070690_100151103 3300005330 Bacteria 1585
12 Ga0070677_10304308 3300005333 Bacteria 811
13 Ga0068869_100001662 3300005334 Bacteria 13287
14 Ga0068869_100125000 3300005334 Unclassified 1971
15 Ga0070680_100089406 3300005336 Bacteria 2548
16 Ga0070682_100882074 3300005337 Unclassified 733
17 Ga0068868_100001388 3300005338 Bacteria 16720
18 Ga0068868_100059864 3300005338 Bacteria 3013
19 Ga0068868_100082544 3300005338 Bacteria 2578
20 Ga0070660_100006387 3300005339 Bacteria 8170
21 Ga0070689_100252173 3300005340 Bacteria 1456
22 Ga0070691_10075503 3300005341 Unclassified 1642
23 Ga0070661_100013353 3300005344 Bacteria 5765
24 Ga0070692_10432210 3300005345 Bacteria 838
25 Ga0070668_100044886 3300005347 Bacteria 3391
26 Ga0070675_100167505 3300005354 Unclassified 1893
27 Ga0070675_101598374 3300005354 Unclassified 601
28 Ga0070671_100303127 3300005355 Bacteria 1360
29 Ga0070671_101148744 3300005355 Bacteria 683
30 Ga0070674_100298065 3300005356 Bacteria 1284
31 Ga0070673_100542018 3300005364 Bacteria 1056
32 Ga0070659_100017607 3300005366 Bacteria 5381
33 Ga0070659_100102405 3300005366 Bacteria 2305
34 Ga0070667_100060743 3300005367 Bacteria 3198
35 Ga0070667_100160758 3300005367 Unclassified 1978
36 Ga0070667_100978188 3300005367 Unclassified 789
37 Ga0070709_10064008 3300005434 Unclassified 2350
38 Ga0070709_10106736 3300005434 Bacteria 1875
39 Ga0070709_10129489 3300005434 Bacteria 1721
40 Ga0070709_10226545 3300005434 Bacteria 1335
41 Ga0070709_10242718 3300005434 Bacteria 1294
42 Ga0070714_100002082 3300005435 Bacteria 14656
43 Ga0070714_100070692 3300005435 Bacteria 3017
44 Ga0070714_100081772 3300005435 Unclassified 2813
45 Ga0070714_100877836 3300005435 Unclassified 870
46 Ga0070713_100001170 3300005436 Bacteria 16769
47 Ga0070713_100041393 3300005436 Unclassified 3753
48 Ga0070713_100053651 3300005436 Bacteria 3341
49 Ga0070713_100085962 3300005436 Bacteria 2695
50 Ga0070713_100115254 3300005436 Unclassified 2348
51 Ga0070713_100149931 3300005436 Bacteria 2073
52 Ga0070713_100155486 3300005436 Bacteria 2038
53 Ga0070713_100215311 3300005436 Bacteria 1741
54 Ga0070713_100254257 3300005436 Unclassified 1604
55 Ga0070713_100478045 3300005436 Unclassified 1173
56 Ga0070713_100530545 3300005436 Unclassified 1113
57 Ga0070713_100632519 3300005436 Bacteria 1018
58 Ga0070710_10199946 3300005437 Bacteria 1261
59 Ga0070710_11523605 3300005437 Unclassified 503
60 Ga0070701_10712957 3300005438 Unclassified 676
61 Ga0070711_100003108 3300005439 Bacteria 9606
62 Ga0070711_100006478 3300005439 Bacteria 7061
63 Ga0070711_100089177 3300005439 Bacteria 2218
64 Ga0070711_100146764 3300005439 Unclassified 1775
65 Ga0070705_100080322 3300005440 Bacteria 2000
66 Ga0070705_100649900 3300005440 Unclassified 822
67 Ga0070694_100002781 3300005444 Bacteria 10387
68 Ga0070694_100105575 3300005444 Unclassified 1999
69 Ga0070694_100457083 3300005444 Bacteria 1009
70 Ga0070708_100000263 3300005445 Bacteria 39351
71 Ga0070708_100002949 3300005445 Bacteria 13227
72 Ga0070708_100003924 3300005445 Bacteria 11681
73 Ga0070708_100022080 3300005445 Bacteria 5394
74 Ga0070708_100113948 3300005445 Bacteria 2487
75 Ga0070708_100495932 3300005445 Bacteria 1152
76 Ga0070663_100028694 3300005455 Bacteria 3792
77 Ga0070678_100023075 3300005456 Bacteria 4139
78 Ga0070678_100196038 3300005456 Unclassified 1664
79 Ga0070662_100002426 3300005457 Bacteria 11463
80 Ga0070681_10032433 3300005458 Bacteria 5242
81 Ga0070681_10267513 3300005458 Bacteria 1621
82 Ga0070681_10689449 3300005458 Unclassified 937
83 Ga0068867_100017844 3300005459 Bacteria 5040
84 Ga0070685_10229445 3300005466 Unclassified 1220
85 Ga0070685_10309365 3300005466 Unclassified 1067
86 Ga0070685_10357492 3300005466 Unclassified 1000
87 Ga0070706_100001289 3300005467 Bacteria 26742
88 Ga0070706_100011557 3300005467 Bacteria 8202
89 Ga0070706_101101674 3300005467 Unclassified 731
90 Ga0070707_100010726 3300005468 Bacteria 8534
91 Ga0070707_100140495 3300005468 Bacteria 2350
92 Ga0070707_100175140 3300005468 Bacteria 2091
93 Ga0070698_100000456 3300005471 Bacteria 43335
94 Ga0070698_100226784 3300005471 Bacteria 1801
95 Ga0070698_100782121 3300005471 Unclassified 898
96 Ga0070699_100001799 3300005518 Bacteria 19484
97 Ga0070699_100011106 3300005518 Bacteria 7785
98 Ga0070699_100659643 3300005518 Bacteria 955
99 Ga0070679_100085876 3300005530 Bacteria 3134
100 Ga0070679_100114065 3300005530 Bacteria 2687
101 Ga0070679_100185696 3300005530 Unclassified 2050
102 Ga0070679_100609836 3300005530 Bacteria 1035
103 Ga0070684_100007536 3300005535 Bacteria 8472
104 Ga0070684_100042554 3300005535 Bacteria 3922
105 Ga0070697_100000496 3300005536 Bacteria 29902
106 Ga0070697_100001425 3300005536 Bacteria 18173
107 Ga0070697_100012017 3300005536 Bacteria 6777
108 Ga0070697_100133441 3300005536 Unclassified 2084
109 Ga0070697_100274661 3300005536 Bacteria 1445
110 Ga0070697_100646421 3300005536 Bacteria 931
111 Ga0070697_101174303 3300005536 Unclassified 684
112 Ga0068853_100004992 3300005539 Bacteria 10340
113 Ga0068853_100093998 3300005539 Bacteria 2641
114 Ga0070672_100284088 3300005543 Bacteria 1400
115 Ga0070672_100466070 3300005543 Bacteria 1090
116 Ga0070686_100000633 3300005544 Bacteria 20506
117 Ga0070686_100015085 3300005544 Bacteria 4467
118 Ga0070686_100577302 3300005544 Unclassified 883
119 Ga0070695_100061937 3300005545 Bacteria 2428
120 Ga0070695_100606262 3300005545 Bacteria 860
121 Ga0070696_100289030 3300005546 Bacteria 1252
122 Ga0070693_100153242 3300005547 Bacteria 1461
123 Ga0070693_100218845 3300005547 Unclassified 1246
124 Ga0070665_100204252 3300005548 Unclassified 1976
125 Ga0070704_100013181 3300005549 Bacteria 5123
126 Ga0070704_100832958 3300005549 Bacteria 826
127 Ga0068855_100058865 3300005563 Bacteria 4497
128 Ga0068855_100259717 3300005563 Bacteria 1935
129 Ga0068855_101304626 3300005563 Bacteria 751
130 Ga0070664_100104985 3300005564 Bacteria 2460
131 Ga0070664_100203726 3300005564 Unclassified 1766
132 Ga0068857_100044015 3300005577 Bacteria 3959
133 Ga0068857_100083866 3300005577 Bacteria 2848
134 Ga0068854_100086725 3300005578 Unclassified 2321
135 Ga0068854_100102988 3300005578 Bacteria 2142
136 Ga0068854_100132729 3300005578 Bacteria 1903
137 Ga0068856_100005519 3300005614 Bacteria 12457
138 Ga0068856_100085984 3300005614 Bacteria 3124
139 Ga0068856_100113969 3300005614 Bacteria 2702
140 Ga0068856_100543427 3300005614 Bacteria 1183
141 Ga0068856_101556336 3300005614 Unclassified 675
142 Ga0070702_100831871 3300005615 Bacteria 717
143 Ga0068852_100015752 3300005616 Bacteria 5877
144 Ga0068859_100016880 3300005617 Bacteria 7327
145 Ga0068859_100054585 3300005617 Bacteria 4019
146 Ga0068864_100088024 3300005618 Bacteria 2735
147 Ga0068866_10038699 3300005718 Unclassified 2350
148 Ga0068861_100288922 3300005719 Unclassified 1415
149 Ga0068861_100589762 3300005719 Bacteria 1018
150 Ga0068851_10018270 3300005834 Bacteria 3377
151 Ga0068851_10811982 3300005834 Unclassified 582
152 Ga0068863_100021802 3300005841 Bacteria 6114
153 Ga0068863_100057211 3300005841 Unclassified 3691
154 Ga0068858_100009222 3300005842 Bacteria 9421
155 Ga0068858_100039198 3300005842 Bacteria 4394
156 Ga0068858_100257833 3300005842 Bacteria 1657
157 Ga0068858_100885206 3300005842 Bacteria 873
158 Ga0068860_100055729 3300005843 Bacteria 3758
159 Ga0068860_100222843 3300005843 Unclassified 1831
160 Ga0068860_100392847 3300005843 Bacteria 1371
161 Ga0068860_101311283 3300005843 Bacteria 745
162 Ga0068862_100082071 3300005844 Unclassified 2797
163 Ga0068862_100150397 3300005844 Unclassified 2072
164 Ga0081540_1050975 3300005983 Bacteria 2050
165 Ga0070717_10002245 3300006028 Bacteria 13546
166 Ga0070717_10007223 3300006028 Bacteria 8240
167 Ga0070717_10012058 3300006028 Bacteria 6584
168 Ga0070717_10091269 3300006028 Bacteria 2572
169 Ga0070717_10128373 3300006028 Bacteria 2178
170 Ga0070717_10174963 3300006028 Bacteria 1868
171 Ga0070717_10259412 3300006028 Bacteria 1537
172 Ga0070717_10310932 3300006028 Bacteria 1402
173 Ga0070717_10716656 3300006028 Unclassified 909
174 Ga0070717_10732223 3300006028 Unclassified 899
175 Ga0070715_10332396 3300006163 Unclassified 824
176 Ga0070716_100000526 3300006173 Bacteria 16009
177 Ga0070716_100006587 3300006173 Bacteria 5677
178 Ga0070716_100045220 3300006173 Bacteria 2471
179 Ga0070716_100046064 3300006173 Bacteria 2452
180 Ga0070716_100084109 3300006173 Bacteria 1907
181 Ga0070716_100108924 3300006173 Bacteria 1713
182 Ga0070716_100171595 3300006173 Unclassified 1416
183 Ga0070716_100414168 3300006173 Unclassified 973
184 Ga0070716_100637364 3300006173 Unclassified 806
185 Ga0070712_100000550 3300006175 Bacteria 21698
186 Ga0070712_100000969 3300006175 Bacteria 17281
187 Ga0070712_100008020 3300006175 Bacteria 6623
188 Ga0070712_100008354 3300006175 Bacteria 6510
189 Ga0070712_100049310 3300006175 Unclassified 2923
190 Ga0070712_100309169 3300006175 Bacteria 1282
191 Ga0070712_100635342 3300006175 Unclassified 906
192 Ga0070712_100678283 3300006175 Unclassified 877
193 Ga0097621_100013116 3300006237 Bacteria 6164
194 Ga0097621_100022304 3300006237 Unclassified 4913
195 Ga0097621_100199949 3300006237 Unclassified 1734
196 Ga0097621_100250655 3300006237 Bacteria 1550
197 Ga0097621_100341767 3300006237 Bacteria 1329
198 Ga0097621_101344316 3300006237 Unclassified 676
199 Ga0068871_100030754 3300006358 Bacteria 4231
200 Ga0068871_100047582 3300006358 Bacteria 3459
201 Ga0068871_100061868 3300006358 Bacteria 3059
202 Ga0068871_100601320 3300006358 Bacteria 1000
203 Ga0075433_10005454 3300006852 Bacteria 9995
204 Ga0075434_100000416 3300006871 Bacteria 31534
205 Ga0075434_100321418 3300006871 Bacteria 1568
206 Ga0068865_100024800 3300006881 Bacteria 3939
207 Ga0068865_100067294 3300006881 Unclassified 2530
208 Ga0075436_100006264 3300006914 Bacteria 8150
209 Ga0075436_100049284 3300006914 Bacteria 2906
210 Ga0075436_100063044 3300006914 Unclassified 2562
211 Ga0097620_100016880 3300006931 Bacteria 7327
212 Ga0097620_100054586 3300006931 Bacteria 4019
213 Ga0075435_100018943 3300007076 Bacteria 5246
214 Ga0075435_100025747 3300007076 Bacteria 4582
215 Ga0075435_100445630 3300007076 Bacteria 1116
216 Ga0105250_10281540 3300009092 Unclassified 716
217 Ga0105240_10009649 3300009093 Bacteria 13651
218 Ga0105240_10067816 3300009093 Bacteria 4421
219 Ga0111539_11096966 3300009094 Unclassified 925
220 Ga0105245_10068422 3300009098 Bacteria 3217
221 Ga0105245_10132404 3300009098 Bacteria 2340
222 Ga0105245_10431470 3300009098 Bacteria 1323
223 Ga0105245_10821238 3300009098 Unclassified 968
224 Ga0105247_10013079 3300009101 Bacteria 4977
225 Ga0105247_10078385 3300009101 Unclassified 2078
226 Ga0105247_10121480 3300009101 Bacteria 1693
227 Ga0114129_10150815 3300009147 Bacteria 3181
228 Ga0105241_10006514 3300009174 Bacteria 8607
229 Ga0105241_10022680 3300009174 Bacteria 4651
230 Ga0105241_10161139 3300009174 Bacteria 1844
231 Ga0105241_10555812 3300009174 Bacteria 1031
232 Ga0105242_10116161 3300009176 Bacteria 2289
233 Ga0105248_10006081 3300009177 Bacteria 13248
234 Ga0105248_10102641 3300009177 Bacteria 3223
235 Ga0105248_10161215 3300009177 Bacteria 2529
236 Ga0105237_10027226 3300009545 Bacteria 5838
237 Ga0105237_10036130 3300009545 Unclassified 4998
238 Ga0105237_10201447 3300009545 Bacteria 1991
239 Ga0105237_10217528 3300009545 Unclassified 1910
240 Ga0105237_10401644 3300009545 Bacteria 1375
241 Ga0105238_10022710 3300009551 Bacteria 6394
242 Ga0105238_10023137 3300009551 Bacteria 6336
243 Ga0105238_10140412 3300009551 Bacteria 2393
244 Ga0105238_10155261 3300009551 Bacteria 2264
245 Ga0105238_10240384 3300009551 Bacteria 1788
246 Ga0105249_10004117 3300009553 Bacteria 12556
247 Ga0105239_10014150 3300010375 Bacteria 8852
248 Ga0105239_10135233 3300010375 Bacteria 2744
249 Ga0105246_10037404 3300011119 Unclassified 3258
250 Ga0157373_10145969 3300013100 Bacteria 1664
251 Ga0157373_10147417 3300013100 Bacteria 1655
252 Ga0157371_10011857 3300013102 Bacteria 6690
253 Ga0157371_10180333 3300013102 Bacteria 1511
254 Ga0157371_10464865 3300013102 Unclassified 931
255 Ga0157370_10158132 3300013104 Unclassified 2108
256 Ga0157370_10246814 3300013104 Unclassified 1651
257 Ga0157370_10347078 3300013104 Bacteria 1368
258 Ga0157369_10042263 3300013105 Bacteria 4973
259 Ga0157369_10101196 3300013105 Bacteria 3071
260 Ga0157369_10427651 3300013105 Unclassified 1373
261 Ga0157374_10001092 3300013296 Bacteria 23356
262 Ga0157374_10002984 3300013296 Bacteria 14164
263 Ga0157374_10008704 3300013296 Bacteria 8680
264 Ga0157374_10019060 3300013296 Bacteria 6070
265 Ga0157374_10154667 3300013296 Bacteria 2231
266 Ga0157374_10483781 3300013296 Unclassified 1241
267 Ga0157378_10000151 3300013297 Bacteria 65215
268 Ga0157378_10040368 3300013297 Bacteria 4138
269 Ga0157378_10128829 3300013297 Bacteria 2340
270 Ga0157378_10262763 3300013297 Bacteria 1657
271 Ga0157378_11361619 3300013297 Unclassified 752
272 Ga0163162_10002065 3300013306 Bacteria 18873
273 Ga0163162_10019988 3300013306 Bacteria 6577
274 Ga0163162_10179078 3300013306 Bacteria 2246
275 Ga0157372_10001206 3300013307 Bacteria 27941
276 Ga0157372_10028555 3300013307 Bacteria 6089
277 Ga0157372_10051345 3300013307 Unclassified 4589
278 Ga0157372_10199253 3300013307 Bacteria 2319
279 Ga0157372_10207642 3300013307 Bacteria 2269
280 Ga0157372_10941870 3300013307 Bacteria 1001
281 Ga0157372_12710549 3300013307 Bacteria 569
282 Ga0157375_10214888 3300013308 Unclassified 2081
283 Ga0163163_10123035 3300014325 Bacteria 2629
284 Ga0182008_10145511 3300014497 Bacteria 1187
285 Ga0157377_10086543 3300014745 Bacteria 1842
286 Ga0157379_10006291 3300014968 Bacteria 10224
287 Ga0157379_10015074 3300014968 Bacteria 6780
288 Ga0157379_10016233 3300014968 Bacteria 6552
289 Ga0157379_10099315 3300014968 Unclassified 2613
290 Ga0157376_10122549 3300014969 Bacteria 2307
291 Ga0157376_10382079 3300014969 Unclassified 1357
292 Ga0157376_10699791 3300014969 Unclassified 1018
293 Ga0182006_1018783 3300015261 Bacteria 2916
294 Ga0182007_10021918 3300015262 Bacteria 2262
295 Ga0182005_1009501 3300015265 Bacteria 2829
296 Ga0163161_10487205 3300017792 Unclassified 1002
297 Ga0213874_10174301 3300021377 Bacteria 762
298 Ga0207697_10162063 3300025315 Unclassified 976
299 Ga0207656_10041404 3300025321 Unclassified 1957
300 Ga0207692_10005206 3300025898 Bacteria 5192
301 Ga0207692_10241497 3300025898 Bacteria 1079
302 Ga0207692_10301561 3300025898 Bacteria 975
303 Ga0207680_10041482 3300025903 Bacteria 2685
304 Ga0207647_10007186 3300025904 Bacteria 8069
305 Ga0207685_10206560 3300025905 Bacteria 926
306 Ga0207685_10237773 3300025905 Bacteria 875
307 Ga0207699_10026236 3300025906 Bacteria 3208
308 Ga0207699_10030164 3300025906 Unclassified 3032
309 Ga0207699_10051162 3300025906 Bacteria 2440
310 Ga0207699_10281665 3300025906 Bacteria 1155
311 Ga0207699_10363977 3300025906 Unclassified 1023
312 Ga0207699_10578759 3300025906 Unclassified 816
313 Ga0207699_10907489 3300025906 Unclassified 650
314 Ga0207645_10022895 3300025907 Bacteria 4060
315 Ga0207684_10001754 3300025910 Bacteria 22933
316 Ga0207684_10013315 3300025910 Bacteria 7115
317 Ga0207654_10004043 3300025911 Bacteria 7383
318 Ga0207654_10009332 3300025911 Bacteria 4980
319 Ga0207654_10016406 3300025911 Bacteria 3857
320 Ga0207654_10147618 3300025911 Bacteria 1506
321 Ga0207654_10347267 3300025911 Unclassified 1021
322 Ga0207654_10492266 3300025911 Bacteria 865
323 Ga0207707_10731299 3300025912 Unclassified 829
324 Ga0207695_10045992 3300025913 Bacteria 4628
325 Ga0207695_10460380 3300025913 Bacteria 1155
326 Ga0207695_10991980 3300025913 Unclassified 720
327 Ga0207671_10052188 3300025914 Bacteria 3030
328 Ga0207671_10287990 3300025914 Unclassified 1296
329 Ga0207693_10000362 3300025915 Bacteria 41574
330 Ga0207693_10000457 3300025915 Bacteria 37236
331 Ga0207693_10003882 3300025915 Bacteria 12729
332 Ga0207693_10037771 3300025915 Unclassified 3805
333 Ga0207693_10037868 3300025915 Bacteria 3801
334 Ga0207693_10387258 3300025915 Unclassified 1093
335 Ga0207693_10536329 3300025915 Unclassified 913
336 Ga0207663_10004317 3300025916 Bacteria 7055
337 Ga0207663_10005278 3300025916 Bacteria 6504
338 Ga0207663_10031765 3300025916 Unclassified 3128
339 Ga0207663_10170414 3300025916 Bacteria 1546
340 Ga0207663_10246187 3300025916 Unclassified 1314
341 Ga0207660_10105507 3300025917 Bacteria 2112
342 Ga0207657_10000246 3300025919 Bacteria 57698
343 Ga0207657_10001266 3300025919 Bacteria 26953
344 Ga0207649_10194019 3300025920 Bacteria 1430
345 Ga0207649_10799065 3300025920 Unclassified 736
346 Ga0207652_10070448 3300025921 Bacteria 3037
347 Ga0207652_10225325 3300025921 Unclassified 1689
348 Ga0207646_10002216 3300025922 Bacteria 23136
349 Ga0207646_10812080 3300025922 Unclassified 832
350 Ga0207681_10306667 3300025923 Bacteria 1258
351 Ga0207694_10137574 3300025924 Bacteria 1963
352 Ga0207694_10260560 3300025924 Bacteria 1420
353 Ga0207694_10808101 3300025924 Unclassified 792
354 Ga0207650_10847915 3300025925 Bacteria 775
355 Ga0207687_10011229 3300025927 Bacteria 5850
356 Ga0207687_10329372 3300025927 Unclassified 1238
357 Ga0207687_10567599 3300025927 Unclassified 953
358 Ga0207700_10000528 3300025928 Bacteria 22511
359 Ga0207700_10030361 3300025928 Unclassified 3827
360 Ga0207700_10136256 3300025928 Bacteria 2011
361 Ga0207700_10177585 3300025928 Unclassified 1780
362 Ga0207700_10195776 3300025928 Bacteria 1701
363 Ga0207700_10339977 3300025928 Unclassified 1305
364 Ga0207700_10651653 3300025928 Unclassified 939
365 Ga0207700_11115995 3300025928 Unclassified 705
366 Ga0207664_10068294 3300025929 Unclassified 2855
367 Ga0207664_10081835 3300025929 Bacteria 2629
368 Ga0207664_10455043 3300025929 Unclassified 1143
369 Ga0207664_10466375 3300025929 Unclassified 1128
370 Ga0207664_10641495 3300025929 Unclassified 954
371 Ga0207664_10885864 3300025929 Unclassified 802
372 Ga0207644_10183242 3300025931 Bacteria 1642
373 Ga0207644_10980717 3300025931 Unclassified 709
374 Ga0207690_10010651 3300025932 Bacteria 5478
375 Ga0207706_10000139 3300025933 Bacteria 79096
376 Ga0207686_10089477 3300025934 Bacteria 2029
377 Ga0207709_10171480 3300025935 Unclassified 1523
378 Ga0207670_10086519 3300025936 Unclassified 2206
379 Ga0207704_10195188 3300025938 Unclassified 1476
380 Ga0207665_10000281 3300025939 Bacteria 35365
381 Ga0207665_10002897 3300025939 Bacteria 11511
382 Ga0207665_10060910 3300025939 Bacteria 2557
383 Ga0207665_10067516 3300025939 Bacteria 2435
384 Ga0207665_10146092 3300025939 Unclassified 1690
385 Ga0207665_10148243 3300025939 Unclassified 1678
386 Ga0207665_10155654 3300025939 Unclassified 1640
387 Ga0207665_10756454 3300025939 Bacteria 766
388 Ga0207665_10917858 3300025939 Bacteria 695
389 Ga0207691_10459555 3300025940 Bacteria 1083
390 Ga0207691_10521745 3300025940 Bacteria 1008
391 Ga0207711_10011787 3300025941 Bacteria 7263
392 Ga0207711_10189569 3300025941 Bacteria 1873
393 Ga0207711_10319858 3300025941 Bacteria 1434
394 Ga0207711_11335610 3300025941 Bacteria 659
395 Ga0207689_10001053 3300025942 Bacteria 26527
396 Ga0207689_10064306 3300025942 Unclassified 3019
397 Ga0207679_10027166 3300025945 Bacteria 3955
398 Ga0207679_10040898 3300025945 Bacteria 3321
399 Ga0207667_10004029 3300025949 Bacteria 18047
400 Ga0207667_10311841 3300025949 Bacteria 1607
401 Ga0207667_10524786 3300025949 Unclassified 1199
402 Ga0207667_11118186 3300025949 Bacteria 770
403 Ga0207651_10657041 3300025960 Bacteria 921
404 Ga0207712_10024542 3300025961 Bacteria 3995
405 Ga0207668_10454113 3300025972 Unclassified 1094
406 Ga0207640_10036120 3300025981 Bacteria 3099
407 Ga0207640_10078421 3300025981 Unclassified 2248
408 Ga0207640_10218202 3300025981 Bacteria 1458
409 Ga0207658_10041406 3300025986 Bacteria 3335
410 Ga0207658_10496255 3300025986 Unclassified 1087
411 Ga0207658_10873932 3300025986 Bacteria 818
412 Ga0207677_10005049 3300026023 Bacteria 7132
413 Ga0207677_10057478 3300026023 Bacteria 2671
414 Ga0207677_10372891 3300026023 Unclassified 1202
415 Ga0207703_10001863 3300026035 Bacteria 18753
416 Ga0207703_10160535 3300026035 Unclassified 1968
417 Ga0207703_10166493 3300026035 Bacteria 1935
418 Ga0207639_10200155 3300026041 Bacteria 1712
419 Ga0207639_10223963 3300026041 Bacteria 1626
420 Ga0207639_10325450 3300026041 Unclassified 1366
421 Ga0207678_10004676 3300026067 Bacteria 12295
422 Ga0207678_10283047 3300026067 Bacteria 1423
423 Ga0207702_10014881 3300026078 Bacteria 6453
424 Ga0207702_10016745 3300026078 Bacteria 6067
425 Ga0207702_10028337 3300026078 Bacteria 4655
426 Ga0207702_10097171 3300026078 Bacteria 2592
427 Ga0207702_10145508 3300026078 Bacteria 2150
428 Ga0207702_10847822 3300026078 Bacteria 904
429 Ga0207702_12191879 3300026078 Unclassified 541
430 Ga0207641_10026028 3300026088 Bacteria 4827
431 Ga0207641_10078652 3300026088 Unclassified 2857
432 Ga0207641_10875878 3300026088 Unclassified 891
433 Ga0207648_10003612 3300026089 Bacteria 16172
434 Ga0207676_10114539 3300026095 Bacteria 2262
435 Ga0207674_10009505 3300026116 Bacteria 11102
436 Ga0207674_10049003 3300026116 Bacteria 4322
437 Ga0207675_100112550 3300026118 Unclassified 2569
438 Ga0207675_100246773 3300026118 Bacteria 1727
439 Ga0207675_100252047 3300026118 Bacteria 1709
440 Ga0207683_10121435 3300026121 Unclassified 2346
441 Ga0207683_10554141 3300026121 Bacteria 1063
442 Ga0207683_11497712 3300026121 Bacteria 623
443 Ga0207698_10044147 3300026142 Bacteria 3346
444 Ga0268266_10120411 3300028379 Unclassified 2335
445 Ga0268265_10063459 3300028380 Unclassified 2842
446 Ga0268265_10079197 3300028380 Unclassified 2587
447 Ga0268264_10106135 3300028381 Unclassified 2451
448 Ga0268264_10242987 3300028381 Unclassified 1668
449 Ga0265338_10038645 3300028800 Unclassified 4517
450 Ga0265338_10142086 3300028800 Bacteria 1879
451 Ga0265773_1022057 3300031018 Unclassified 634
452 Ga0265760_10066621 3300031090 Unclassified 1100
453 Ga0265330_10044813 3300031235 Bacteria 1952
454 Ga0265320_10282780 3300031240 Unclassified 735
455 Ga0265325_10002327 3300031241 Bacteria 12890
456 Ga0265325_10156088 3300031241 Bacteria 1076
457 Ga0265316_10026020 3300031344 Bacteria 4875
458 Ga0307408_100203117 3300031548 Bacteria 1605
459 Ga0265314_10233646 3300031711 Bacteria 1065
460 Ga0307405_10191915 3300031731 Bacteria 1476
461 Ga0307410_10117580 3300031852 Bacteria 1933
462 Ga0307406_10040090 3300031901 Unclassified 2910
463 Ga0307407_10043039 3300031903 Bacteria 2536
464 Ga0307411_10020125 3300032005 Unclassified 3873
465 Ga0307415_100147613 3300032126 Bacteria 1805
466 Ga0373928_0011668 3300035084 Bacteria 1744
467 Ga0373951_0031557 3300035091 Bacteria 1250
468 Ga0373936_0016526 3300035113 Bacteria 2839
469 Ga0373936_0039064 3300035113 Bacteria 1898
470 Ga0373936_0161853 3300035113 Bacteria 975
471 Ga0373941_0506490 3300035115 Unclassified 514
472 Ga0373945_0039365 3300035116 Bacteria 1704
473 Ga0373945_0100915 3300035116 Unclassified 1129
474 Ga0373943_0013463 3300035170 Bacteria 3695
475 Ga0373943_0085500 3300035170 Bacteria 1625
476 Ga0373943_0114633 3300035170 Bacteria 1426
477 Ga0373943_0797339 3300035170 Unclassified 562
478 Ga0373946_0079993 3300035171 Bacteria 1429
479 Ga0373955_0247267 3300035172 Bacteria 1069
480 Ga0373961_0228491 3300035241 Unclassified 666
481 Ga0373962_0197863 3300035242 Bacteria 679
482 Ga0373931_0052209 3300035691 Unclassified 2179
483 Ga0373931_0064157 3300035691 Bacteria 1987
484 Ga0373931_0246544 3300035691 Bacteria 1085
485 Ga0373935_0016193 3300035692 Bacteria 4512
486 Ga0373935_0034720 3300035692 Bacteria 3145
487 Ga0373927_0016852 3300035695 Unclassified 4818
488 Ga0373927_0117903 3300035695 Unclassified 1732
489 Ga0373927_1039742 3300035695 Unclassified 540
490 Ga0373933_0253547 3300035724 Unclassified 1133
491 Ga0373933_0256573 3300035724 Unclassified 1127
492 Ga0373947_0025855 3300035725 Bacteria 3425
493 Ga0373947_0121902 3300035725 Unclassified 1657
494 Ga0373937_0035986 3300036401 Bacteria 4510
495 Ga0373937_0138139 3300036401 Bacteria 2279
496 Ga0373937_0241999 3300036401 Bacteria 1700
497 Ga0373937_0378841 3300036401 Unclassified 1342
498 Ga0373937_0721102 3300036401 Bacteria 944
499 Ga0373925_0001086 3300037068 Bacteria 24439
500 Ga0373925_0031457 3300037068 Unclassified 3900
501 Ga0373925_0414160 3300037068 Unclassified 1100
502 Ga0373925_0688099 3300037068 Unclassified 843
503 Ga0373925_1113030 3300037068 Unclassified 650
504 Ga0395898_0302118 3300037466 Bacteria 1527
505 Ga0395898_0337093 3300037466 Bacteria 1438
506 Ga0395905_1201646 3300037471 Unclassified 662
507 Ga0436364_0731791 3300037853 Unclassified 1375
508 Ga0395901_1265249 3300038443 Unclassified 701
509 Ga0395901_1581680 3300038443 Unclassified 609
510 Ga0436365_0870896 3300039437 Unclassified 745
511 Ga0436360_1079114 3300039438 Bacteria 569
512 Ga0436363_0581010 3300039450 Bacteria 1417
513 Ga0436363_0701884 3300039450 Bacteria 3611
514 Ga0436363_1291424 3300039450 Unclassified 1559
515 Ga0436362_0501176 3300039453 Bacteria 513
516 Ga0451853_1623157 3300041512 Bacteria 1096
517 Ga0451577_0000157 3300042876 Bacteria 151953
518 Ga0451577_1083076 3300042876 Unclassified 718
519 Ga0453683_0036319 3300044673 Bacteria 3101
520 Ga0453684_0000686 3300044712 Bacteria 120659
521 Ga0453684_1251295 3300044712 Unclassified 777
522 Ga0451576_0065280 3300045051 Bacteria 3790
523 Ga0451576_0236473 3300045051 Unclassified 1908
524 Ga0451576_0279170 3300045051 Bacteria 1747
525 Ga0466967_0032045 3300045976 Bacteria 4434
526 Ga0495603_0377504 3300046455 Unclassified 813
527 Ga0495629_0107727 3300046459 Bacteria 1944
528 Ga0495641_0429074 3300046461 Unclassified 600
529 Ga0495580_0003182 3300046472 Bacteria 14071
530 Ga0495580_0005751 3300046472 Bacteria 10184
531 Ga0495580_0008637 3300046472 Bacteria 8080
532 Ga0495580_0015718 3300046472 Bacteria 5703
533 Ga0495580_0037477 3300046472 Bacteria 3480
534 Ga0495580_0318257 3300046472 Unclassified 1058
535 Ga0495580_0357905 3300046472 Bacteria 988
536 Ga0495580_0635978 3300046472 Unclassified 703
537 Ga0495580_0962831 3300046472 Unclassified 546
538 Ga0495582_0001766 3300046473 Bacteria 12202
539 Ga0495582_0018863 3300046473 Bacteria 3772
540 Ga0495582_0031347 3300046473 Unclassified 2922
541 Ga0495639_0075273 3300046475 Bacteria 1565
542 Ga0495662_0076804 3300046476 Unclassified 1622
543 Ga0495662_0273111 3300046476 Unclassified 832
544 Ga0495618_0600212 3300046514 Unclassified 655
545 Ga0495630_0523832 3300046517 Unclassified 909
546 Ga0495630_0866496 3300046517 Bacteria 688
547 Ga0495666_0213362 3300046526 Unclassified 885
548 Ga0495665_0010815 3300046531 Unclassified 4938
549 Ga0495665_0080543 3300046531 Bacteria 1713
550 Ga0495665_0320919 3300046531 Bacteria 791
551 Ga0495586_0002383 3300046535 Bacteria 10201
552 Ga0495586_0450178 3300046535 Unclassified 742
553 Ga0495667_0256731 3300046559 Bacteria 1112
554 Ga0495634_0351602 3300046642 Unclassified 882
555 Ga0495659_0011691 3300046664 Unclassified 2830
556 Ga0495659_0168692 3300046664 Bacteria 887
557 Ga0495623_0024206 3300046679 Bacteria 3916
558 Ga0495623_0076913 3300046679 Bacteria 2071
559 Ga0495658_0028030 3300046683 Unclassified 3036
560 Ga0495658_0862375 3300046683 Bacteria 579
561 Ga0495669_0245136 3300046684 Bacteria 860
562 Ga0495613_0139230 3300046689 Unclassified 1735
563 Ga0495613_0160396 3300046689 Unclassified 1600
564 Ga0495624_0389335 3300046690 Unclassified 837
565 Ga0495624_0746062 3300046690 Unclassified 580
566 Ga0495649_0680449 3300046694 Bacteria 505
567 Ga0495581_0028314 3300047315 Unclassified 3248
568 Ga0495674_0071711 3300047319 Unclassified 2989
569 Ga0495674_0557278 3300047319 Bacteria 912
570 Ga0495675_0039141 3300047444 Bacteria 3019
571 Ga0495602_0055511 3300048088 Bacteria 3488
572 Ga0495602_0120440 3300048088 Bacteria 2112
573 Ga0496100_0003857 3300048903 Bacteria 7862
574 Ga0496100_0130159 3300048903 Bacteria 1772
575 Ga0496101_0003461 3300048904 Bacteria 9848
576 Ga0496101_0421128 3300048904 Bacteria 1053
577 Ga0496101_0514226 3300048904 Unclassified 946
578 Ga0496101_1239157 3300048904 Unclassified 584
579 Ga0496102_0000537 3300048905 Bacteria 40994
580 Ga0496102_0048587 3300048905 Bacteria 3858
581 Ga0496102_0348965 3300048905 Unclassified 1393
582 Ga0496103_0010438 3300048906 Bacteria 5496
583 Ga0496103_0011600 3300048906 Bacteria 5225
584 Ga0496103_0053924 3300048906 Unclassified 2492
585 Ga0496104_0035988 3300048907 Bacteria 4625
586 Ga0496104_0043663 3300048907 Bacteria 4210
587 Ga0496104_0050923 3300048907 Bacteria 3907
588 Ga0496104_0305183 3300048907 Unclassified 1504
589 Ga0496104_0425768 3300048907 Bacteria 1239
590 Ga0496104_0863524 3300048907 Unclassified 810
591 Ga0496105_0031508 3300048908 Unclassified 4347
592 Ga0496105_0114955 3300048908 Bacteria 2220
593 Ga0496106_0062827 3300048909 Unclassified 2821
594 Ga0496106_0097339 3300048909 Unclassified 2278
595 Ga0496106_0113740 3300048909 Bacteria 2110
596 Ga0496106_0196932 3300048909 Unclassified 1603
597 Ga0496107_0227295 3300048910 Unclassified 1388
598 Ga0496107_0655022 3300048910 Bacteria 774
599 Ga0496108_0035693 3300048911 Bacteria 4134
600 Ga0496108_0094357 3300048911 Unclassified 2547
601 Ga0496108_0478731 3300048911 Unclassified 1088
602 Ga0496109_0039890 3300048912 Bacteria 4251
603 Ga0496109_0184031 3300048912 Bacteria 1963
604 Ga0496109_0209122 3300048912 Unclassified 1835
605 Ga0496110_0051224 3300048913 Bacteria 3628
606 Ga0496111_0014712 3300048914 Bacteria 5352
607 Ga0496111_0297310 3300048914 Unclassified 1197
608 Ga0496112_0001099 3300048915 Bacteria 20026
609 Ga0496112_0013062 3300048915 Bacteria 7661
610 Ga0496112_0037620 3300048915 Bacteria 4723
611 Ga0496112_0050195 3300048915 Bacteria 4090
612 Ga0496112_0082762 3300048915 Bacteria 3174
613 Ga0496113_0113103 3300048916 Bacteria 2115
614 Ga0496113_0274758 3300048916 Unclassified 1347
615 Ga0496114_0028113 3300048917 Bacteria 4612
616 Ga0496115_0004624 3300048918 Bacteria 9960
617 Ga0496115_0016349 3300048918 Bacteria 5648
618 nmdc:mga05p37_154518_c1 3300050507 Bacteria 2805
619 nmdc:mga0n895_459_c1 3300050512 Bacteria 27275
620 nmdc:mga0rr50_1097345_c1 3300050513 Unclassified 677
621 nmdc:mga0rr50_34917_c1 3300050513 Unclassified 3606
622 nmdc:mga0rr50_392022_c1 3300050513 Unclassified 1172
623 nmdc:mga0rr50_8978_c1 3300050513 Bacteria 6253
624 nmdc:mga08x19_18527_c1 3300050514 Unclassified 4267
625 nmdc:mga08x19_45921_c1 3300050514 Bacteria 2792
626 nmdc:mga08x19_6888_c1 3300050514 Bacteria 6749
627 nmdc:mga0a205_20163_c1 3300050515 Bacteria 6289
628 Ga0495601_0588585 3300053077 Unclassified 714
629 Ga0495595_0119575 3300053084 Bacteria 1283
630 Ga0070714_100600610
631 MBSR1b_contig_2190678
632 MBSR1b_contig_3904799
633 rootH1_10376184
634 Ga0065712_10114404
635 Ga0065715_10225510
636 Ga0070676_10041193
637 Ga0070683_100061135
638 Ga0070690_100005791
639 Ga0070690_100070525
640 Ga0070690_100151103
641 Ga0070677_10304308
642 Ga0068869_100001662
643 Ga0068869_100125000
644 Ga0070680_100089406
645 Ga0070682_100882074
646 Ga0068868_100001388
647 Ga0068868_100059864
648 Ga0068868_100082544
649 Ga0070660_100006387
650 Ga0070689_100252173
651 Ga0070691_10075503
652 Ga0070661_100013353
653 Ga0070692_10432210
654 Ga0070668_100044886
655 Ga0070675_100167505
656 Ga0070675_101598374
657 Ga0070671_100303127
658 Ga0070671_101148744
659 Ga0070674_100298065
660 Ga0070673_100542018
661 Ga0070659_100017607
662 Ga0070659_100102405
663 Ga0070667_100060743
664 Ga0070667_100160758
665 Ga0070667_100978188
666 Ga0070709_10064008
667 Ga0070709_10106736
668 Ga0070709_10129489
669 Ga0070709_10226545
670 Ga0070709_10242718
671 Ga0070714_100002082
672 Ga0070714_100070692
673 Ga0070714_100081772
674 Ga0070714_100877836
675 Ga0070713_100001170
676 Ga0070713_100041393
677 Ga0070713_100053651
678 Ga0070713_100085962
679 Ga0070713_100115254
680 Ga0070713_100149931
681 Ga0070713_100155486
682 Ga0070713_100215311
683 Ga0070713_100254257
684 Ga0070713_100478045
685 Ga0070713_100530545
686 Ga0070713_100632519
687 Ga0070710_10199946
688 Ga0070710_11523605
689 Ga0070701_10712957
690 Ga0070711_100003108
691 Ga0070711_100006478
692 Ga0070711_100089177
693 Ga0070711_100146764
694 Ga0070705_100080322
695 Ga0070705_100649900
696 Ga0070694_100002781
697 Ga0070694_100105575
698 Ga0070694_100457083
699 Ga0070708_100000263
700 Ga0070708_100002949
701 Ga0070708_100003924
702 Ga0070708_100022080
703 Ga0070708_100113948
704 Ga0070708_100495932
705 Ga0070663_100028694
706 Ga0070678_100023075
707 Ga0070678_100196038
708 Ga0070662_100002426
709 Ga0070681_10032433
710 Ga0070681_10267513
711 Ga0070681_10689449
712 Ga0068867_100017844
713 Ga0070685_10229445
714 Ga0070685_10309365
715 Ga0070685_10357492
716 Ga0070706_100001289
717 Ga0070706_100011557
718 Ga0070706_101101674
719 Ga0070707_100010726
720 Ga0070707_100140495
721 Ga0070707_100175140
722 Ga0070698_100000456
723 Ga0070698_100226784
724 Ga0070698_100782121
725 Ga0070699_100001799
726 Ga0070699_100011106
727 Ga0070699_100659643
728 Ga0070679_100085876
729 Ga0070679_100114065
730 Ga0070679_100185696
731 Ga0070679_100609836
732 Ga0070684_100007536
733 Ga0070684_100042554
734 Ga0070697_100000496
735 Ga0070697_100001425
736 Ga0070697_100012017
737 Ga0070697_100133441
738 Ga0070697_100274661
739 Ga0070697_100646421
740 Ga0070697_101174303
741 Ga0068853_100004992
742 Ga0068853_100093998
743 Ga0070672_100284088
744 Ga0070672_100466070
745 Ga0070686_100000633
746 Ga0070686_100015085
747 Ga0070686_100577302
748 Ga0070695_100061937
749 Ga0070695_100606262
750 Ga0070696_100289030
751 Ga0070693_100153242
752 Ga0070693_100218845
753 Ga0070665_100204252
754 Ga0070704_100013181
755 Ga0070704_100832958
756 Ga0068855_100058865
757 Ga0068855_100259717
758 Ga0068855_101304626
759 Ga0070664_100104985
760 Ga0070664_100203726
761 Ga0068857_100044015
762 Ga0068857_100083866
763 Ga0068854_100086725
764 Ga0068854_100102988
765 Ga0068854_100132729
766 Ga0068856_100005519
767 Ga0068856_100085984
768 Ga0068856_100113969
769 Ga0068856_100543427
770 Ga0068856_101556336
771 Ga0070702_100831871
772 Ga0068852_100015752
773 Ga0068859_100016880
774 Ga0068859_100054585
775 Ga0068864_100088024
776 Ga0068866_10038699
777 Ga0068861_100288922
778 Ga0068861_100589762
779 Ga0068851_10018270
780 Ga0068851_10811982
781 Ga0068863_100021802
782 Ga0068863_100057211
783 Ga0068858_100009222
784 Ga0068858_100039198
785 Ga0068858_100257833
786 Ga0068858_100885206
787 Ga0068860_100055729
788 Ga0068860_100222843
789 Ga0068860_100392847
790 Ga0068860_101311283
791 Ga0068862_100082071
792 Ga0068862_100150397
793 Ga0081540_1050975
794 Ga0070717_10002245
795 Ga0070717_10007223
796 Ga0070717_10012058
797 Ga0070717_10091269
798 Ga0070717_10128373
799 Ga0070717_10174963
800 Ga0070717_10259412
801 Ga0070717_10310932
802 Ga0070717_10716656
803 Ga0070717_10732223
804 Ga0070715_10332396
805 Ga0070716_100000526
806 Ga0070716_100006587
807 Ga0070716_100045220
808 Ga0070716_100046064
809 Ga0070716_100084109
810 Ga0070716_100108924
811 Ga0070716_100171595
812 Ga0070716_100414168
813 Ga0070716_100637364
814 Ga0070712_100000550
815 Ga0070712_100000969
816 Ga0070712_100008020
817 Ga0070712_100008354
818 Ga0070712_100049310
819 Ga0070712_100309169
820 Ga0070712_100635342
821 Ga0070712_100678283
822 Ga0097621_100013116
823 Ga0097621_100022304
824 Ga0097621_100199949
825 Ga0097621_100250655
826 Ga0097621_100341767
827 Ga0097621_101344316
828 Ga0068871_100030754
829 Ga0068871_100047582
830 Ga0068871_100061868
831 Ga0068871_100601320
832 Ga0075433_10005454
833 Ga0075434_100000416
834 Ga0075434_100321418
835 Ga0068865_100024800
836 Ga0068865_100067294
837 Ga0075436_100006264
838 Ga0075436_100049284
839 Ga0075436_100063044
840 Ga0097620_100016880
841 Ga0097620_100054586
842 Ga0075435_100018943
843 Ga0075435_100025747
844 Ga0075435_100445630
845 Ga0105250_10281540
846 Ga0105240_10009649
847 Ga0105240_10067816
848 Ga0111539_11096966
849 Ga0105245_10068422
850 Ga0105245_10132404
851 Ga0105245_10431470
852 Ga0105245_10821238
853 Ga0105247_10013079
854 Ga0105247_10078385
855 Ga0105247_10121480
856 Ga0114129_10150815
857 Ga0105241_10006514
858 Ga0105241_10022680
859 Ga0105241_10161139
860 Ga0105241_10555812
861 Ga0105242_10116161
862 Ga0105248_10006081
863 Ga0105248_10102641
864 Ga0105248_10161215
865 Ga0105237_10027226
866 Ga0105237_10036130
867 Ga0105237_10201447
868 Ga0105237_10217528
869 Ga0105237_10401644
870 Ga0105238_10022710
871 Ga0105238_10023137
872 Ga0105238_10140412
873 Ga0105238_10155261
874 Ga0105238_10240384
875 Ga0105249_10004117
876 Ga0105239_10014150
877 Ga0105239_10135233
878 Ga0105246_10037404
879 Ga0157373_10145969
880 Ga0157373_10147417
881 Ga0157371_10011857
882 Ga0157371_10180333
883 Ga0157371_10464865
884 Ga0157370_10158132
885 Ga0157370_10246814
886 Ga0157370_10347078
887 Ga0157369_10042263
888 Ga0157369_10101196
889 Ga0157369_10427651
890 Ga0157374_10001092
891 Ga0157374_10002984
892 Ga0157374_10008704
893 Ga0157374_10019060
894 Ga0157374_10154667
895 Ga0157374_10483781
896 Ga0157378_10000151
897 Ga0157378_10040368
898 Ga0157378_10128829
899 Ga0157378_10262763
900 Ga0157378_11361619
901 Ga0163162_10002065
902 Ga0163162_10019988
903 Ga0163162_10179078
904 Ga0157372_10001206
905 Ga0157372_10028555
906 Ga0157372_10051345
907 Ga0157372_10199253
908 Ga0157372_10207642
909 Ga0157372_10941870
910 Ga0157372_12710549
911 Ga0157375_10214888
912 Ga0163163_10123035
913 Ga0182008_10145511
914 Ga0157377_10086543
915 Ga0157379_10006291
916 Ga0157379_10015074
917 Ga0157379_10016233
918 Ga0157379_10099315
919 Ga0157376_10122549
920 Ga0157376_10382079
921 Ga0157376_10699791
922 Ga0182006_1018783
923 Ga0182007_10021918
924 Ga0182005_1009501
925 Ga0163161_10487205
926 Ga0213874_10174301
927 Ga0207697_10162063
928 Ga0207656_10041404
929 Ga0207692_10005206
930 Ga0207692_10241497
931 Ga0207692_10301561
932 Ga0207680_10041482
933 Ga0207647_10007186
934 Ga0207685_10206560
935 Ga0207685_10237773
936 Ga0207699_10026236
937 Ga0207699_10030164
938 Ga0207699_10051162
939 Ga0207699_10281665
940 Ga0207699_10363977
941 Ga0207699_10578759
942 Ga0207699_10907489
943 Ga0207645_10022895
944 Ga0207684_10001754
945 Ga0207684_10013315
946 Ga0207654_10004043
947 Ga0207654_10009332
948 Ga0207654_10016406
949 Ga0207654_10147618
950 Ga0207654_10347267
951 Ga0207654_10492266
952 Ga0207707_10731299
953 Ga0207695_10045992
954 Ga0207695_10460380
955 Ga0207695_10991980
956 Ga0207671_10052188
957 Ga0207671_10287990
958 Ga0207693_10000362
959 Ga0207693_10000457
960 Ga0207693_10003882
961 Ga0207693_10037771
962 Ga0207693_10037868
963 Ga0207693_10387258
964 Ga0207693_10536329
965 Ga0207663_10004317
966 Ga0207663_10005278
967 Ga0207663_10031765
968 Ga0207663_10170414
969 Ga0207663_10246187
970 Ga0207660_10105507
971 Ga0207657_10000246
972 Ga0207657_10001266
973 Ga0207649_10194019
974 Ga0207649_10799065
975 Ga0207652_10070448
976 Ga0207652_10225325
977 Ga0207646_10002216
978 Ga0207646_10812080
979 Ga0207681_10306667
980 Ga0207694_10137574
981 Ga0207694_10260560
982 Ga0207694_10808101
983 Ga0207650_10847915
984 Ga0207687_10011229
985 Ga0207687_10329372
986 Ga0207687_10567599
987 Ga0207700_10000528
988 Ga0207700_10030361
989 Ga0207700_10136256
990 Ga0207700_10177585
991 Ga0207700_10195776
992 Ga0207700_10339977
993 Ga0207700_10651653
994 Ga0207700_11115995
995 Ga0207664_10068294
996 Ga0207664_10081835
997 Ga0207664_10455043
998 Ga0207664_10466375
999 Ga0207664_10641495
1000 Ga0207664_10885864
1001 Ga0207644_10183242
1002 Ga0207644_10980717
1003 Ga0207690_10010651
1004 Ga0207706_10000139
1005 Ga0207686_10089477
1006 Ga0207709_10171480
1007 Ga0207670_10086519
1008 Ga0207704_10195188
1009 Ga0207665_10000281
1010 Ga0207665_10002897
1011 Ga0207665_10060910
1012 Ga0207665_10067516
1013 Ga0207665_10146092
1014 Ga0207665_10148243
1015 Ga0207665_10155654
1016 Ga0207665_10756454
1017 Ga0207665_10917858
1018 Ga0207691_10459555
1019 Ga0207691_10521745
1020 Ga0207711_10011787
1021 Ga0207711_10189569
1022 Ga0207711_10319858
1023 Ga0207711_11335610
1024 Ga0207689_10001053
1025 Ga0207689_10064306
1026 Ga0207679_10027166
1027 Ga0207679_10040898
1028 Ga0207667_10004029
1029 Ga0207667_10311841
1030 Ga0207667_10524786
1031 Ga0207667_11118186
1032 Ga0207651_10657041
1033 Ga0207712_10024542
1034 Ga0207668_10454113
1035 Ga0207640_10036120
1036 Ga0207640_10078421
1037 Ga0207640_10218202
1038 Ga0207658_10041406
1039 Ga0207658_10496255
1040 Ga0207658_10873932
1041 Ga0207677_10005049
1042 Ga0207677_10057478
1043 Ga0207677_10372891
1044 Ga0207703_10001863
1045 Ga0207703_10160535
1046 Ga0207703_10166493
1047 Ga0207639_10200155
1048 Ga0207639_10223963
1049 Ga0207639_10325450
1050 Ga0207678_10004676
1051 Ga0207678_10283047
1052 Ga0207702_10014881
1053 Ga0207702_10016745
1054 Ga0207702_10028337
1055 Ga0207702_10097171
1056 Ga0207702_10145508
1057 Ga0207702_10847822
1058 Ga0207702_12191879
1059 Ga0207641_10026028
1060 Ga0207641_10078652
1061 Ga0207641_10875878
1062 Ga0207648_10003612
1063 Ga0207676_10114539
1064 Ga0207674_10009505
1065 Ga0207674_10049003
1066 Ga0207675_100112550
1067 Ga0207675_100246773
1068 Ga0207675_100252047
1069 Ga0207683_10121435
1070 Ga0207683_10554141
1071 Ga0207683_11497712
1072 Ga0207698_10044147
1073 Ga0268266_10120411
1074 Ga0268265_10063459
1075 Ga0268265_10079197
1076 Ga0268264_10106135
1077 Ga0268264_10242987
1078 Ga0265338_10038645
1079 Ga0265338_10142086
1080 Ga0265773_1022057
1081 Ga0265760_10066621
1082 Ga0265330_10044813
1083 Ga0265320_10282780
1084 Ga0265325_10002327
1085 Ga0265325_10156088
1086 Ga0265316_10026020
1087 Ga0307408_100203117
1088 Ga0265314_10233646
1089 Ga0307405_10191915
1090 Ga0307410_10117580
1091 Ga0307406_10040090
1092 Ga0307407_10043039
1093 Ga0307411_10020125
1094 Ga0307415_100147613
1095 Ga0373928_0011668
1096 Ga0373951_0031557
1097 Ga0373936_0016526
1098 Ga0373936_0039064
1099 Ga0373936_0161853
1100 Ga0373941_0506490
1101 Ga0373945_0039365
1102 Ga0373945_0100915
1103 Ga0373943_0013463
1104 Ga0373943_0085500
1105 Ga0373943_0114633
1106 Ga0373943_0797339
1107 Ga0373946_0079993
1108 Ga0373955_0247267
1109 Ga0373961_0228491
1110 Ga0373962_0197863
1111 Ga0373931_0052209
1112 Ga0373931_0064157
1113 Ga0373931_0246544
1114 Ga0373935_0016193
1115 Ga0373935_0034720
1116 Ga0373927_0016852
1117 Ga0373927_0117903
1118 Ga0373927_1039742
1119 Ga0373933_0253547
1120 Ga0373933_0256573
1121 Ga0373947_0025855
1122 Ga0373947_0121902
1123 Ga0373937_0035986
1124 Ga0373937_0138139
1125 Ga0373937_0241999
1126 Ga0373937_0378841
1127 Ga0373937_0721102
1128 Ga0373925_0001086
1129 Ga0373925_0031457
1130 Ga0373925_0414160
1131 Ga0373925_0688099
1132 Ga0373925_1113030
1133 Ga0395898_0302118
1134 Ga0395898_0337093
1135 Ga0395905_1201646
1136 Ga0436364_0731791
1137 Ga0395901_1265249
1138 Ga0395901_1581680
1139 Ga0436365_0870896
1140 Ga0436360_1079114
1141 Ga0436363_0581010
1142 Ga0436363_0701884
1143 Ga0436363_1291424
1144 Ga0436362_0501176
1145 Ga0451853_1623157
1146 Ga0451577_0000157
1147 Ga0451577_1083076
1148 Ga0453683_0036319
1149 Ga0453684_0000686
1150 Ga0453684_1251295
1151 Ga0451576_0065280
1152 Ga0451576_0236473
1153 Ga0451576_0279170
1154 Ga0466967_0032045
1155 Ga0495603_0377504
1156 Ga0495629_0107727
1157 Ga0495641_0429074
1158 Ga0495580_0003182
1159 Ga0495580_0005751
1160 Ga0495580_0008637
1161 Ga0495580_0015718
1162 Ga0495580_0037477
1163 Ga0495580_0318257
1164 Ga0495580_0357905
1165 Ga0495580_0635978
1166 Ga0495580_0962831
1167 Ga0495582_0001766
1168 Ga0495582_0018863
1169 Ga0495582_0031347
1170 Ga0495639_0075273
1171 Ga0495662_0076804
1172 Ga0495662_0273111
1173 Ga0495618_0600212
1174 Ga0495630_0523832
1175 Ga0495630_0866496
1176 Ga0495666_0213362
1177 Ga0495665_0010815
1178 Ga0495665_0080543
1179 Ga0495665_0320919
1180 Ga0495586_0002383
1181 Ga0495586_0450178
1182 Ga0495667_0256731
1183 Ga0495634_0351602
1184 Ga0495659_0011691
1185 Ga0495659_0168692
1186 Ga0495623_0024206
1187 Ga0495623_0076913
1188 Ga0495658_0028030
1189 Ga0495658_0862375
1190 Ga0495669_0245136
1191 Ga0495613_0139230
1192 Ga0495613_0160396
1193 Ga0495624_0389335
1194 Ga0495624_0746062
1195 Ga0495649_0680449
1196 Ga0495581_0028314
1197 Ga0495674_0071711
1198 Ga0495674_0557278
1199 Ga0495675_0039141
1200 Ga0495602_0055511
1201 Ga0495602_0120440
1202 Ga0496100_0003857
1203 Ga0496100_0130159
1204 Ga0496101_0003461
1205 Ga0496101_0421128
1206 Ga0496101_0514226
1207 Ga0496101_1239157
1208 Ga0496102_0000537
1209 Ga0496102_0048587
1210 Ga0496102_0348965
1211 Ga0496103_0010438
1212 Ga0496103_0011600
1213 Ga0496103_0053924
1214 Ga0496104_0035988
1215 Ga0496104_0043663
1216 Ga0496104_0050923
1217 Ga0496104_0305183
1218 Ga0496104_0425768
1219 Ga0496104_0863524
1220 Ga0496105_0031508
1221 Ga0496105_0114955
1222 Ga0496106_0062827
1223 Ga0496106_0097339
1224 Ga0496106_0113740
1225 Ga0496106_0196932
1226 Ga0496107_0227295
1227 Ga0496107_0655022
1228 Ga0496108_0035693
1229 Ga0496108_0094357
1230 Ga0496108_0478731
1231 Ga0496109_0039890
1232 Ga0496109_0184031
1233 Ga0496109_0209122
1234 Ga0496110_0051224
1235 Ga0496111_0014712
1236 Ga0496111_0297310
1237 Ga0496112_0001099
1238 Ga0496112_0013062
1239 Ga0496112_0037620
1240 Ga0496112_0050195
1241 Ga0496112_0082762
1242 Ga0496113_0113103
1243 Ga0496113_0274758
1244 Ga0496114_0028113
1245 Ga0496115_0004624
1246 Ga0496115_0016349
1247 nmdc:mga05p37_154518_c1
1248 nmdc:mga0n895_459_c1
1249 nmdc:mga0rr50_1097345_c1
1250 nmdc:mga0rr50_34917_c1
1251 nmdc:mga0rr50_392022_c1
1252 nmdc:mga0rr50_8978_c1
1253 nmdc:mga08x19_18527_c1
1254 nmdc:mga08x19_45921_c1
1255 nmdc:mga08x19_6888_c1
1256 nmdc:mga0a205_20163_c1
1257 Ga0495601_0588585
1258 Ga0495595_0119575

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04238

DUF420

Protein of unknown function (DUF420)

10

132

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
7jrq-assembly1.cif.gz_A crystallographically characterized de novo designed mn-diphenylporphyrin binding protein 0.7383 3 143
8q1b-assembly1.cif.gz_c iii2-iv1 respiratory supercomplex from s. pombe 0.7229 9 140
7o3e-assembly1.cif.gz_c murine supercomplex ciii2civ in the intermediate locked conformation 0.7132 9 140
6adq-assembly1.cif.gz_S respiratory complex ciii2civ2sod2 from mycobacterium smegmatis 0.7068 8 139
7rh5-assembly1.cif.gz_S mycobacterial ciii2civ2 supercomplex, inhibitor free 0.7061 6 139
ID Description Score Start End Superfamily
af_Q0WRW8_184_365_1.20.120.1770 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.7087 1 142 1.20.120.1770
af_I1JRZ9_200_386_1.20.120.1770 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.7057 4 143 1.20.120.1770
af_A0A1D6NFR3_201_388_1.20.120.1770 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.7011 1 143 1.20.120.1770
af_Q9M363_194_379_1.20.120.1770 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.6961 1 142 1.20.120.1770
af_Q0WRW8_184_365_1.20.120.1770 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.6957 1 142 1.20.120.1770
ID Description Score Start End GO Terms
AF-A0A5R8KD99-F1-model_v4 DUF420 domain-containing protein 0.995 5 138 GO:0016020
AF-A0A372IRR1-F1-model_v4 DUF420 domain-containing protein 0.9937 7 136 GO:0016020
AF-A0A7C4UW82-F1-model_v4 DUF420 domain-containing protein 0.9928 5 142 GO:0016020
AF-A0A496XTQ9-F1-model_v4 DUF420 domain-containing protein 0.9928 5 140 GO:0016020
AF-A0A7C3NIQ9-F1-model_v4 DUF420 domain-containing protein 0.9922 5 137 GO:0016020

Map