F470632
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 628 | 322 | 597 | 137 |
Family's Representative Sequence
| Representative Sequence | 3300006178|Ga0075367_10434599|Ga0075367_104345992 |
| Length | 129 |
| Sequence | MGDLLGPDPVLLPGDPAAEAELAASENPSIVAAAHPSASVAWAALAEKAVTAYAYARTGYHRGLDQLRRNGWKGFGPVPFNHQPNRGFLRCVAALAKAADTIGETDEYQRCLDLLDDCDPAARAELGLT |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2565956761 | Rhodococcus qingshengii BKS 20-40 | Isolate | Rhizosphere |
| 2 | 2643221715 | Mycobacterium sp. Root265 | Isolate | Unclassified |
| 3 | 2738541308 | Rhodococcus sp. OK551 | Isolate | Unclassified |
| 4 | 2738541356 | Mycobacterium sp. OK887 | Isolate | Unclassified |
| 5 | 2738543005 | Rhodococcus sp. OK519 | Isolate | Unclassified |
| 6 | 2738543011 | Rhodococcus sp. OK611 | Isolate | Unclassified |
| 7 | 2738543034 | Rhodococcus sp. OK269 | Isolate | Unclassified |
| 8 | 2751185725 | Microbispora sp. NRRL B-24597 | Isolate | Unclassified |
| 9 | 2751185792 | Kitasatospora arboriphila NRRL B-24581 | Isolate | Unclassified |
| 10 | 2816332139 | Pseudonocardia kunmingensis DSM 45301 | Isolate | Unclassified |
| 11 | 2852635781 | Streptomyces sp. AK010 | Isolate | Rhizosphere |
| 12 | 2889300758 | Rhodococcus sp. PvR099 | Isolate | Rhizosphere |
| 13 | 2902792274 | Mycolicibacterium sp. P9-64 | Isolate | Unclassified |
| 14 | 2902799365 | Mycolicibacterium sp. P1-5 | Isolate | Unclassified |
| 15 | 2904535858 | Rhodococcus erythropolis 2017 | Isolate | Unclassified |
| 16 | 2904765812 | Rhodococcus fascians 1590 | Isolate | Rhizosphere |
| 17 | 2904770941 | Rhodococcus fascians 1339 | Isolate | Rhizosphere |
| 18 | 2908811453 | Rhodococcus sp. 1R11 | Isolate | Unclassified |
| 19 | 2912723979 | Streptomyces sp. NEAU-sy36 | Isolate | Rhizosphere |
| 20 | 2919420072 | Rhodococcus fascians 3241 | Isolate | Rhizosphere |
| 21 | 2919432681 | Rhodococcus sp. 3258 | Isolate | Rhizosphere |
| 22 | 2922554459 | Rhodococcus sp. 66b | Isolate | Unclassified |
| 23 | 2928142448 | Prescottella equi DPS 2018 | Isolate | Unclassified |
| 24 | 2929212328 | Mycolicibacterium sp. R-73050 Hybrid assembly | Isolate | Unclassified |
| 25 | 2932398195 | Dietzia sp. 2505 | Isolate | Rhizosphere |
| 26 | 2939582691 | Mycolicibacterium sp. 624 | Isolate | Rhizosphere |
| 27 | 2939743619 | Rhodococcus sp. PvR044 | Isolate | Rhizosphere |
| 28 | 2956939328 | Lolliginicoccus suaedae LNNU 331112 | Isolate | Rhizosphere |
| 29 | 2984523437 | Rhodococcus sp. SORGH_AS303 | Isolate | Aerial Root |
| 30 | 3001119090 | Lolliginicoccus lacisalsi G463 | Isolate | Rhizosphere |
| 31 | 3006486233 | Streptomyces sp. BR123 | Isolate | Rhizosphere |
| 32 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 33 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 34 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 35 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 36 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 37 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 38 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 39 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 40 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 41 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 42 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 48 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 50 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 51 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 52 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 54 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 55 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 56 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 65 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 69 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 70 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 71 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 73 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 74 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 79 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 80 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 81 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 82 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 83 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 84 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 85 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 86 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 87 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 88 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 89 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 90 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 91 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 92 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 93 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 94 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 95 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 96 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 97 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 98 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 99 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 100 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 101 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 102 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 103 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 104 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 105 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 106 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 107 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 108 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 109 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 110 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 111 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 112 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 113 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 114 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 115 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 116 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 117 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 118 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 120 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 121 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 122 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 123 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 129 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 130 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 131 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 132 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 133 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 134 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 135 | 3300009993 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG | Metagenome | Rhizosphere |
| 136 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 137 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 138 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 143 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 144 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 145 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 146 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 147 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 148 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 149 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 150 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 151 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 152 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 153 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 154 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 155 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 218 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 219 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 220 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 221 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 222 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 223 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 224 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 225 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 226 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 227 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 228 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 229 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 230 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 231 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 232 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 233 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 234 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 235 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 236 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 237 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 238 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 239 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 240 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 241 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 242 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 243 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 244 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 245 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 246 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 247 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 248 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 249 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 250 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 251 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 252 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 253 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 254 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 255 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 271 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 272 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 273 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 274 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 275 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 276 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 277 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 278 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 279 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 280 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 281 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 282 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 283 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 284 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 285 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 286 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 287 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 288 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 289 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 290 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 291 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 292 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 293 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 294 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 295 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 296 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 297 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 298 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 299 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 300 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 301 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 302 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 303 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 304 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 305 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 306 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 307 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 308 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 309 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 310 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 311 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 312 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 313 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 314 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 316 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 317 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 318 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 319 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 320 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 321 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 322 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 94.9 |
| Metatranscriptomes | 0.16 |
| Isolates | 4.94 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.16 |
| Bulb | 0 |
| Endosphere | 7.17 |
| Nodule | 0 |
| Rhizoplane | 10.35 |
| Rhizosphere | 77.07 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 5.25 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24739J22299_10042173 | 3300001989 | Bacteria | 1514 |
| 2 | JGI24743J22301_10018902 | 3300001991 | Bacteria | 1305 |
| 3 | JGI24735J21928_10106489 | 3300002067 | Bacteria | 806 |
| 4 | JGI24735J21928_10224958 | 3300002067 | Bacteria | 545 |
| 5 | JGI24750J21931_1011933 | 3300002070 | Bacteria | 1147 |
| 6 | JGI24745J21846_1014878 | 3300002073 | Bacteria | 900 |
| 7 | JGI24738J21930_10014628 | 3300002075 | Bacteria | 1681 |
| 8 | JGI24749J21850_1001138 | 3300002076 | Bacteria | 3772 |
| 9 | JGI24744J21845_10004535 | 3300002077 | Bacteria | 2870 |
| 10 | JGI24034J26672_10007250 | 3300002239 | Bacteria | 1608 |
| 11 | JGI24742J22300_10004587 | 3300002244 | Bacteria | 2265 |
| 12 | Ga0070658_10745375 | 3300005327 | Bacteria | 850 |
| 13 | Ga0070658_11960984 | 3300005327 | Bacteria | 505 |
| 14 | Ga0070676_10003302 | 3300005328 | Bacteria | 8384 |
| 15 | Ga0070683_100254556 | 3300005329 | Bacteria | 1670 |
| 16 | Ga0070683_101099834 | 3300005329 | Bacteria | 763 |
| 17 | Ga0070683_101561657 | 3300005329 | Bacteria | 634 |
| 18 | Ga0070683_101576162 | 3300005329 | Bacteria | 631 |
| 19 | Ga0070670_100984562 | 3300005331 | Bacteria | 766 |
| 20 | Ga0070677_10358996 | 3300005333 | Bacteria | 757 |
| 21 | Ga0068869_100006214 | 3300005334 | Bacteria | 7562 |
| 22 | Ga0068869_100070150 | 3300005334 | Bacteria | 2592 |
| 23 | Ga0068869_100258751 | 3300005334 | Bacteria | 1393 |
| 24 | Ga0070666_10107736 | 3300005335 | Bacteria | 1925 |
| 25 | Ga0070680_100216831 | 3300005336 | Bacteria | 1615 |
| 26 | Ga0070682_100195266 | 3300005337 | Bacteria | 1424 |
| 27 | Ga0070682_100304149 | 3300005337 | Bacteria | 1171 |
| 28 | Ga0070682_100307199 | 3300005337 | Bacteria | 1166 |
| 29 | Ga0070682_100948114 | 3300005337 | Bacteria | 710 |
| 30 | Ga0068868_100000598 | 3300005338 | Bacteria | 24261 |
| 31 | Ga0068868_100124807 | 3300005338 | Bacteria | 2102 |
| 32 | Ga0068868_100808185 | 3300005338 | Bacteria | 846 |
| 33 | Ga0070660_100798772 | 3300005339 | Bacteria | 793 |
| 34 | Ga0070689_100335966 | 3300005340 | Bacteria | 1265 |
| 35 | Ga0070691_10012130 | 3300005341 | Bacteria | 3947 |
| 36 | Ga0070691_10236000 | 3300005341 | Bacteria | 975 |
| 37 | Ga0070687_100149690 | 3300005343 | Bacteria | 1369 |
| 38 | Ga0070661_100961635 | 3300005344 | Bacteria | 707 |
| 39 | Ga0070692_10070532 | 3300005345 | Bacteria | 1861 |
| 40 | Ga0070692_10557888 | 3300005345 | Bacteria | 751 |
| 41 | Ga0070668_100005926 | 3300005347 | Bacteria | 9058 |
| 42 | Ga0070668_100011482 | 3300005347 | Bacteria | 6594 |
| 43 | Ga0070668_100346901 | 3300005347 | Bacteria | 1255 |
| 44 | Ga0070668_100673881 | 3300005347 | Bacteria | 910 |
| 45 | Ga0070669_100006306 | 3300005353 | Bacteria | 8550 |
| 46 | Ga0070675_100429213 | 3300005354 | Bacteria | 1183 |
| 47 | Ga0070671_100158444 | 3300005355 | Bacteria | 1913 |
| 48 | Ga0070674_100001268 | 3300005356 | Bacteria | 13286 |
| 49 | Ga0070674_100233831 | 3300005356 | Bacteria | 1436 |
| 50 | Ga0070674_101700217 | 3300005356 | Bacteria | 571 |
| 51 | Ga0070673_100487354 | 3300005364 | Bacteria | 1114 |
| 52 | Ga0070688_100013586 | 3300005365 | Bacteria | 4597 |
| 53 | Ga0070688_100222984 | 3300005365 | Bacteria | 1329 |
| 54 | Ga0070659_100033509 | 3300005366 | Bacteria | 3989 |
| 55 | Ga0070659_100061193 | 3300005366 | Bacteria | 2975 |
| 56 | Ga0070659_101086965 | 3300005366 | Bacteria | 704 |
| 57 | Ga0070667_100001266 | 3300005367 | Bacteria | 22917 |
| 58 | Ga0070667_100163160 | 3300005367 | Bacteria | 1964 |
| 59 | Ga0070714_100272375 | 3300005435 | Bacteria | 1570 |
| 60 | Ga0070713_100572270 | 3300005436 | Bacteria | 1071 |
| 61 | Ga0070710_10002134 | 3300005437 | Bacteria | 9377 |
| 62 | Ga0070701_10001535 | 3300005438 | Bacteria | 8559 |
| 63 | Ga0070711_100000399 | 3300005439 | Bacteria | 22400 |
| 64 | Ga0070711_101058326 | 3300005439 | Bacteria | 698 |
| 65 | Ga0070700_100023189 | 3300005441 | Bacteria | 3628 |
| 66 | Ga0070700_100041790 | 3300005441 | Bacteria | 2812 |
| 67 | Ga0070700_100088501 | 3300005441 | Bacteria | 2015 |
| 68 | Ga0070700_100417693 | 3300005441 | Bacteria | 1013 |
| 69 | Ga0070694_100071304 | 3300005444 | Bacteria | 2395 |
| 70 | Ga0070694_100470033 | 3300005444 | Bacteria | 996 |
| 71 | Ga0070708_100308638 | 3300005445 | Bacteria | 1490 |
| 72 | Ga0070663_100000824 | 3300005455 | Bacteria | 16823 |
| 73 | Ga0070663_100362238 | 3300005455 | Bacteria | 1176 |
| 74 | Ga0070663_100523620 | 3300005455 | Bacteria | 987 |
| 75 | Ga0070663_100866778 | 3300005455 | Bacteria | 778 |
| 76 | Ga0070678_100009847 | 3300005456 | Bacteria | 5810 |
| 77 | Ga0070678_100335327 | 3300005456 | Bacteria | 1295 |
| 78 | Ga0070678_100438145 | 3300005456 | Bacteria | 1142 |
| 79 | Ga0070678_100582178 | 3300005456 | Bacteria | 997 |
| 80 | Ga0070678_100645077 | 3300005456 | Bacteria | 949 |
| 81 | Ga0070678_101818482 | 3300005456 | Bacteria | 574 |
| 82 | Ga0070662_100001067 | 3300005457 | Bacteria | 16714 |
| 83 | Ga0070662_101592891 | 3300005457 | Bacteria | 563 |
| 84 | Ga0070662_101986619 | 3300005457 | Bacteria | 502 |
| 85 | Ga0070681_10526997 | 3300005458 | Bacteria | 1095 |
| 86 | Ga0070681_10707306 | 3300005458 | Bacteria | 923 |
| 87 | Ga0068867_100031064 | 3300005459 | Bacteria | 3855 |
| 88 | Ga0068867_100198536 | 3300005459 | Bacteria | 1605 |
| 89 | Ga0068867_101780083 | 3300005459 | Bacteria | 579 |
| 90 | Ga0070685_10145206 | 3300005466 | Bacteria | 1498 |
| 91 | Ga0070685_10164305 | 3300005466 | Bacteria | 1417 |
| 92 | Ga0070685_10572054 | 3300005466 | Bacteria | 809 |
| 93 | Ga0070679_100189091 | 3300005530 | Bacteria | 2029 |
| 94 | Ga0070684_100109176 | 3300005535 | Bacteria | 2479 |
| 95 | Ga0070684_100274728 | 3300005535 | Bacteria | 1543 |
| 96 | Ga0070684_100759175 | 3300005535 | Bacteria | 906 |
| 97 | Ga0068853_100001822 | 3300005539 | Bacteria | 15671 |
| 98 | Ga0068853_100431796 | 3300005539 | Bacteria | 1237 |
| 99 | Ga0070672_100339154 | 3300005543 | Bacteria | 1280 |
| 100 | Ga0070672_100359812 | 3300005543 | Bacteria | 1242 |
| 101 | Ga0070672_100456824 | 3300005543 | Bacteria | 1101 |
| 102 | Ga0070686_100434292 | 3300005544 | Bacteria | 1006 |
| 103 | Ga0070696_100003604 | 3300005546 | Bacteria | 10311 |
| 104 | Ga0070696_100292558 | 3300005546 | Bacteria | 1245 |
| 105 | Ga0070693_100014542 | 3300005547 | Bacteria | 4035 |
| 106 | Ga0070693_100564533 | 3300005547 | Bacteria | 817 |
| 107 | Ga0070665_100138784 | 3300005548 | Bacteria | 2434 |
| 108 | Ga0070665_100277616 | 3300005548 | Bacteria | 1677 |
| 109 | Ga0070665_100298116 | 3300005548 | Bacteria | 1615 |
| 110 | Ga0070665_101846542 | 3300005548 | Bacteria | 610 |
| 111 | Ga0070704_100000142 | 3300005549 | Bacteria | 27154 |
| 112 | Ga0068855_100013561 | 3300005563 | Bacteria | 9830 |
| 113 | Ga0068855_100214605 | 3300005563 | Bacteria | 2161 |
| 114 | Ga0068855_102095093 | 3300005563 | Bacteria | 570 |
| 115 | Ga0070664_100121064 | 3300005564 | Bacteria | 2291 |
| 116 | Ga0070664_100763667 | 3300005564 | Bacteria | 903 |
| 117 | Ga0068857_100498657 | 3300005577 | Bacteria | 1142 |
| 118 | Ga0068854_100000132 | 3300005578 | Bacteria | 51381 |
| 119 | Ga0068856_100082414 | 3300005614 | Bacteria | 3192 |
| 120 | Ga0068856_100228963 | 3300005614 | Bacteria | 1874 |
| 121 | Ga0068856_100302742 | 3300005614 | Bacteria | 1616 |
| 122 | Ga0070702_100000433 | 3300005615 | Bacteria | 14899 |
| 123 | Ga0070702_100567380 | 3300005615 | Bacteria | 845 |
| 124 | Ga0070702_101735431 | 3300005615 | Bacteria | 520 |
| 125 | Ga0068852_100041014 | 3300005616 | Bacteria | 3909 |
| 126 | Ga0068852_100166125 | 3300005616 | Bacteria | 2065 |
| 127 | Ga0068852_100344989 | 3300005616 | Bacteria | 1452 |
| 128 | Ga0068859_100072721 | 3300005617 | Bacteria | 3475 |
| 129 | Ga0068859_101375111 | 3300005617 | Bacteria | 778 |
| 130 | Ga0068864_100063256 | 3300005618 | Bacteria | 3207 |
| 131 | Ga0068864_100245745 | 3300005618 | Bacteria | 1659 |
| 132 | Ga0068864_100861423 | 3300005618 | Bacteria | 893 |
| 133 | Ga0068866_10000146 | 3300005718 | Bacteria | 31984 |
| 134 | Ga0068866_10396827 | 3300005718 | Bacteria | 889 |
| 135 | Ga0068861_100000573 | 3300005719 | Bacteria | 21796 |
| 136 | Ga0068861_100066848 | 3300005719 | Bacteria | 2772 |
| 137 | Ga0068861_100095142 | 3300005719 | Bacteria | 2358 |
| 138 | Ga0068870_10030119 | 3300005840 | Bacteria | 2741 |
| 139 | Ga0068870_10205280 | 3300005840 | Bacteria | 1197 |
| 140 | Ga0068870_10845891 | 3300005840 | Bacteria | 642 |
| 141 | Ga0068863_100239522 | 3300005841 | Bacteria | 1751 |
| 142 | Ga0068858_100001434 | 3300005842 | Bacteria | 24529 |
| 143 | Ga0068858_100057285 | 3300005842 | Bacteria | 3601 |
| 144 | Ga0068858_100357762 | 3300005842 | Bacteria | 1399 |
| 145 | Ga0068860_100000994 | 3300005843 | Bacteria | 31355 |
| 146 | Ga0068860_100293233 | 3300005843 | Bacteria | 1592 |
| 147 | Ga0068862_100001311 | 3300005844 | Bacteria | 23156 |
| 148 | Ga0068862_100286425 | 3300005844 | Bacteria | 1511 |
| 149 | Ga0068862_100632906 | 3300005844 | Bacteria | 1030 |
| 150 | Ga0081538_10238705 | 3300005981 | Bacteria | 703 |
| 151 | Ga0070717_10263979 | 3300006028 | Bacteria | 1524 |
| 152 | Ga0070717_11068368 | 3300006028 | Bacteria | 735 |
| 153 | Ga0070717_12160107 | 3300006028 | Bacteria | 500 |
| 154 | Ga0075365_10346689 | 3300006038 | Bacteria | 1047 |
| 155 | Ga0075363_100054745 | 3300006048 | Bacteria | 2135 |
| 156 | Ga0075363_100259503 | 3300006048 | Bacteria | 1002 |
| 157 | Ga0075363_100325804 | 3300006048 | Bacteria | 894 |
| 158 | Ga0075363_100363698 | 3300006048 | Bacteria | 846 |
| 159 | Ga0075363_100515004 | 3300006048 | Bacteria | 711 |
| 160 | Ga0075364_10009617 | 3300006051 | Bacteria | 5807 |
| 161 | Ga0075364_10231945 | 3300006051 | Bacteria | 1253 |
| 162 | Ga0075432_10530079 | 3300006058 | Bacteria | 529 |
| 163 | Ga0070715_10026657 | 3300006163 | Bacteria | 2301 |
| 164 | Ga0070716_100009665 | 3300006173 | Bacteria | 4812 |
| 165 | Ga0070716_100275711 | 3300006173 | Bacteria | 1158 |
| 166 | Ga0070712_100001186 | 3300006175 | Bacteria | 15742 |
| 167 | Ga0070712_100185238 | 3300006175 | Bacteria | 1625 |
| 168 | Ga0075362_10061322 | 3300006177 | Bacteria | 1702 |
| 169 | Ga0075367_10434599 | 3300006178 | Bacteria | 831 |
| 170 | Ga0075369_10004548 | 3300006186 | Bacteria | 5134 |
| 171 | Ga0097621_102051118 | 3300006237 | Bacteria | 546 |
| 172 | Ga0075370_10093839 | 3300006353 | Bacteria | 1732 |
| 173 | Ga0075370_10216189 | 3300006353 | Bacteria | 1132 |
| 174 | Ga0075370_10240800 | 3300006353 | Bacteria | 1071 |
| 175 | Ga0075370_10377292 | 3300006353 | Bacteria | 849 |
| 176 | Ga0075370_10381802 | 3300006353 | Bacteria | 844 |
| 177 | Ga0068871_100039359 | 3300006358 | Bacteria | 3783 |
| 178 | Ga0068871_100450437 | 3300006358 | Bacteria | 1153 |
| 179 | Ga0075431_101062825 | 3300006847 | Bacteria | 775 |
| 180 | Ga0068865_100012460 | 3300006881 | Bacteria | 5352 |
| 181 | Ga0068865_100345252 | 3300006881 | Bacteria | 1204 |
| 182 | Ga0068865_101001626 | 3300006881 | Bacteria | 732 |
| 183 | Ga0097620_100072714 | 3300006931 | Bacteria | 3475 |
| 184 | Ga0097620_101375069 | 3300006931 | Bacteria | 778 |
| 185 | Ga0105240_10511999 | 3300009093 | Bacteria | 1333 |
| 186 | Ga0111539_10307347 | 3300009094 | Bacteria | 1845 |
| 187 | Ga0105245_10019281 | 3300009098 | Bacteria | 5972 |
| 188 | Ga0105245_10142444 | 3300009098 | Bacteria | 2259 |
| 189 | Ga0105245_10262372 | 3300009098 | Bacteria | 1682 |
| 190 | Ga0105245_10528998 | 3300009098 | Bacteria | 1198 |
| 191 | Ga0105247_10000186 | 3300009101 | Bacteria | 60603 |
| 192 | Ga0105247_10022867 | 3300009101 | Bacteria | 3766 |
| 193 | Ga0105247_11283111 | 3300009101 | Bacteria | 587 |
| 194 | Ga0105243_10042425 | 3300009148 | Bacteria | 3561 |
| 195 | Ga0105243_10076509 | 3300009148 | Bacteria | 2719 |
| 196 | Ga0105243_10115903 | 3300009148 | Bacteria | 2250 |
| 197 | Ga0105243_10341808 | 3300009148 | Bacteria | 1371 |
| 198 | Ga0105243_10423136 | 3300009148 | Bacteria | 1243 |
| 199 | Ga0105243_10612929 | 3300009148 | Bacteria | 1049 |
| 200 | Ga0105243_11752511 | 3300009148 | Bacteria | 651 |
| 201 | Ga0105241_10161928 | 3300009174 | Bacteria | 1840 |
| 202 | Ga0105241_11160796 | 3300009174 | Bacteria | 730 |
| 203 | Ga0105242_10000731 | 3300009176 | Bacteria | 25618 |
| 204 | Ga0105242_11296302 | 3300009176 | Bacteria | 752 |
| 205 | Ga0105248_10004274 | 3300009177 | Bacteria | 15808 |
| 206 | Ga0105248_10047837 | 3300009177 | Bacteria | 4797 |
| 207 | Ga0105237_10011100 | 3300009545 | Bacteria | 9548 |
| 208 | Ga0105237_10178722 | 3300009545 | Bacteria | 2122 |
| 209 | Ga0105237_10953395 | 3300009545 | Bacteria | 865 |
| 210 | Ga0105238_10354713 | 3300009551 | Bacteria | 1456 |
| 211 | Ga0105238_10815157 | 3300009551 | Bacteria | 949 |
| 212 | Ga0105249_10016009 | 3300009553 | Bacteria | 6646 |
| 213 | Ga0105249_10107042 | 3300009553 | Bacteria | 2638 |
| 214 | Ga0105249_12674214 | 3300009553 | Bacteria | 571 |
| 215 | Ga0105028_109213 | 3300009993 | Bacteria | 1034 |
| 216 | Ga0105239_10112590 | 3300010375 | Bacteria | 3017 |
| 217 | Ga0105239_10115948 | 3300010375 | Bacteria | 2972 |
| 218 | Ga0105239_10150126 | 3300010375 | Bacteria | 2601 |
| 219 | Ga0105239_10305173 | 3300010375 | Bacteria | 1793 |
| 220 | Ga0105239_10963053 | 3300010375 | Bacteria | 980 |
| 221 | Ga0105246_10392896 | 3300011119 | Bacteria | 1150 |
| 222 | Ga0105246_11160707 | 3300011119 | Bacteria | 709 |
| 223 | Ga0157371_10240060 | 3300013102 | Bacteria | 1303 |
| 224 | Ga0157371_10497114 | 3300013102 | Bacteria | 900 |
| 225 | Ga0157370_10310101 | 3300013104 | Bacteria | 1456 |
| 226 | Ga0157369_10128133 | 3300013105 | Bacteria | 2690 |
| 227 | Ga0157369_10200934 | 3300013105 | Bacteria | 2092 |
| 228 | Ga0157374_10057709 | 3300013296 | Bacteria | 3626 |
| 229 | Ga0157374_10074957 | 3300013296 | Bacteria | 3197 |
| 230 | Ga0157374_10336331 | 3300013296 | Bacteria | 1498 |
| 231 | Ga0157378_10019603 | 3300013297 | Bacteria | 5945 |
| 232 | Ga0157378_10261854 | 3300013297 | Bacteria | 1660 |
| 233 | Ga0163162_10015890 | 3300013306 | Bacteria | 7356 |
| 234 | Ga0163162_10151583 | 3300013306 | Bacteria | 2436 |
| 235 | Ga0157372_10421476 | 3300013307 | Bacteria | 1556 |
| 236 | Ga0157372_11505648 | 3300013307 | Bacteria | 775 |
| 237 | Ga0157375_10027086 | 3300013308 | Bacteria | 5354 |
| 238 | Ga0157375_10180507 | 3300013308 | Bacteria | 2262 |
| 239 | Ga0157375_10280643 | 3300013308 | Bacteria | 1829 |
| 240 | Ga0157375_10489831 | 3300013308 | Bacteria | 1394 |
| 241 | Ga0157375_11301788 | 3300013308 | Bacteria | 854 |
| 242 | Ga0157375_13599876 | 3300013308 | Bacteria | 515 |
| 243 | Ga0163163_10283008 | 3300014325 | Bacteria | 1710 |
| 244 | Ga0163163_10986068 | 3300014325 | Bacteria | 906 |
| 245 | Ga0157380_10002376 | 3300014326 | Bacteria | 12644 |
| 246 | Ga0157380_10446030 | 3300014326 | Bacteria | 1241 |
| 247 | Ga0157380_11692201 | 3300014326 | Bacteria | 690 |
| 248 | Ga0182008_10119269 | 3300014497 | Bacteria | 1310 |
| 249 | Ga0157377_10266987 | 3300014745 | Bacteria | 1116 |
| 250 | Ga0157377_10566145 | 3300014745 | Bacteria | 805 |
| 251 | Ga0157377_10960479 | 3300014745 | Bacteria | 644 |
| 252 | Ga0157379_10000419 | 3300014968 | Bacteria | 34325 |
| 253 | Ga0157379_10254416 | 3300014968 | Bacteria | 1595 |
| 254 | Ga0157376_10130616 | 3300014969 | Bacteria | 2241 |
| 255 | Ga0157376_10165081 | 3300014969 | Bacteria | 2011 |
| 256 | Ga0163161_10001582 | 3300017792 | Bacteria | 16779 |
| 257 | Ga0163161_10160882 | 3300017792 | Bacteria | 1712 |
| 258 | Ga0163161_10298168 | 3300017792 | Bacteria | 1269 |
| 259 | Ga0206354_11658198 | 3300020081 | Bacteria | 508 |
| 260 | Ga0209051_1139547 | 3300025303 | Bacteria | 585 |
| 261 | Ga0207656_10312248 | 3300025321 | Bacteria | 780 |
| 262 | Ga0207692_10003683 | 3300025898 | Bacteria | 6008 |
| 263 | Ga0207642_10000332 | 3300025899 | Bacteria | 14184 |
| 264 | Ga0207642_10255211 | 3300025899 | Bacteria | 997 |
| 265 | Ga0207710_10006318 | 3300025900 | Bacteria | 5067 |
| 266 | Ga0207710_10321888 | 3300025900 | Bacteria | 784 |
| 267 | Ga0207688_10004409 | 3300025901 | Bacteria | 7658 |
| 268 | Ga0207688_10033488 | 3300025901 | Bacteria | 2843 |
| 269 | Ga0207688_10066672 | 3300025901 | Bacteria | 2036 |
| 270 | Ga0207688_10186490 | 3300025901 | Bacteria | 1239 |
| 271 | Ga0207680_10123326 | 3300025903 | Bacteria | 1697 |
| 272 | Ga0207685_10001049 | 3300025905 | Bacteria | 5426 |
| 273 | Ga0207645_10046073 | 3300025907 | Bacteria | 2786 |
| 274 | Ga0207643_10015756 | 3300025908 | Bacteria | 4117 |
| 275 | Ga0207705_10580038 | 3300025909 | Bacteria | 872 |
| 276 | Ga0207705_10761541 | 3300025909 | Bacteria | 752 |
| 277 | Ga0207654_10763276 | 3300025911 | Bacteria | 697 |
| 278 | Ga0207707_10597003 | 3300025912 | Bacteria | 935 |
| 279 | Ga0207695_10622179 | 3300025913 | Bacteria | 961 |
| 280 | Ga0207671_10032443 | 3300025914 | Bacteria | 3888 |
| 281 | Ga0207671_10077323 | 3300025914 | Bacteria | 2491 |
| 282 | Ga0207671_10415195 | 3300025914 | Bacteria | 1071 |
| 283 | Ga0207693_10000172 | 3300025915 | Bacteria | 58877 |
| 284 | Ga0207693_10235235 | 3300025915 | Bacteria | 1439 |
| 285 | Ga0207663_10001208 | 3300025916 | Bacteria | 11932 |
| 286 | Ga0207663_11168287 | 3300025916 | Bacteria | 619 |
| 287 | Ga0207660_10182840 | 3300025917 | Bacteria | 1629 |
| 288 | Ga0207662_10155727 | 3300025918 | Bacteria | 1456 |
| 289 | Ga0207657_10076906 | 3300025919 | Bacteria | 2815 |
| 290 | Ga0207657_10184341 | 3300025919 | Bacteria | 1686 |
| 291 | Ga0207657_10399323 | 3300025919 | Bacteria | 1081 |
| 292 | Ga0207657_10518229 | 3300025919 | Bacteria | 933 |
| 293 | Ga0207649_10735390 | 3300025920 | Bacteria | 767 |
| 294 | Ga0207652_10356240 | 3300025921 | Bacteria | 1321 |
| 295 | Ga0207652_10376906 | 3300025921 | Bacteria | 1281 |
| 296 | Ga0207652_10743014 | 3300025921 | Bacteria | 873 |
| 297 | Ga0207681_10014848 | 3300025923 | Bacteria | 4850 |
| 298 | Ga0207694_10275939 | 3300025924 | Bacteria | 1380 |
| 299 | Ga0207694_10905040 | 3300025924 | Bacteria | 746 |
| 300 | Ga0207650_10137217 | 3300025925 | Bacteria | 1920 |
| 301 | Ga0207659_11341581 | 3300025926 | Bacteria | 614 |
| 302 | Ga0207687_10004141 | 3300025927 | Bacteria | 9717 |
| 303 | Ga0207687_10030832 | 3300025927 | Bacteria | 3619 |
| 304 | Ga0207687_10245951 | 3300025927 | Bacteria | 1420 |
| 305 | Ga0207687_11194169 | 3300025927 | Bacteria | 654 |
| 306 | Ga0207664_10272145 | 3300025929 | Bacteria | 1484 |
| 307 | Ga0207664_10381193 | 3300025929 | Bacteria | 1252 |
| 308 | Ga0207664_10876566 | 3300025929 | Bacteria | 806 |
| 309 | Ga0207644_10052303 | 3300025931 | Bacteria | 2935 |
| 310 | Ga0207644_10245025 | 3300025931 | Bacteria | 1428 |
| 311 | Ga0207690_10049980 | 3300025932 | Bacteria | 2789 |
| 312 | Ga0207690_10227839 | 3300025932 | Bacteria | 1429 |
| 313 | Ga0207690_11635698 | 3300025932 | Bacteria | 538 |
| 314 | Ga0207706_10054685 | 3300025933 | Bacteria | 3522 |
| 315 | Ga0207706_10100218 | 3300025933 | Bacteria | 2548 |
| 316 | Ga0207706_11112174 | 3300025933 | Bacteria | 660 |
| 317 | Ga0207686_10058000 | 3300025934 | Bacteria | 2439 |
| 318 | Ga0207709_10003310 | 3300025935 | Bacteria | 9654 |
| 319 | Ga0207709_10025984 | 3300025935 | Bacteria | 3359 |
| 320 | Ga0207709_10110554 | 3300025935 | Bacteria | 1836 |
| 321 | Ga0207709_10317073 | 3300025935 | Bacteria | 1165 |
| 322 | Ga0207709_11062432 | 3300025935 | Bacteria | 664 |
| 323 | Ga0207670_10469425 | 3300025936 | Bacteria | 1017 |
| 324 | Ga0207669_10000124 | 3300025937 | Bacteria | 38397 |
| 325 | Ga0207669_10145933 | 3300025937 | Bacteria | 1650 |
| 326 | Ga0207704_10004389 | 3300025938 | Bacteria | 6453 |
| 327 | Ga0207704_10225033 | 3300025938 | Bacteria | 1391 |
| 328 | Ga0207704_10234468 | 3300025938 | Bacteria | 1367 |
| 329 | Ga0207665_10026800 | 3300025939 | Bacteria | 3806 |
| 330 | Ga0207665_10088162 | 3300025939 | Bacteria | 2146 |
| 331 | Ga0207691_10085377 | 3300025940 | Bacteria | 2833 |
| 332 | Ga0207691_10120971 | 3300025940 | Bacteria | 2320 |
| 333 | Ga0207711_10173891 | 3300025941 | Bacteria | 1955 |
| 334 | Ga0207689_10024871 | 3300025942 | Bacteria | 5020 |
| 335 | Ga0207689_10290241 | 3300025942 | Bacteria | 1355 |
| 336 | Ga0207689_10464069 | 3300025942 | Bacteria | 1059 |
| 337 | Ga0207679_10076351 | 3300025945 | Bacteria | 2545 |
| 338 | Ga0207667_10065657 | 3300025949 | Bacteria | 3784 |
| 339 | Ga0207667_11559511 | 3300025949 | Bacteria | 630 |
| 340 | Ga0207651_10141206 | 3300025960 | Bacteria | 1861 |
| 341 | Ga0207712_10030188 | 3300025961 | Bacteria | 3642 |
| 342 | Ga0207712_10075694 | 3300025961 | Bacteria | 2434 |
| 343 | Ga0207668_10001759 | 3300025972 | Bacteria | 12659 |
| 344 | Ga0207668_10002901 | 3300025972 | Bacteria | 10061 |
| 345 | Ga0207668_10240598 | 3300025972 | Bacteria | 1464 |
| 346 | Ga0207668_10279205 | 3300025972 | Bacteria | 1369 |
| 347 | Ga0207668_10346901 | 3300025972 | Bacteria | 1240 |
| 348 | Ga0207640_10001238 | 3300025981 | Bacteria | 13910 |
| 349 | Ga0207658_10004718 | 3300025986 | Bacteria | 9440 |
| 350 | Ga0207658_10558132 | 3300025986 | Bacteria | 1025 |
| 351 | Ga0207658_11085558 | 3300025986 | Bacteria | 731 |
| 352 | Ga0207658_11623964 | 3300025986 | Bacteria | 591 |
| 353 | Ga0207677_10129767 | 3300026023 | Bacteria | 1911 |
| 354 | Ga0207677_10740620 | 3300026023 | Bacteria | 875 |
| 355 | Ga0207677_11022953 | 3300026023 | Bacteria | 750 |
| 356 | Ga0207703_10016310 | 3300026035 | Bacteria | 5791 |
| 357 | Ga0207703_10069667 | 3300026035 | Bacteria | 2901 |
| 358 | Ga0207703_10275600 | 3300026035 | Bacteria | 1526 |
| 359 | Ga0207703_10321258 | 3300026035 | Bacteria | 1418 |
| 360 | Ga0207703_11006815 | 3300026035 | Bacteria | 799 |
| 361 | Ga0207639_10023258 | 3300026041 | Bacteria | 4474 |
| 362 | Ga0207639_10109132 | 3300026041 | Bacteria | 2251 |
| 363 | Ga0207639_11204497 | 3300026041 | Bacteria | 711 |
| 364 | Ga0207639_11597208 | 3300026041 | Bacteria | 612 |
| 365 | Ga0207678_10007789 | 3300026067 | Bacteria | 9463 |
| 366 | Ga0207678_10055806 | 3300026067 | Bacteria | 3402 |
| 367 | Ga0207678_10491006 | 3300026067 | Bacteria | 1070 |
| 368 | Ga0207678_10749006 | 3300026067 | Bacteria | 861 |
| 369 | Ga0207708_10002732 | 3300026075 | Bacteria | 12963 |
| 370 | Ga0207708_10053197 | 3300026075 | Bacteria | 3084 |
| 371 | Ga0207708_10701128 | 3300026075 | Bacteria | 865 |
| 372 | Ga0207702_10258063 | 3300026078 | Bacteria | 1640 |
| 373 | Ga0207702_10386889 | 3300026078 | Bacteria | 1346 |
| 374 | Ga0207702_10418823 | 3300026078 | Bacteria | 1295 |
| 375 | Ga0207702_11090575 | 3300026078 | Bacteria | 792 |
| 376 | Ga0207641_10293487 | 3300026088 | Bacteria | 1533 |
| 377 | Ga0207641_10812994 | 3300026088 | Bacteria | 925 |
| 378 | Ga0207648_10044350 | 3300026089 | Bacteria | 3901 |
| 379 | Ga0207648_10049169 | 3300026089 | Bacteria | 3691 |
| 380 | Ga0207648_12167460 | 3300026089 | Bacteria | 516 |
| 381 | Ga0207676_10705026 | 3300026095 | Bacteria | 978 |
| 382 | Ga0207676_11097869 | 3300026095 | Bacteria | 786 |
| 383 | Ga0207674_10165726 | 3300026116 | Bacteria | 2164 |
| 384 | Ga0207675_100000554 | 3300026118 | Bacteria | 36519 |
| 385 | Ga0207675_100039045 | 3300026118 | Bacteria | 4431 |
| 386 | Ga0207675_100102772 | 3300026118 | Bacteria | 2693 |
| 387 | Ga0207683_10000486 | 3300026121 | Bacteria | 36689 |
| 388 | Ga0207683_10098306 | 3300026121 | Bacteria | 2611 |
| 389 | Ga0207683_10289515 | 3300026121 | Bacteria | 1498 |
| 390 | Ga0207683_10423081 | 3300026121 | Bacteria | 1227 |
| 391 | Ga0207683_11009015 | 3300026121 | Bacteria | 772 |
| 392 | Ga0207698_10226873 | 3300026142 | Bacteria | 1692 |
| 393 | Ga0207698_10424008 | 3300026142 | Bacteria | 1277 |
| 394 | Ga0268266_10107036 | 3300028379 | Bacteria | 2472 |
| 395 | Ga0268266_10149568 | 3300028379 | Bacteria | 2103 |
| 396 | Ga0268266_10765909 | 3300028379 | Bacteria | 932 |
| 397 | Ga0268266_11277518 | 3300028379 | Bacteria | 709 |
| 398 | Ga0268265_10007213 | 3300028380 | Bacteria | 7511 |
| 399 | Ga0268265_10085812 | 3300028380 | Bacteria | 2500 |
| 400 | Ga0268265_10395609 | 3300028380 | Bacteria | 1276 |
| 401 | Ga0268265_10607910 | 3300028380 | Bacteria | 1046 |
| 402 | Ga0268264_10006786 | 3300028381 | Bacteria | 9617 |
| 403 | Ga0268264_10792574 | 3300028381 | Bacteria | 946 |
| 404 | Ga0268264_11014747 | 3300028381 | Bacteria | 837 |
| 405 | Ga0307511_10196288 | 3300030521 | Bacteria | 1057 |
| 406 | Ga0307513_10018498 | 3300031456 | Bacteria | 8322 |
| 407 | Ga0307416_101743536 | 3300032002 | Bacteria | 727 |
| 408 | Ga0373948_0077707 | 3300034817 | Bacteria | 753 |
| 409 | Ga0373949_0015882 | 3300035090 | Bacteria | 1685 |
| 410 | Ga0373951_0167916 | 3300035091 | Bacteria | 624 |
| 411 | Ga0373941_0206154 | 3300035115 | Bacteria | 750 |
| 412 | Ga0373960_0047966 | 3300035121 | Bacteria | 1258 |
| 413 | Ga0373942_0235218 | 3300035207 | Bacteria | 618 |
| 414 | Ga0373962_0225014 | 3300035242 | Bacteria | 643 |
| 415 | Ga0316574_0282958 | 3300035398 | Bacteria | 1056 |
| 416 | Ga0316574_0319711 | 3300035398 | Bacteria | 985 |
| 417 | Ga0373931_0076920 | 3300035691 | Bacteria | 1834 |
| 418 | Ga0316582_0248477 | 3300036647 | Bacteria | 1219 |
| 419 | Ga0316584_0507621 | 3300036712 | Bacteria | 846 |
| 420 | Ga0316584_0736675 | 3300036712 | Bacteria | 673 |
| 421 | Ga0436365_0011767 | 3300039437 | Bacteria | 7798 |
| 422 | Ga0436363_0933205 | 3300039450 | Bacteria | 847 |
| 423 | Ga0439461_0004147 | 3300041410 | Bacteria | 2409 |
| 424 | Ga0439466_0001778 | 3300041411 | Bacteria | 8426 |
| 425 | Ga0451833_1272580 | 3300041491 | Bacteria | 673 |
| 426 | Ga0451837_0069700 | 3300041494 | Bacteria | 938 |
| 427 | Ga0439442_019360 | 3300042002 | Bacteria | 1408 |
| 428 | Ga0439445_0013984 | 3300042004 | Bacteria | 1949 |
| 429 | Ga0439457_106053 | 3300042014 | Bacteria | 657 |
| 430 | Ga0439459_0020402 | 3300042438 | Bacteria | 1264 |
| 431 | Ga0466972_0004922 | 3300044658 | Bacteria | 6704 |
| 432 | Ga0466965_0024314 | 3300044683 | Bacteria | 2929 |
| 433 | Ga0466965_0114769 | 3300044683 | Bacteria | 1387 |
| 434 | Ga0466966_0008355 | 3300044684 | Bacteria | 6857 |
| 435 | Ga0466961_0984763 | 3300044693 | Bacteria | 501 |
| 436 | Ga0466963_0345388 | 3300044694 | Bacteria | 1048 |
| 437 | Ga0466964_0043724 | 3300044706 | Bacteria | 1818 |
| 438 | Ga0466964_0384833 | 3300044706 | Bacteria | 729 |
| 439 | Ga0466971_0049913 | 3300044719 | Bacteria | 1883 |
| 440 | Ga0466968_0002213 | 3300044735 | Bacteria | 7099 |
| 441 | Ga0466968_0004456 | 3300044735 | Bacteria | 5239 |
| 442 | Ga0466970_0024731 | 3300044765 | Bacteria | 3141 |
| 443 | Ga0466970_0082957 | 3300044765 | Bacteria | 1734 |
| 444 | Ga0466957_0016121 | 3300044842 | Bacteria | 4367 |
| 445 | Ga0466957_0253836 | 3300044842 | Bacteria | 1170 |
| 446 | Ga0466957_0341809 | 3300044842 | Bacteria | 1014 |
| 447 | Ga0466957_0436408 | 3300044842 | Bacteria | 900 |
| 448 | Ga0466960_0002339 | 3300044901 | Bacteria | 7124 |
| 449 | Ga0466960_0066696 | 3300044901 | Bacteria | 1780 |
| 450 | Ga0466959_0034186 | 3300045049 | Bacteria | 3761 |
| 451 | Ga0466959_0367025 | 3300045049 | Bacteria | 980 |
| 452 | Ga0466958_0115274 | 3300045836 | Bacteria | 1679 |
| 453 | Ga0466958_0264408 | 3300045836 | Bacteria | 1101 |
| 454 | Ga0466967_0013771 | 3300045976 | Bacteria | 6268 |
| 455 | Ga0466967_0019262 | 3300045976 | Bacteria | 5483 |
| 456 | Ga0466967_0030816 | 3300045976 | Bacteria | 4505 |
| 457 | Ga0466967_0040907 | 3300045976 | Bacteria | 3993 |
| 458 | Ga0466967_0114830 | 3300045976 | Bacteria | 2479 |
| 459 | Ga0466967_2136082 | 3300045976 | Bacteria | 556 |
| 460 | Ga0495603_0675906 | 3300046455 | Bacteria | 591 |
| 461 | Ga0495603_0863081 | 3300046455 | Bacteria | 515 |
| 462 | Ga0495650_0042092 | 3300046471 | Bacteria | 1948 |
| 463 | Ga0495583_0009710 | 3300046506 | Bacteria | 5716 |
| 464 | Ga0495606_0064739 | 3300046507 | Bacteria | 2325 |
| 465 | Ga0495648_0004576 | 3300046524 | Bacteria | 11781 |
| 466 | Ga0495654_0124018 | 3300046530 | Bacteria | 1166 |
| 467 | Ga0495668_0007547 | 3300046616 | Bacteria | 6939 |
| 468 | Ga0495668_0017605 | 3300046616 | Bacteria | 4141 |
| 469 | Ga0495611_0350617 | 3300046648 | Bacteria | 677 |
| 470 | Ga0495588_0059007 | 3300046674 | Bacteria | 1984 |
| 471 | Ga0495671_0148330 | 3300046692 | Bacteria | 1142 |
| 472 | Ga0495671_0467865 | 3300046692 | Bacteria | 602 |
| 473 | Ga0495649_0420926 | 3300046694 | Bacteria | 669 |
| 474 | Ga0495581_0033746 | 3300047315 | Bacteria | 2962 |
| 475 | Ga0495672_0004629 | 3300047320 | Bacteria | 11167 |
| 476 | Ga0495673_0001554 | 3300047469 | Bacteria | 17987 |
| 477 | Ga0495686_0430597 | 3300047472 | Bacteria | 704 |
| 478 | Ga0496100_0002220 | 3300048903 | Bacteria | 9806 |
| 479 | Ga0496100_0003746 | 3300048903 | Bacteria | 7959 |
| 480 | Ga0496100_0023748 | 3300048903 | Bacteria | 3730 |
| 481 | Ga0496100_0136503 | 3300048903 | Bacteria | 1733 |
| 482 | Ga0496101_0000115 | 3300048904 | Bacteria | 79334 |
| 483 | Ga0496101_0002076 | 3300048904 | Bacteria | 12201 |
| 484 | Ga0496101_0013674 | 3300048904 | Bacteria | 5444 |
| 485 | Ga0496101_0135681 | 3300048904 | Bacteria | 1872 |
| 486 | Ga0496101_0372075 | 3300048904 | Bacteria | 1124 |
| 487 | Ga0496101_0583405 | 3300048904 | Bacteria | 884 |
| 488 | Ga0496102_0000009 | 3300048905 | Bacteria | 344149 |
| 489 | Ga0496102_0161621 | 3300048905 | Bacteria | 2107 |
| 490 | Ga0496102_0163592 | 3300048905 | Bacteria | 2093 |
| 491 | Ga0496102_0263926 | 3300048905 | Bacteria | 1623 |
| 492 | Ga0496102_1039609 | 3300048905 | Bacteria | 739 |
| 493 | Ga0496103_0000051 | 3300048906 | Bacteria | 150397 |
| 494 | Ga0496103_0000694 | 3300048906 | Bacteria | 25093 |
| 495 | Ga0496104_0156146 | 3300048907 | Bacteria | 2189 |
| 496 | Ga0496104_0161538 | 3300048907 | Bacteria | 2149 |
| 497 | Ga0496104_0209137 | 3300048907 | Bacteria | 1863 |
| 498 | Ga0496104_0803690 | 3300048907 | Bacteria | 847 |
| 499 | Ga0496105_0043866 | 3300048908 | Bacteria | 3688 |
| 500 | Ga0496105_0317182 | 3300048908 | Bacteria | 1250 |
| 501 | Ga0496105_1047657 | 3300048908 | Bacteria | 608 |
| 502 | Ga0496105_1208028 | 3300048908 | Bacteria | 556 |
| 503 | Ga0496105_1416987 | 3300048908 | Bacteria | 503 |
| 504 | Ga0496106_0007463 | 3300048909 | Bacteria | 8081 |
| 505 | Ga0496106_0030201 | 3300048909 | Bacteria | 4040 |
| 506 | Ga0496106_0370685 | 3300048909 | Bacteria | 1150 |
| 507 | Ga0496106_1014592 | 3300048909 | Bacteria | 652 |
| 508 | Ga0496107_0002211 | 3300048910 | Bacteria | 12504 |
| 509 | Ga0496107_0005423 | 3300048910 | Bacteria | 8731 |
| 510 | Ga0496107_0129246 | 3300048910 | Bacteria | 1864 |
| 511 | Ga0496107_0522096 | 3300048910 | Bacteria | 880 |
| 512 | Ga0496108_0011728 | 3300048911 | Bacteria | 7128 |
| 513 | Ga0496108_0063412 | 3300048911 | Bacteria | 3112 |
| 514 | Ga0496108_0174488 | 3300048911 | Bacteria | 1860 |
| 515 | Ga0496108_0312947 | 3300048911 | Bacteria | 1368 |
| 516 | Ga0496108_0482030 | 3300048911 | Bacteria | 1083 |
| 517 | Ga0496108_0595288 | 3300048911 | Bacteria | 964 |
| 518 | Ga0496109_0013155 | 3300048912 | Bacteria | 7161 |
| 519 | Ga0496109_0048342 | 3300048912 | Bacteria | 3871 |
| 520 | Ga0496109_0119090 | 3300048912 | Bacteria | 2458 |
| 521 | Ga0496109_0878304 | 3300048912 | Bacteria | 834 |
| 522 | Ga0496109_1663013 | 3300048912 | Bacteria | 572 |
| 523 | Ga0496110_0042561 | 3300048913 | Bacteria | 3964 |
| 524 | Ga0496110_0310543 | 3300048913 | Bacteria | 1436 |
| 525 | Ga0496110_0496499 | 3300048913 | Bacteria | 1111 |
| 526 | Ga0496110_1240730 | 3300048913 | Bacteria | 654 |
| 527 | Ga0496111_0041398 | 3300048914 | Bacteria | 3306 |
| 528 | Ga0496111_0069410 | 3300048914 | Bacteria | 2563 |
| 529 | Ga0496111_0428171 | 3300048914 | Bacteria | 977 |
| 530 | Ga0496111_0921758 | 3300048914 | Bacteria | 628 |
| 531 | Ga0496112_0029795 | 3300048915 | Bacteria | 5280 |
| 532 | Ga0496112_0740246 | 3300048915 | Bacteria | 910 |
| 533 | Ga0496113_0177215 | 3300048916 | Bacteria | 1689 |
| 534 | Ga0496113_0773204 | 3300048916 | Bacteria | 764 |
| 535 | Ga0496114_0000470 | 3300048917 | Bacteria | 29501 |
| 536 | Ga0496114_0001282 | 3300048917 | Bacteria | 18984 |
| 537 | Ga0496114_0153368 | 3300048917 | Bacteria | 1999 |
| 538 | Ga0496114_0185915 | 3300048917 | Bacteria | 1816 |
| 539 | Ga0496114_0575829 | 3300048917 | Bacteria | 994 |
| 540 | Ga0496114_0890975 | 3300048917 | Bacteria | 771 |
| 541 | Ga0496114_0969792 | 3300048917 | Bacteria | 733 |
| 542 | Ga0496115_0005314 | 3300048918 | Bacteria | 9365 |
| 543 | Ga0496116_0000141 | 3300048919 | Bacteria | 150405 |
| 544 | Ga0496117_0000019 | 3300048920 | Bacteria | 469256 |
| 545 | Ga0496118_0000020 | 3300048921 | Bacteria | 470521 |
| 546 | Ga0496119_0001032 | 3300048922 | Bacteria | 35641 |
| 547 | Ga0496120_0002480 | 3300048923 | Bacteria | 18572 |
| 548 | Ga0496121_0000510 | 3300048924 | Bacteria | 74197 |
| 549 | Ga0496125_0164138 | 3300048928 | Bacteria | 1504 |
| 550 | Ga0496125_0370668 | 3300048928 | Bacteria | 847 |
| 551 | Ga0496126_0001641 | 3300048929 | Bacteria | 33823 |
| 552 | Ga0496126_0055657 | 3300048929 | Bacteria | 3578 |
| 553 | Ga0496126_0268113 | 3300048929 | Bacteria | 1417 |
| 554 | Ga0501032_0006575 | 3300049569 | Bacteria | 8535 |
| 555 | Ga0501033_0111628 | 3300049570 | Bacteria | 1989 |
| 556 | Ga0501034_0004273 | 3300049571 | Bacteria | 15940 |
| 557 | Ga0501036_0016856 | 3300049572 | Bacteria | 6103 |
| 558 | Ga0501037_0002477 | 3300049573 | Bacteria | 13336 |
| 559 | Ga0501043_0002246 | 3300049579 | Bacteria | 16438 |
| 560 | Ga0501043_0110085 | 3300049579 | Bacteria | 2163 |
| 561 | Ga0501047_0014204 | 3300049581 | Bacteria | 7568 |
| 562 | Ga0501048_0001569 | 3300049582 | Bacteria | 17372 |
| 563 | Ga0501070_0001570 | 3300049586 | Bacteria | 20304 |
| 564 | Ga0501073_0176539 | 3300049589 | Bacteria | 1478 |
| 565 | Ga0501080_0196997 | 3300049742 | Bacteria | 1850 |
| 566 | Ga0501035_0021057 | 3300049822 | Bacteria | 5994 |
| 567 | Ga0501044_0004782 | 3300049823 | Bacteria | 15149 |
| 568 | Ga0501044_0013430 | 3300049823 | Bacteria | 8856 |
| 569 | nmdc:mga03683_364764_c1 | 3300050489 | Bacteria | 685 |
| 570 | nmdc:mga03n38_11224_c1 | 3300050490 | Bacteria | 3329 |
| 571 | nmdc:mga03n38_48064_c1 | 3300050490 | Bacteria | 1891 |
| 572 | nmdc:mga03n38_77273_c1 | 3300050490 | Bacteria | 1555 |
| 573 | nmdc:mga00v17_190852_c1 | 3300050491 | Bacteria | 1323 |
| 574 | nmdc:mga00v17_460184_c1 | 3300050491 | Bacteria | 826 |
| 575 | nmdc:mga00v17_53005_c1 | 3300050491 | Bacteria | 2471 |
| 576 | nmdc:mga00v17_61672_c1 | 3300050491 | Bacteria | 2305 |
| 577 | nmdc:mga0yw44_695815_c1 | 3300050492 | Bacteria | 690 |
| 578 | nmdc:mga0yw44_701714_c1 | 3300050492 | Bacteria | 687 |
| 579 | nmdc:mga0yw44_889122_c1 | 3300050492 | Bacteria | 604 |
| 580 | nmdc:mga07m45_123740_c1 | 3300050496 | Bacteria | 1495 |
| 581 | nmdc:mga07m45_260086_c1 | 3300050496 | Bacteria | 1010 |
| 582 | nmdc:mga07m45_283097_c1 | 3300050496 | Bacteria | 964 |
| 583 | nmdc:mga07m45_44871_c2 | 3300050496 | Bacteria | 1027 |
| 584 | nmdc:mga07m45_457590_c1 | 3300050496 | Bacteria | 740 |
| 585 | nmdc:mga0sz30_108042_c1 | 3300050516 | Bacteria | 1218 |
| 586 | nmdc:mga0sz30_175055_c1 | 3300050516 | Bacteria | 951 |
| 587 | Ga0500635_0039739 | 3300053080 | Bacteria | 1567 |
| 588 | Ga0495655_0160238 | 3300053083 | Bacteria | 713 |
| 589 | Ga0500643_007330 | 3300053087 | Bacteria | 4471 |
| 590 | Ga0500628_043986 | 3300053129 | Bacteria | 1032 |
| 591 | Ga0500658_0103913 | 3300053134 | Bacteria | 1243 |
| 592 | Ga0500568_0114134 | 3300053139 | Bacteria | 1009 |
| 593 | Ga0500616_0008769 | 3300053153 | Bacteria | 6228 |
| 594 | Ga0500616_0031789 | 3300053153 | Bacteria | 2889 |
| 595 | Ga0500619_218284 | 3300053154 | Bacteria | 636 |
| 596 | Ga0500627_0313827 | 3300053158 | Bacteria | 682 |
| 597 | Ga0500645_000163 | 3300053730 | Bacteria | 51808 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300006178 | Ga0075367_10434599 | Ga0075367_104345992 | 129 |
| 2 | 3300006028 | Ga0070717_11068368 | Ga0070717_110683682 | 130 |
| 3 | 3300005345 | Ga0070692_10557888 | Ga0070692_105578882 | 131 |
| 4 | iso_pu_bacteria | 2643221715 | 2644639058 | 131 |
| 5 | iso_pu_bacteria | 2852635781 | 2852639879 | 132 |
| 6 | iso_pu_bacteria | 2912723979 | 2912724177 | 132 |
| 7 | 3300005535 | Ga0070684_100759175 | Ga0070684_1007591751 | 133 |
| 8 | 3300013104 | Ga0157370_10310101 | Ga0157370_103101012 | 133 |
| 9 | 3300020081 | Ga0206354_11658198 | Ga0206354_116581981 | 133 |
| 10 | 3300025321 | Ga0207656_10312248 | Ga0207656_103122481 | 133 |
| 11 | 3300035398 | Ga0316574_0319711 | Ga0316574_0319711_264_668 | 133 |
| 12 | 3300036712 | Ga0316584_0736675 | Ga0316584_0736675_237_641 | 133 |
| 13 | 3300042014 | Ga0439457_106053 | Ga0439457_106053_229_633 | 133 |
| 14 | 3300048908 | Ga0496105_1208028 | Ga0496105_1208028_58_462 | 133 |
| 15 | 3300048911 | Ga0496108_0063412 | Ga0496108_0063412_131_535 | 133 |
| 16 | 3300048912 | Ga0496109_0119090 | Ga0496109_0119090_1827_2231 | 133 |
| 17 | 3300048914 | Ga0496111_0041398 | Ga0496111_0041398_805_1209 | 133 |
| 18 | iso_pu_bacteria | 2816332139 | 2816506113 | 133 |
| 19 | iso_pu_bacteria | 3006486233 | 3006492221 | 133 |
| 20 | 3300005329 | Ga0070683_100254556 | Ga0070683_1002545562 | 134 |
| 21 | 3300005334 | Ga0068869_100258751 | Ga0068869_1002587512 | 134 |
| 22 | 3300005337 | Ga0070682_100195266 | Ga0070682_1001952662 | 134 |
| 23 | 3300005341 | Ga0070691_10236000 | Ga0070691_102360002 | 134 |
| 24 | 3300005355 | Ga0070671_100158444 | Ga0070671_1001584441 | 134 |
| 25 | 3300005441 | Ga0070700_100041790 | Ga0070700_1000417903 | 134 |
| 26 | 3300005441 | Ga0070700_100417693 | Ga0070700_1004176931 | 134 |
| 27 | 3300005459 | Ga0068867_101780083 | Ga0068867_1017800831 | 134 |
| 28 | 3300005535 | Ga0070684_100274728 | Ga0070684_1002747282 | 134 |
| 29 | 3300006881 | Ga0068865_100345252 | Ga0068865_1003452522 | 134 |
| 30 | 3300009148 | Ga0105243_10115903 | Ga0105243_101159032 | 134 |
| 31 | 3300014326 | Ga0157380_11692201 | Ga0157380_116922012 | 134 |
| 32 | 3300025912 | Ga0207707_10597003 | Ga0207707_105970032 | 134 |
| 33 | 3300025935 | Ga0207709_10110554 | Ga0207709_101105542 | 134 |
| 34 | 3300025942 | Ga0207689_10464069 | Ga0207689_104640692 | 134 |
| 35 | 3300026075 | Ga0207708_10701128 | Ga0207708_107011282 | 134 |
| 36 | 3300026089 | Ga0207648_12167460 | Ga0207648_121674601 | 134 |
| 37 | 3300044694 | Ga0466963_0345388 | Ga0466963_0345388_245_649 | 134 |
| 38 | 3300044842 | Ga0466957_0253836 | Ga0466957_0253836_109_513 | 134 |
| 39 | 3300045976 | Ga0466967_0019262 | Ga0466967_0019262_882_1286 | 134 |
| 40 | 3300048929 | Ga0496126_0055657 | Ga0496126_0055657_110_526 | 134 |
| 41 | iso_pu_bacteria | 2565956761 | 2566991719 | 134 |
| 42 | iso_pu_bacteria | 2751185725 | 2753038474 | 134 |
| 43 | iso_pu_bacteria | 2751185792 | 2753327061 | 134 |
| 44 | iso_pu_bacteria | 2889300758 | 2889305256 | 134 |
| 45 | iso_pu_bacteria | 2902792274 | 2902794319 | 134 |
| 46 | iso_pu_bacteria | 2902799365 | 2902802766 | 134 |
| 47 | iso_pu_bacteria | 2904535858 | 2904541226 | 134 |
| 48 | iso_pu_bacteria | 2904765812 | 2904767834 | 134 |
| 49 | iso_pu_bacteria | 2904770941 | 2904774390 | 134 |
| 50 | iso_pu_bacteria | 2908811453 | 2908813479 | 134 |
| 51 | iso_pu_bacteria | 2919420072 | 2919423737 | 134 |
| 52 | iso_pu_bacteria | 2919432681 | 2919436345 | 134 |
| 53 | iso_pu_bacteria | 2922554459 | 2922560871 | 134 |
| 54 | iso_pu_bacteria | 2928142448 | 2928143398 | 134 |
| 55 | iso_pu_bacteria | 2929212328 | 2929213030 | 134 |
| 56 | iso_pu_bacteria | 2932398195 | 2932401813 | 134 |
| 57 | iso_pu_bacteria | 2939582691 | 2939587193 | 134 |
| 58 | iso_pu_bacteria | 2956939328 | 2956942264 | 134 |
| 59 | iso_pu_bacteria | 2984523437 | 2984527538 | 134 |
| 60 | iso_pu_bacteria | 3001119090 | 3001122013 | 134 |
| 61 | 3300001991 | JGI24743J22301_10018902 | JGI24743J22301_100189022 | 135 |
| 62 | 3300002067 | JGI24735J21928_10106489 | JGI24735J21928_101064892 | 135 |
| 63 | 3300002070 | JGI24750J21931_1011933 | JGI24750J21931_10119332 | 135 |
| 64 | 3300002073 | JGI24745J21846_1014878 | JGI24745J21846_10148782 | 135 |
| 65 | 3300002075 | JGI24738J21930_10014628 | JGI24738J21930_100146283 | 135 |
| 66 | 3300002076 | JGI24749J21850_1001138 | JGI24749J21850_10011382 | 135 |
| 67 | 3300002077 | JGI24744J21845_10004535 | JGI24744J21845_100045352 | 135 |
| 68 | 3300002239 | JGI24034J26672_10007250 | JGI24034J26672_100072502 | 135 |
| 69 | 3300002244 | JGI24742J22300_10004587 | JGI24742J22300_100045872 | 135 |
| 70 | 3300005328 | Ga0070676_10003302 | Ga0070676_100033029 | 135 |
| 71 | 3300005333 | Ga0070677_10358996 | Ga0070677_103589961 | 135 |
| 72 | 3300005334 | Ga0068869_100006214 | Ga0068869_1000062147 | 135 |
| 73 | 3300005335 | Ga0070666_10107736 | Ga0070666_101077363 | 135 |
| 74 | 3300005336 | Ga0070680_100216831 | Ga0070680_1002168312 | 135 |
| 75 | 3300005337 | Ga0070682_100307199 | Ga0070682_1003071992 | 135 |
| 76 | 3300005338 | Ga0068868_100000598 | Ga0068868_1000005987 | 135 |
| 77 | 3300005341 | Ga0070691_10012130 | Ga0070691_100121302 | 135 |
| 78 | 3300005353 | Ga0070669_100006306 | Ga0070669_1000063068 | 135 |
| 79 | 3300005356 | Ga0070674_100001268 | Ga0070674_10000126813 | 135 |
| 80 | 3300005365 | Ga0070688_100013586 | Ga0070688_1000135864 | 135 |
| 81 | 3300005366 | Ga0070659_100033509 | Ga0070659_1000335094 | 135 |
| 82 | 3300005436 | Ga0070713_100572270 | Ga0070713_1005722702 | 135 |
| 83 | 3300005437 | Ga0070710_10002134 | Ga0070710_100021346 | 135 |
| 84 | 3300005438 | Ga0070701_10001535 | Ga0070701_100015354 | 135 |
| 85 | 3300005439 | Ga0070711_100000399 | Ga0070711_1000003993 | 135 |
| 86 | 3300005441 | Ga0070700_100023189 | Ga0070700_1000231893 | 135 |
| 87 | 3300005444 | Ga0070694_100071304 | Ga0070694_1000713043 | 135 |
| 88 | 3300005445 | Ga0070708_100308638 | Ga0070708_1003086382 | 135 |
| 89 | 3300005455 | Ga0070663_100000824 | Ga0070663_10000082415 | 135 |
| 90 | 3300005455 | Ga0070663_100866778 | Ga0070663_1008667782 | 135 |
| 91 | 3300005456 | Ga0070678_100009847 | Ga0070678_1000098472 | 135 |
| 92 | 3300005456 | Ga0070678_100438145 | Ga0070678_1004381452 | 135 |
| 93 | 3300005456 | Ga0070678_100645077 | Ga0070678_1006450772 | 135 |
| 94 | 3300005458 | Ga0070681_10526997 | Ga0070681_105269971 | 135 |
| 95 | 3300005459 | Ga0068867_100031064 | Ga0068867_1000310645 | 135 |
| 96 | 3300005466 | Ga0070685_10145206 | Ga0070685_101452062 | 135 |
| 97 | 3300005466 | Ga0070685_10572054 | Ga0070685_105720542 | 135 |
| 98 | 3300005539 | Ga0068853_100001822 | Ga0068853_10000182215 | 135 |
| 99 | 3300005543 | Ga0070672_100359812 | Ga0070672_1003598122 | 135 |
| 100 | 3300005544 | Ga0070686_100434292 | Ga0070686_1004342921 | 135 |
| 101 | 3300005546 | Ga0070696_100003604 | Ga0070696_1000036041 | 135 |
| 102 | 3300005547 | Ga0070693_100014542 | Ga0070693_1000145422 | 135 |
| 103 | 3300005548 | Ga0070665_100138784 | Ga0070665_1001387844 | 135 |
| 104 | 3300005549 | Ga0070704_100000142 | Ga0070704_10000014214 | 135 |
| 105 | 3300005563 | Ga0068855_100013561 | Ga0068855_10001356111 | 135 |
| 106 | 3300005578 | Ga0068854_100000132 | Ga0068854_10000013230 | 135 |
| 107 | 3300005614 | Ga0068856_100228963 | Ga0068856_1002289633 | 135 |
| 108 | 3300005615 | Ga0070702_100567380 | Ga0070702_1005673801 | 135 |
| 109 | 3300005617 | Ga0068859_100072721 | Ga0068859_1000727215 | 135 |
| 110 | 3300005618 | Ga0068864_100063256 | Ga0068864_1000632561 | 135 |
| 111 | 3300005618 | Ga0068864_100861423 | Ga0068864_1008614232 | 135 |
| 112 | 3300005718 | Ga0068866_10000146 | Ga0068866_1000014623 | 135 |
| 113 | 3300005719 | Ga0068861_100000573 | Ga0068861_10000057318 | 135 |
| 114 | 3300005719 | Ga0068861_100066848 | Ga0068861_1000668484 | 135 |
| 115 | 3300005840 | Ga0068870_10205280 | Ga0068870_102052802 | 135 |
| 116 | 3300005841 | Ga0068863_100239522 | Ga0068863_1002395223 | 135 |
| 117 | 3300005842 | Ga0068858_100001434 | Ga0068858_1000014346 | 135 |
| 118 | 3300005842 | Ga0068858_100357762 | Ga0068858_1003577622 | 135 |
| 119 | 3300005843 | Ga0068860_100000994 | Ga0068860_1000009943 | 135 |
| 120 | 3300005843 | Ga0068860_100293233 | Ga0068860_1002932332 | 135 |
| 121 | 3300005844 | Ga0068862_100001311 | Ga0068862_10000131123 | 135 |
| 122 | 3300005844 | Ga0068862_100632906 | Ga0068862_1006329062 | 135 |
| 123 | 3300006038 | Ga0075365_10346689 | Ga0075365_103466892 | 135 |
| 124 | 3300006163 | Ga0070715_10026657 | Ga0070715_100266573 | 135 |
| 125 | 3300006173 | Ga0070716_100009665 | Ga0070716_1000096655 | 135 |
| 126 | 3300006173 | Ga0070716_100275711 | Ga0070716_1002757111 | 135 |
| 127 | 3300006175 | Ga0070712_100001186 | Ga0070712_1000011863 | 135 |
| 128 | 3300006175 | Ga0070712_100185238 | Ga0070712_1001852382 | 135 |
| 129 | 3300006358 | Ga0068871_100039359 | Ga0068871_1000393594 | 135 |
| 130 | 3300006881 | Ga0068865_100012460 | Ga0068865_1000124603 | 135 |
| 131 | 3300006881 | Ga0068865_101001626 | Ga0068865_1010016262 | 135 |
| 132 | 3300006931 | Ga0097620_100072714 | Ga0097620_1000727145 | 135 |
| 133 | 3300009098 | Ga0105245_10019281 | Ga0105245_100192816 | 135 |
| 134 | 3300009098 | Ga0105245_10528998 | Ga0105245_105289982 | 135 |
| 135 | 3300009101 | Ga0105247_10000186 | Ga0105247_1000018623 | 135 |
| 136 | 3300009101 | Ga0105247_10022867 | Ga0105247_100228673 | 135 |
| 137 | 3300009148 | Ga0105243_10042425 | Ga0105243_100424253 | 135 |
| 138 | 3300009148 | Ga0105243_10076509 | Ga0105243_100765093 | 135 |
| 139 | 3300009174 | Ga0105241_11160796 | Ga0105241_111607962 | 135 |
| 140 | 3300009176 | Ga0105242_10000731 | Ga0105242_100007314 | 135 |
| 141 | 3300009177 | Ga0105248_10004274 | Ga0105248_1000427415 | 135 |
| 142 | 3300009177 | Ga0105248_10047837 | Ga0105248_100478372 | 135 |
| 143 | 3300009545 | Ga0105237_10011100 | Ga0105237_1001110011 | 135 |
| 144 | 3300009545 | Ga0105237_10178722 | Ga0105237_101787224 | 135 |
| 145 | 3300009553 | Ga0105249_10016009 | Ga0105249_100160097 | 135 |
| 146 | 3300010375 | Ga0105239_10115948 | Ga0105239_101159484 | 135 |
| 147 | 3300010375 | Ga0105239_10150126 | Ga0105239_101501263 | 135 |
| 148 | 3300013102 | Ga0157371_10240060 | Ga0157371_102400602 | 135 |
| 149 | 3300013296 | Ga0157374_10057709 | Ga0157374_100577092 | 135 |
| 150 | 3300013297 | Ga0157378_10019603 | Ga0157378_100196036 | 135 |
| 151 | 3300013306 | Ga0163162_10015890 | Ga0163162_100158908 | 135 |
| 152 | 3300013308 | Ga0157375_10027086 | Ga0157375_100270863 | 135 |
| 153 | 3300013308 | Ga0157375_10180507 | Ga0157375_101805072 | 135 |
| 154 | 3300013308 | Ga0157375_10489831 | Ga0157375_104898312 | 135 |
| 155 | 3300013308 | Ga0157375_11301788 | Ga0157375_113017881 | 135 |
| 156 | 3300014326 | Ga0157380_10002376 | Ga0157380_100023768 | 135 |
| 157 | 3300014968 | Ga0157379_10000419 | Ga0157379_1000041935 | 135 |
| 158 | 3300014968 | Ga0157379_10254416 | Ga0157379_102544162 | 135 |
| 159 | 3300014969 | Ga0157376_10165081 | Ga0157376_101650813 | 135 |
| 160 | 3300017792 | Ga0163161_10001582 | Ga0163161_100015822 | 135 |
| 161 | 3300017792 | Ga0163161_10160882 | Ga0163161_101608822 | 135 |
| 162 | 3300025898 | Ga0207692_10003683 | Ga0207692_100036836 | 135 |
| 163 | 3300025899 | Ga0207642_10000332 | Ga0207642_100003328 | 135 |
| 164 | 3300025900 | Ga0207710_10006318 | Ga0207710_100063183 | 135 |
| 165 | 3300025901 | Ga0207688_10033488 | Ga0207688_100334882 | 135 |
| 166 | 3300025901 | Ga0207688_10186490 | Ga0207688_101864901 | 135 |
| 167 | 3300025903 | Ga0207680_10123326 | Ga0207680_101233262 | 135 |
| 168 | 3300025905 | Ga0207685_10001049 | Ga0207685_100010496 | 135 |
| 169 | 3300025907 | Ga0207645_10046073 | Ga0207645_100460733 | 135 |
| 170 | 3300025911 | Ga0207654_10763276 | Ga0207654_107632762 | 135 |
| 171 | 3300025914 | Ga0207671_10032443 | Ga0207671_100324435 | 135 |
| 172 | 3300025914 | Ga0207671_10077323 | Ga0207671_100773232 | 135 |
| 173 | 3300025915 | Ga0207693_10000172 | Ga0207693_1000017220 | 135 |
| 174 | 3300025915 | Ga0207693_10235235 | Ga0207693_102352352 | 135 |
| 175 | 3300025916 | Ga0207663_10001208 | Ga0207663_100012088 | 135 |
| 176 | 3300025917 | Ga0207660_10182840 | Ga0207660_101828402 | 135 |
| 177 | 3300025919 | Ga0207657_10518229 | Ga0207657_105182292 | 135 |
| 178 | 3300025921 | Ga0207652_10376906 | Ga0207652_103769062 | 135 |
| 179 | 3300025923 | Ga0207681_10014848 | Ga0207681_100148483 | 135 |
| 180 | 3300025927 | Ga0207687_10004141 | Ga0207687_100041417 | 135 |
| 181 | 3300025927 | Ga0207687_10245951 | Ga0207687_102459512 | 135 |
| 182 | 3300025931 | Ga0207644_10245025 | Ga0207644_102450252 | 135 |
| 183 | 3300025932 | Ga0207690_10049980 | Ga0207690_100499804 | 135 |
| 184 | 3300025933 | Ga0207706_10100218 | Ga0207706_101002184 | 135 |
| 185 | 3300025934 | Ga0207686_10058000 | Ga0207686_100580002 | 135 |
| 186 | 3300025935 | Ga0207709_10003310 | Ga0207709_100033105 | 135 |
| 187 | 3300025937 | Ga0207669_10000124 | Ga0207669_1000012434 | 135 |
| 188 | 3300025937 | Ga0207669_10145933 | Ga0207669_101459332 | 135 |
| 189 | 3300025938 | Ga0207704_10004389 | Ga0207704_100043897 | 135 |
| 190 | 3300025938 | Ga0207704_10225033 | Ga0207704_102250332 | 135 |
| 191 | 3300025939 | Ga0207665_10026800 | Ga0207665_100268003 | 135 |
| 192 | 3300025939 | Ga0207665_10088162 | Ga0207665_100881621 | 135 |
| 193 | 3300025940 | Ga0207691_10085377 | Ga0207691_100853774 | 135 |
| 194 | 3300025941 | Ga0207711_10173891 | Ga0207711_101738912 | 135 |
| 195 | 3300025949 | Ga0207667_10065657 | Ga0207667_100656573 | 135 |
| 196 | 3300025961 | Ga0207712_10075694 | Ga0207712_100756942 | 135 |
| 197 | 3300025972 | Ga0207668_10001759 | Ga0207668_100017594 | 135 |
| 198 | 3300025972 | Ga0207668_10002901 | Ga0207668_100029017 | 135 |
| 199 | 3300025972 | Ga0207668_10279205 | Ga0207668_102792052 | 135 |
| 200 | 3300025981 | Ga0207640_10001238 | Ga0207640_1000123812 | 135 |
| 201 | 3300025986 | Ga0207658_10004718 | Ga0207658_100047185 | 135 |
| 202 | 3300025986 | Ga0207658_11085558 | Ga0207658_110855582 | 135 |
| 203 | 3300026023 | Ga0207677_10129767 | Ga0207677_101297672 | 135 |
| 204 | 3300026035 | Ga0207703_10016310 | Ga0207703_100163103 | 135 |
| 205 | 3300026035 | Ga0207703_10275600 | Ga0207703_102756002 | 135 |
| 206 | 3300026035 | Ga0207703_10321258 | Ga0207703_103212582 | 135 |
| 207 | 3300026041 | Ga0207639_10023258 | Ga0207639_100232582 | 135 |
| 208 | 3300026041 | Ga0207639_11597208 | Ga0207639_115972081 | 135 |
| 209 | 3300026067 | Ga0207678_10007789 | Ga0207678_100077899 | 135 |
| 210 | 3300026067 | Ga0207678_10749006 | Ga0207678_107490061 | 135 |
| 211 | 3300026075 | Ga0207708_10002732 | Ga0207708_100027322 | 135 |
| 212 | 3300026078 | Ga0207702_10258063 | Ga0207702_102580632 | 135 |
| 213 | 3300026078 | Ga0207702_10418823 | Ga0207702_104188232 | 135 |
| 214 | 3300026088 | Ga0207641_10293487 | Ga0207641_102934873 | 135 |
| 215 | 3300026089 | Ga0207648_10044350 | Ga0207648_100443505 | 135 |
| 216 | 3300026095 | Ga0207676_10705026 | Ga0207676_107050262 | 135 |
| 217 | 3300026118 | Ga0207675_100000554 | Ga0207675_1000005542 | 135 |
| 218 | 3300026118 | Ga0207675_100102772 | Ga0207675_1001027722 | 135 |
| 219 | 3300026121 | Ga0207683_10000486 | Ga0207683_1000048638 | 135 |
| 220 | 3300026121 | Ga0207683_10289515 | Ga0207683_102895151 | 135 |
| 221 | 3300026121 | Ga0207683_11009015 | Ga0207683_110090152 | 135 |
| 222 | 3300028379 | Ga0268266_10149568 | Ga0268266_101495682 | 135 |
| 223 | 3300028379 | Ga0268266_10765909 | Ga0268266_107659092 | 135 |
| 224 | 3300028380 | Ga0268265_10007213 | Ga0268265_100072136 | 135 |
| 225 | 3300028380 | Ga0268265_10607910 | Ga0268265_106079102 | 135 |
| 226 | 3300028381 | Ga0268264_10006786 | Ga0268264_100067867 | 135 |
| 227 | 3300028381 | Ga0268264_11014747 | Ga0268264_110147472 | 135 |
| 228 | 3300031456 | Ga0307513_10018498 | Ga0307513_1001849810 | 135 |
| 229 | 3300032002 | Ga0307416_101743536 | Ga0307416_1017435362 | 135 |
| 230 | 3300034817 | Ga0373948_0077707 | Ga0373948_0077707_189_596 | 135 |
| 231 | 3300035090 | Ga0373949_0015882 | Ga0373949_0015882_704_1111 | 135 |
| 232 | 3300035091 | Ga0373951_0167916 | Ga0373951_0167916_150_557 | 135 |
| 233 | 3300035121 | Ga0373960_0047966 | Ga0373960_0047966_722_1129 | 135 |
| 234 | 3300035207 | Ga0373942_0235218 | Ga0373942_0235218_155_562 | 135 |
| 235 | 3300035242 | Ga0373962_0225014 | Ga0373962_0225014_126_533 | 135 |
| 236 | 3300035691 | Ga0373931_0076920 | Ga0373931_0076920_513_920 | 135 |
| 237 | 3300042438 | Ga0439459_0020402 | Ga0439459_0020402_558_965 | 135 |
| 238 | 3300044683 | Ga0466965_0024314 | Ga0466965_0024314_2286_2693 | 135 |
| 239 | 3300044693 | Ga0466961_0984763 | Ga0466961_0984763_65_472 | 135 |
| 240 | 3300044706 | Ga0466964_0043724 | Ga0466964_0043724_223_630 | 135 |
| 241 | 3300044719 | Ga0466971_0049913 | Ga0466971_0049913_70_477 | 135 |
| 242 | 3300044735 | Ga0466968_0002213 | Ga0466968_0002213_2904_3311 | 135 |
| 243 | 3300044765 | Ga0466970_0024731 | Ga0466970_0024731_377_784 | 135 |
| 244 | 3300044842 | Ga0466957_0016121 | Ga0466957_0016121_459_866 | 135 |
| 245 | 3300044901 | Ga0466960_0002339 | Ga0466960_0002339_4685_5092 | 135 |
| 246 | 3300045049 | Ga0466959_0034186 | Ga0466959_0034186_1227_1634 | 135 |
| 247 | 3300045836 | Ga0466958_0115274 | Ga0466958_0115274_1254_1661 | 135 |
| 248 | 3300045976 | Ga0466967_0013771 | Ga0466967_0013771_3109_3516 | 135 |
| 249 | 3300045976 | Ga0466967_0040907 | Ga0466967_0040907_983_1390 | 135 |
| 250 | 3300046455 | Ga0495603_0675906 | Ga0495603_0675906_98_505 | 135 |
| 251 | 3300046506 | Ga0495583_0009710 | Ga0495583_0009710_253_660 | 135 |
| 252 | 3300046507 | Ga0495606_0064739 | Ga0495606_0064739_548_955 | 135 |
| 253 | 3300046524 | Ga0495648_0004576 | Ga0495648_0004576_4997_5404 | 135 |
| 254 | 3300046530 | Ga0495654_0124018 | Ga0495654_0124018_544_951 | 135 |
| 255 | 3300046616 | Ga0495668_0017605 | Ga0495668_0017605_1730_2137 | 135 |
| 256 | 3300046648 | Ga0495611_0350617 | Ga0495611_0350617_215_622 | 135 |
| 257 | 3300046692 | Ga0495671_0148330 | Ga0495671_0148330_282_689 | 135 |
| 258 | 3300046692 | Ga0495671_0467865 | Ga0495671_0467865_160_567 | 135 |
| 259 | 3300047320 | Ga0495672_0004629 | Ga0495672_0004629_5549_5956 | 135 |
| 260 | 3300047469 | Ga0495673_0001554 | Ga0495673_0001554_15876_16283 | 135 |
| 261 | 3300048903 | Ga0496100_0002220 | Ga0496100_0002220_3736_4143 | 135 |
| 262 | 3300048903 | Ga0496100_0003746 | Ga0496100_0003746_1706_2113 | 135 |
| 263 | 3300048903 | Ga0496100_0023748 | Ga0496100_0023748_1903_2310 | 135 |
| 264 | 3300048904 | Ga0496101_0000115 | Ga0496101_0000115_47507_47914 | 135 |
| 265 | 3300048904 | Ga0496101_0002076 | Ga0496101_0002076_1705_2112 | 135 |
| 266 | 3300048904 | Ga0496101_0013674 | Ga0496101_0013674_2728_3135 | 135 |
| 267 | 3300048905 | Ga0496102_0000009 | Ga0496102_0000009_23063_23470 | 135 |
| 268 | 3300048905 | Ga0496102_0163592 | Ga0496102_0163592_1273_1680 | 135 |
| 269 | 3300048905 | Ga0496102_1039609 | Ga0496102_1039609_105_512 | 135 |
| 270 | 3300048906 | Ga0496103_0000051 | Ga0496103_0000051_23063_23470 | 135 |
| 271 | 3300048906 | Ga0496103_0000694 | Ga0496103_0000694_2345_2752 | 135 |
| 272 | 3300048907 | Ga0496104_0156146 | Ga0496104_0156146_65_472 | 135 |
| 273 | 3300048907 | Ga0496104_0209137 | Ga0496104_0209137_498_905 | 135 |
| 274 | 3300048908 | Ga0496105_0043866 | Ga0496105_0043866_1287_1694 | 135 |
| 275 | 3300048908 | Ga0496105_0317182 | Ga0496105_0317182_513_920 | 135 |
| 276 | 3300048909 | Ga0496106_0007463 | Ga0496106_0007463_1701_2108 | 135 |
| 277 | 3300048909 | Ga0496106_0030201 | Ga0496106_0030201_1563_1970 | 135 |
| 278 | 3300048909 | Ga0496106_0370685 | Ga0496106_0370685_39_446 | 135 |
| 279 | 3300048910 | Ga0496107_0002211 | Ga0496107_0002211_1440_1847 | 135 |
| 280 | 3300048910 | Ga0496107_0005423 | Ga0496107_0005423_7252_7659 | 135 |
| 281 | 3300048910 | Ga0496107_0129246 | Ga0496107_0129246_1322_1729 | 135 |
| 282 | 3300048911 | Ga0496108_0174488 | Ga0496108_0174488_531_938 | 135 |
| 283 | 3300048912 | Ga0496109_0048342 | Ga0496109_0048342_3293_3700 | 135 |
| 284 | 3300048913 | Ga0496110_1240730 | Ga0496110_1240730_66_473 | 135 |
| 285 | 3300048917 | Ga0496114_0000470 | Ga0496114_0000470_28942_29349 | 135 |
| 286 | 3300048917 | Ga0496114_0001282 | Ga0496114_0001282_15018_15425 | 135 |
| 287 | 3300048917 | Ga0496114_0185915 | Ga0496114_0185915_973_1380 | 135 |
| 288 | 3300048917 | Ga0496114_0575829 | Ga0496114_0575829_157_579 | 135 |
| 289 | 3300048918 | Ga0496115_0005314 | Ga0496115_0005314_5115_5522 | 135 |
| 290 | 3300048919 | Ga0496116_0000141 | Ga0496116_0000141_126947_127354 | 135 |
| 291 | 3300048920 | Ga0496117_0000019 | Ga0496117_0000019_445787_446194 | 135 |
| 292 | 3300048921 | Ga0496118_0000020 | Ga0496118_0000020_23063_23470 | 135 |
| 293 | 3300048922 | Ga0496119_0001032 | Ga0496119_0001032_34214_34621 | 135 |
| 294 | 3300048923 | Ga0496120_0002480 | Ga0496120_0002480_13606_14013 | 135 |
| 295 | 3300048924 | Ga0496121_0000510 | Ga0496121_0000510_23063_23470 | 135 |
| 296 | 3300048929 | Ga0496126_0001641 | Ga0496126_0001641_22816_23223 | 135 |
| 297 | 3300050492 | nmdc:mga0yw44_695815_c1 | nmdc:mga0yw44_695815_c1_260_667 | 135 |
| 298 | 3300050492 | nmdc:mga0yw44_889122_c1 | nmdc:mga0yw44_889122_c1_104_511 | 135 |
| 299 | 3300050516 | nmdc:mga0sz30_175055_c1 | nmdc:mga0sz30_175055_c1_366_773 | 135 |
| 300 | 3300053087 | Ga0500643_007330 | Ga0500643_007330_1004_1411 | 135 |
| 301 | 3300053153 | Ga0500616_0031789 | Ga0500616_0031789_1419_1826 | 135 |
| 302 | 3300053158 | Ga0500627_0313827 | Ga0500627_0313827_202_609 | 135 |
| 303 | 3300025929 | Ga0207664_10381193 | Ga0207664_103811932 | 136 |
| 304 | iso_pu_bacteria | 2738541356 | 2739144811 | 136 |
| 305 | 3300005327 | Ga0070658_10745375 | Ga0070658_107453751 | 137 |
| 306 | 3300005327 | Ga0070658_11960984 | Ga0070658_119609841 | 137 |
| 307 | 3300005329 | Ga0070683_101099834 | Ga0070683_1010998342 | 137 |
| 308 | 3300005329 | Ga0070683_101561657 | Ga0070683_1015616571 | 137 |
| 309 | 3300005329 | Ga0070683_101576162 | Ga0070683_1015761621 | 137 |
| 310 | 3300005331 | Ga0070670_100984562 | Ga0070670_1009845622 | 137 |
| 311 | 3300005334 | Ga0068869_100070150 | Ga0068869_1000701502 | 137 |
| 312 | 3300005337 | Ga0070682_100304149 | Ga0070682_1003041492 | 137 |
| 313 | 3300005337 | Ga0070682_100948114 | Ga0070682_1009481141 | 137 |
| 314 | 3300005338 | Ga0068868_100808185 | Ga0068868_1008081851 | 137 |
| 315 | 3300005339 | Ga0070660_100798772 | Ga0070660_1007987721 | 137 |
| 316 | 3300005340 | Ga0070689_100335966 | Ga0070689_1003359662 | 137 |
| 317 | 3300005343 | Ga0070687_100149690 | Ga0070687_1001496901 | 137 |
| 318 | 3300005344 | Ga0070661_100961635 | Ga0070661_1009616351 | 137 |
| 319 | 3300005345 | Ga0070692_10070532 | Ga0070692_100705322 | 137 |
| 320 | 3300005347 | Ga0070668_100346901 | Ga0070668_1003469012 | 137 |
| 321 | 3300005354 | Ga0070675_100429213 | Ga0070675_1004292132 | 137 |
| 322 | 3300005356 | Ga0070674_100233831 | Ga0070674_1002338312 | 137 |
| 323 | 3300005356 | Ga0070674_101700217 | Ga0070674_1017002171 | 137 |
| 324 | 3300005364 | Ga0070673_100487354 | Ga0070673_1004873541 | 137 |
| 325 | 3300005365 | Ga0070688_100222984 | Ga0070688_1002229841 | 137 |
| 326 | 3300005366 | Ga0070659_100061193 | Ga0070659_1000611933 | 137 |
| 327 | 3300005366 | Ga0070659_101086965 | Ga0070659_1010869652 | 137 |
| 328 | 3300005367 | Ga0070667_100163160 | Ga0070667_1001631603 | 137 |
| 329 | 3300005439 | Ga0070711_101058326 | Ga0070711_1010583262 | 137 |
| 330 | 3300005441 | Ga0070700_100088501 | Ga0070700_1000885012 | 137 |
| 331 | 3300005444 | Ga0070694_100470033 | Ga0070694_1004700332 | 137 |
| 332 | 3300005455 | Ga0070663_100362238 | Ga0070663_1003622382 | 137 |
| 333 | 3300005455 | Ga0070663_100523620 | Ga0070663_1005236201 | 137 |
| 334 | 3300005456 | Ga0070678_100335327 | Ga0070678_1003353272 | 137 |
| 335 | 3300005456 | Ga0070678_100582178 | Ga0070678_1005821782 | 137 |
| 336 | 3300005456 | Ga0070678_101818482 | Ga0070678_1018184821 | 137 |
| 337 | 3300005457 | Ga0070662_101592891 | Ga0070662_1015928911 | 137 |
| 338 | 3300005457 | Ga0070662_101986619 | Ga0070662_1019866191 | 137 |
| 339 | 3300005458 | Ga0070681_10707306 | Ga0070681_107073062 | 137 |
| 340 | 3300005459 | Ga0068867_100198536 | Ga0068867_1001985362 | 137 |
| 341 | 3300005466 | Ga0070685_10164305 | Ga0070685_101643052 | 137 |
| 342 | 3300005530 | Ga0070679_100189091 | Ga0070679_1001890912 | 137 |
| 343 | 3300005535 | Ga0070684_100109176 | Ga0070684_1001091762 | 137 |
| 344 | 3300005539 | Ga0068853_100431796 | Ga0068853_1004317962 | 137 |
| 345 | 3300005543 | Ga0070672_100339154 | Ga0070672_1003391541 | 137 |
| 346 | 3300005543 | Ga0070672_100456824 | Ga0070672_1004568242 | 137 |
| 347 | 3300005546 | Ga0070696_100292558 | Ga0070696_1002925582 | 137 |
| 348 | 3300005547 | Ga0070693_100564533 | Ga0070693_1005645331 | 137 |
| 349 | 3300005548 | Ga0070665_100277616 | Ga0070665_1002776162 | 137 |
| 350 | 3300005548 | Ga0070665_100298116 | Ga0070665_1002981162 | 137 |
| 351 | 3300005548 | Ga0070665_101846542 | Ga0070665_1018465421 | 137 |
| 352 | 3300005563 | Ga0068855_100214605 | Ga0068855_1002146052 | 137 |
| 353 | 3300005563 | Ga0068855_102095093 | Ga0068855_1020950931 | 137 |
| 354 | 3300005564 | Ga0070664_100121064 | Ga0070664_1001210643 | 137 |
| 355 | 3300005564 | Ga0070664_100763667 | Ga0070664_1007636672 | 137 |
| 356 | 3300005577 | Ga0068857_100498657 | Ga0068857_1004986571 | 137 |
| 357 | 3300005614 | Ga0068856_100082414 | Ga0068856_1000824144 | 137 |
| 358 | 3300005614 | Ga0068856_100302742 | Ga0068856_1003027422 | 137 |
| 359 | 3300005616 | Ga0068852_100041014 | Ga0068852_1000410146 | 137 |
| 360 | 3300005616 | Ga0068852_100166125 | Ga0068852_1001661252 | 137 |
| 361 | 3300005616 | Ga0068852_100344989 | Ga0068852_1003449892 | 137 |
| 362 | 3300005617 | Ga0068859_101375111 | Ga0068859_1013751111 | 137 |
| 363 | 3300005618 | Ga0068864_100245745 | Ga0068864_1002457451 | 137 |
| 364 | 3300005718 | Ga0068866_10396827 | Ga0068866_103968271 | 137 |
| 365 | 3300005719 | Ga0068861_100095142 | Ga0068861_1000951421 | 137 |
| 366 | 3300005840 | Ga0068870_10030119 | Ga0068870_100301194 | 137 |
| 367 | 3300005840 | Ga0068870_10845891 | Ga0068870_108458912 | 137 |
| 368 | 3300005842 | Ga0068858_100057285 | Ga0068858_1000572852 | 137 |
| 369 | 3300005844 | Ga0068862_100286425 | Ga0068862_1002864252 | 137 |
| 370 | 3300005981 | Ga0081538_10238705 | Ga0081538_102387052 | 137 |
| 371 | 3300006028 | Ga0070717_10263979 | Ga0070717_102639792 | 137 |
| 372 | 3300006028 | Ga0070717_12160107 | Ga0070717_121601071 | 137 |
| 373 | 3300006058 | Ga0075432_10530079 | Ga0075432_105300791 | 137 |
| 374 | 3300006237 | Ga0097621_102051118 | Ga0097621_1020511182 | 137 |
| 375 | 3300006358 | Ga0068871_100450437 | Ga0068871_1004504372 | 137 |
| 376 | 3300006847 | Ga0075431_101062825 | Ga0075431_1010628252 | 137 |
| 377 | 3300006931 | Ga0097620_101375069 | Ga0097620_1013750691 | 137 |
| 378 | 3300009093 | Ga0105240_10511999 | Ga0105240_105119991 | 137 |
| 379 | 3300009094 | Ga0111539_10307347 | Ga0111539_103073472 | 137 |
| 380 | 3300009098 | Ga0105245_10142444 | Ga0105245_101424443 | 137 |
| 381 | 3300009101 | Ga0105247_11283111 | Ga0105247_112831112 | 137 |
| 382 | 3300009148 | Ga0105243_10341808 | Ga0105243_103418082 | 137 |
| 383 | 3300009148 | Ga0105243_10423136 | Ga0105243_104231362 | 137 |
| 384 | 3300009148 | Ga0105243_11752511 | Ga0105243_117525112 | 137 |
| 385 | 3300009174 | Ga0105241_10161928 | Ga0105241_101619282 | 137 |
| 386 | 3300009176 | Ga0105242_11296302 | Ga0105242_112963021 | 137 |
| 387 | 3300009545 | Ga0105237_10953395 | Ga0105237_109533952 | 137 |
| 388 | 3300009551 | Ga0105238_10354713 | Ga0105238_103547132 | 137 |
| 389 | 3300009551 | Ga0105238_10815157 | Ga0105238_108151571 | 137 |
| 390 | 3300009553 | Ga0105249_10107042 | Ga0105249_101070423 | 137 |
| 391 | 3300009553 | Ga0105249_12674214 | Ga0105249_126742141 | 137 |
| 392 | 3300009993 | Ga0105028_109213 | Ga0105028_1092132 | 137 |
| 393 | 3300010375 | Ga0105239_10112590 | Ga0105239_101125904 | 137 |
| 394 | 3300010375 | Ga0105239_10305173 | Ga0105239_103051732 | 137 |
| 395 | 3300010375 | Ga0105239_10963053 | Ga0105239_109630532 | 137 |
| 396 | 3300011119 | Ga0105246_10392896 | Ga0105246_103928962 | 137 |
| 397 | 3300011119 | Ga0105246_11160707 | Ga0105246_111607071 | 137 |
| 398 | 3300013102 | Ga0157371_10497114 | Ga0157371_104971142 | 137 |
| 399 | 3300013105 | Ga0157369_10128133 | Ga0157369_101281333 | 137 |
| 400 | 3300013105 | Ga0157369_10200934 | Ga0157369_102009343 | 137 |
| 401 | 3300013296 | Ga0157374_10074957 | Ga0157374_100749572 | 137 |
| 402 | 3300013296 | Ga0157374_10336331 | Ga0157374_103363312 | 137 |
| 403 | 3300013297 | Ga0157378_10261854 | Ga0157378_102618544 | 137 |
| 404 | 3300013307 | Ga0157372_10421476 | Ga0157372_104214762 | 137 |
| 405 | 3300013307 | Ga0157372_11505648 | Ga0157372_115056481 | 137 |
| 406 | 3300013308 | Ga0157375_10280643 | Ga0157375_102806432 | 137 |
| 407 | 3300013308 | Ga0157375_13599876 | Ga0157375_135998761 | 137 |
| 408 | 3300014325 | Ga0163163_10283008 | Ga0163163_102830082 | 137 |
| 409 | 3300014326 | Ga0157380_10446030 | Ga0157380_104460302 | 137 |
| 410 | 3300014497 | Ga0182008_10119269 | Ga0182008_101192692 | 137 |
| 411 | 3300014745 | Ga0157377_10266987 | Ga0157377_102669872 | 137 |
| 412 | 3300014745 | Ga0157377_10566145 | Ga0157377_105661452 | 137 |
| 413 | 3300014745 | Ga0157377_10960479 | Ga0157377_109604792 | 137 |
| 414 | 3300014969 | Ga0157376_10130616 | Ga0157376_101306162 | 137 |
| 415 | 3300017792 | Ga0163161_10298168 | Ga0163161_102981682 | 137 |
| 416 | 3300025899 | Ga0207642_10255211 | Ga0207642_102552112 | 137 |
| 417 | 3300025900 | Ga0207710_10321888 | Ga0207710_103218882 | 137 |
| 418 | 3300025901 | Ga0207688_10004409 | Ga0207688_100044099 | 137 |
| 419 | 3300025901 | Ga0207688_10066672 | Ga0207688_100666722 | 137 |
| 420 | 3300025908 | Ga0207643_10015756 | Ga0207643_100157562 | 137 |
| 421 | 3300025909 | Ga0207705_10580038 | Ga0207705_105800381 | 137 |
| 422 | 3300025909 | Ga0207705_10761541 | Ga0207705_107615412 | 137 |
| 423 | 3300025913 | Ga0207695_10622179 | Ga0207695_106221791 | 137 |
| 424 | 3300025914 | Ga0207671_10415195 | Ga0207671_104151951 | 137 |
| 425 | 3300025916 | Ga0207663_11168287 | Ga0207663_111682872 | 137 |
| 426 | 3300025918 | Ga0207662_10155727 | Ga0207662_101557271 | 137 |
| 427 | 3300025919 | Ga0207657_10076906 | Ga0207657_100769062 | 137 |
| 428 | 3300025919 | Ga0207657_10184341 | Ga0207657_101843412 | 137 |
| 429 | 3300025919 | Ga0207657_10399323 | Ga0207657_103993232 | 137 |
| 430 | 3300025920 | Ga0207649_10735390 | Ga0207649_107353902 | 137 |
| 431 | 3300025921 | Ga0207652_10356240 | Ga0207652_103562401 | 137 |
| 432 | 3300025921 | Ga0207652_10743014 | Ga0207652_107430141 | 137 |
| 433 | 3300025924 | Ga0207694_10275939 | Ga0207694_102759392 | 137 |
| 434 | 3300025924 | Ga0207694_10905040 | Ga0207694_109050401 | 137 |
| 435 | 3300025925 | Ga0207650_10137217 | Ga0207650_101372173 | 137 |
| 436 | 3300025926 | Ga0207659_11341581 | Ga0207659_113415811 | 137 |
| 437 | 3300025927 | Ga0207687_10030832 | Ga0207687_100308322 | 137 |
| 438 | 3300025927 | Ga0207687_11194169 | Ga0207687_111941692 | 137 |
| 439 | 3300025929 | Ga0207664_10876566 | Ga0207664_108765662 | 137 |
| 440 | 3300025931 | Ga0207644_10052303 | Ga0207644_100523032 | 137 |
| 441 | 3300025932 | Ga0207690_10227839 | Ga0207690_102278391 | 137 |
| 442 | 3300025932 | Ga0207690_11635698 | Ga0207690_116356981 | 137 |
| 443 | 3300025933 | Ga0207706_10054685 | Ga0207706_100546851 | 137 |
| 444 | 3300025933 | Ga0207706_11112174 | Ga0207706_111121742 | 137 |
| 445 | 3300025935 | Ga0207709_10317073 | Ga0207709_103170731 | 137 |
| 446 | 3300025935 | Ga0207709_11062432 | Ga0207709_110624322 | 137 |
| 447 | 3300025936 | Ga0207670_10469425 | Ga0207670_104694251 | 137 |
| 448 | 3300025938 | Ga0207704_10234468 | Ga0207704_102344682 | 137 |
| 449 | 3300025940 | Ga0207691_10120971 | Ga0207691_101209713 | 137 |
| 450 | 3300025942 | Ga0207689_10024871 | Ga0207689_100248714 | 137 |
| 451 | 3300025942 | Ga0207689_10290241 | Ga0207689_102902412 | 137 |
| 452 | 3300025945 | Ga0207679_10076351 | Ga0207679_100763513 | 137 |
| 453 | 3300025949 | Ga0207667_11559511 | Ga0207667_115595111 | 137 |
| 454 | 3300025960 | Ga0207651_10141206 | Ga0207651_101412062 | 137 |
| 455 | 3300025961 | Ga0207712_10030188 | Ga0207712_100301882 | 137 |
| 456 | 3300025972 | Ga0207668_10240598 | Ga0207668_102405983 | 137 |
| 457 | 3300025972 | Ga0207668_10346901 | Ga0207668_103469012 | 137 |
| 458 | 3300025986 | Ga0207658_10558132 | Ga0207658_105581321 | 137 |
| 459 | 3300026023 | Ga0207677_10740620 | Ga0207677_107406202 | 137 |
| 460 | 3300026023 | Ga0207677_11022953 | Ga0207677_110229532 | 137 |
| 461 | 3300026035 | Ga0207703_10069667 | Ga0207703_100696672 | 137 |
| 462 | 3300026035 | Ga0207703_11006815 | Ga0207703_110068152 | 137 |
| 463 | 3300026041 | Ga0207639_10109132 | Ga0207639_101091321 | 137 |
| 464 | 3300026067 | Ga0207678_10055806 | Ga0207678_100558062 | 137 |
| 465 | 3300026067 | Ga0207678_10491006 | Ga0207678_104910062 | 137 |
| 466 | 3300026075 | Ga0207708_10053197 | Ga0207708_100531974 | 137 |
| 467 | 3300026078 | Ga0207702_10386889 | Ga0207702_103868892 | 137 |
| 468 | 3300026078 | Ga0207702_11090575 | Ga0207702_110905752 | 137 |
| 469 | 3300026088 | Ga0207641_10812994 | Ga0207641_108129942 | 137 |
| 470 | 3300026089 | Ga0207648_10049169 | Ga0207648_100491694 | 137 |
| 471 | 3300026095 | Ga0207676_11097869 | Ga0207676_110978691 | 137 |
| 472 | 3300026116 | Ga0207674_10165726 | Ga0207674_101657262 | 137 |
| 473 | 3300026118 | Ga0207675_100039045 | Ga0207675_1000390457 | 137 |
| 474 | 3300026121 | Ga0207683_10098306 | Ga0207683_100983062 | 137 |
| 475 | 3300026121 | Ga0207683_10423081 | Ga0207683_104230812 | 137 |
| 476 | 3300026142 | Ga0207698_10226873 | Ga0207698_102268732 | 137 |
| 477 | 3300026142 | Ga0207698_10424008 | Ga0207698_104240082 | 137 |
| 478 | 3300028379 | Ga0268266_10107036 | Ga0268266_101070363 | 137 |
| 479 | 3300028379 | Ga0268266_11277518 | Ga0268266_112775181 | 137 |
| 480 | 3300028380 | Ga0268265_10085812 | Ga0268265_100858123 | 137 |
| 481 | 3300028381 | Ga0268264_10792574 | Ga0268264_107925742 | 137 |
| 482 | 3300030521 | Ga0307511_10196288 | Ga0307511_101962882 | 137 |
| 483 | 3300035115 | Ga0373941_0206154 | Ga0373941_0206154_274_702 | 137 |
| 484 | 3300039437 | Ga0436365_0011767 | Ga0436365_0011767_5631_6065 | 137 |
| 485 | 3300039450 | Ga0436363_0933205 | Ga0436363_0933205_130_543 | 137 |
| 486 | 3300044658 | Ga0466972_0004922 | Ga0466972_0004922_4966_5379 | 137 |
| 487 | 3300044706 | Ga0466964_0384833 | Ga0466964_0384833_127_540 | 137 |
| 488 | 3300044735 | Ga0466968_0004456 | Ga0466968_0004456_529_942 | 137 |
| 489 | 3300044765 | Ga0466970_0082957 | Ga0466970_0082957_554_967 | 137 |
| 490 | 3300044842 | Ga0466957_0341809 | Ga0466957_0341809_357_770 | 137 |
| 491 | 3300044842 | Ga0466957_0436408 | Ga0466957_0436408_156_569 | 137 |
| 492 | 3300044901 | Ga0466960_0066696 | Ga0466960_0066696_238_702 | 137 |
| 493 | 3300045049 | Ga0466959_0367025 | Ga0466959_0367025_245_658 | 137 |
| 494 | 3300045836 | Ga0466958_0264408 | Ga0466958_0264408_121_585 | 137 |
| 495 | 3300045976 | Ga0466967_0030816 | Ga0466967_0030816_2910_3374 | 137 |
| 496 | 3300045976 | Ga0466967_2136082 | Ga0466967_2136082_45_473 | 137 |
| 497 | 3300046471 | Ga0495650_0042092 | Ga0495650_0042092_492_905 | 137 |
| 498 | 3300046694 | Ga0495649_0420926 | Ga0495649_0420926_176_589 | 137 |
| 499 | 3300048904 | Ga0496101_0583405 | Ga0496101_0583405_124_537 | 137 |
| 500 | 3300048905 | Ga0496102_0161621 | Ga0496102_0161621_1114_1542 | 137 |
| 501 | 3300048907 | Ga0496104_0161538 | Ga0496104_0161538_390_803 | 137 |
| 502 | 3300048908 | Ga0496105_1416987 | Ga0496105_1416987_29_457 | 137 |
| 503 | 3300048909 | Ga0496106_1014592 | Ga0496106_1014592_17_430 | 137 |
| 504 | 3300048910 | Ga0496107_0522096 | Ga0496107_0522096_142_555 | 137 |
| 505 | 3300048911 | Ga0496108_0011728 | Ga0496108_0011728_3656_4069 | 137 |
| 506 | 3300048911 | Ga0496108_0482030 | Ga0496108_0482030_271_699 | 137 |
| 507 | 3300048912 | Ga0496109_0013155 | Ga0496109_0013155_6179_6592 | 137 |
| 508 | 3300048912 | Ga0496109_0878304 | Ga0496109_0878304_166_594 | 137 |
| 509 | 3300048913 | Ga0496110_0042561 | Ga0496110_0042561_947_1360 | 137 |
| 510 | 3300048913 | Ga0496110_0310543 | Ga0496110_0310543_18_446 | 137 |
| 511 | 3300048913 | Ga0496110_0496499 | Ga0496110_0496499_207_635 | 137 |
| 512 | 3300048914 | Ga0496111_0069410 | Ga0496111_0069410_1493_1906 | 137 |
| 513 | 3300048914 | Ga0496111_0428171 | Ga0496111_0428171_379_807 | 137 |
| 514 | 3300048914 | Ga0496111_0921758 | Ga0496111_0921758_137_565 | 137 |
| 515 | 3300048915 | Ga0496112_0029795 | Ga0496112_0029795_1705_2118 | 137 |
| 516 | 3300048916 | Ga0496113_0177215 | Ga0496113_0177215_1050_1463 | 137 |
| 517 | 3300048917 | Ga0496114_0890975 | Ga0496114_0890975_77_505 | 137 |
| 518 | 3300048917 | Ga0496114_0969792 | Ga0496114_0969792_67_495 | 137 |
| 519 | 3300049569 | Ga0501032_0006575 | Ga0501032_0006575_4353_4766 | 137 |
| 520 | 3300049570 | Ga0501033_0111628 | Ga0501033_0111628_800_1213 | 137 |
| 521 | 3300049571 | Ga0501034_0004273 | Ga0501034_0004273_11302_11715 | 137 |
| 522 | 3300049572 | Ga0501036_0016856 | Ga0501036_0016856_3463_3876 | 137 |
| 523 | 3300049573 | Ga0501037_0002477 | Ga0501037_0002477_1624_2037 | 137 |
| 524 | 3300049579 | Ga0501043_0002246 | Ga0501043_0002246_8991_9404 | 137 |
| 525 | 3300049581 | Ga0501047_0014204 | Ga0501047_0014204_773_1186 | 137 |
| 526 | 3300049582 | Ga0501048_0001569 | Ga0501048_0001569_2933_3346 | 137 |
| 527 | 3300049586 | Ga0501070_0001570 | Ga0501070_0001570_3741_4154 | 137 |
| 528 | 3300049589 | Ga0501073_0176539 | Ga0501073_0176539_1024_1437 | 137 |
| 529 | 3300049742 | Ga0501080_0196997 | Ga0501080_0196997_643_1056 | 137 |
| 530 | 3300049822 | Ga0501035_0021057 | Ga0501035_0021057_1228_1641 | 137 |
| 531 | 3300049823 | Ga0501044_0004782 | Ga0501044_0004782_8123_8536 | 137 |
| 532 | 3300050492 | nmdc:mga0yw44_701714_c1 | nmdc:mga0yw44_701714_c1_112_525 | 137 |
| 533 | 3300053083 | Ga0495655_0160238 | Ga0495655_0160238_129_542 | 137 |
| 534 | 3300053129 | Ga0500628_043986 | Ga0500628_043986_449_862 | 137 |
| 535 | iso_pu_bacteria | 2738543005 | 2739202384 | 137 |
| 536 | iso_pu_bacteria | 2738543011 | 2739235642 | 137 |
| 537 | iso_pu_bacteria | 2738543034 | 2739362365 | 137 |
| 538 | iso_pu_bacteria | 2939743619 | 2939746886 | 137 |
| 539 | 3300001989 | JGI24739J22299_10042173 | JGI24739J22299_100421733 | 138 |
| 540 | 3300002067 | JGI24735J21928_10224958 | JGI24735J21928_102249581 | 138 |
| 541 | 3300005338 | Ga0068868_100124807 | Ga0068868_1001248071 | 138 |
| 542 | 3300005347 | Ga0070668_100005926 | Ga0070668_1000059267 | 138 |
| 543 | 3300005347 | Ga0070668_100011482 | Ga0070668_1000114824 | 138 |
| 544 | 3300005347 | Ga0070668_100673881 | Ga0070668_1006738812 | 138 |
| 545 | 3300005367 | Ga0070667_100001266 | Ga0070667_10000126611 | 138 |
| 546 | 3300005435 | Ga0070714_100272375 | Ga0070714_1002723752 | 138 |
| 547 | 3300005457 | Ga0070662_100001067 | Ga0070662_10000106714 | 138 |
| 548 | 3300005615 | Ga0070702_100000433 | Ga0070702_10000043313 | 138 |
| 549 | 3300005615 | Ga0070702_101735431 | Ga0070702_1017354311 | 138 |
| 550 | 3300006048 | Ga0075363_100054745 | Ga0075363_1000547453 | 138 |
| 551 | 3300006048 | Ga0075363_100259503 | Ga0075363_1002595032 | 138 |
| 552 | 3300006048 | Ga0075363_100325804 | Ga0075363_1003258042 | 138 |
| 553 | 3300006048 | Ga0075363_100363698 | Ga0075363_1003636982 | 138 |
| 554 | 3300006048 | Ga0075363_100515004 | Ga0075363_1005150041 | 138 |
| 555 | 3300006051 | Ga0075364_10009617 | Ga0075364_100096173 | 138 |
| 556 | 3300006051 | Ga0075364_10231945 | Ga0075364_102319452 | 138 |
| 557 | 3300006177 | Ga0075362_10061322 | Ga0075362_100613223 | 138 |
| 558 | 3300006186 | Ga0075369_10004548 | Ga0075369_100045487 | 138 |
| 559 | 3300006353 | Ga0075370_10093839 | Ga0075370_100938392 | 138 |
| 560 | 3300006353 | Ga0075370_10216189 | Ga0075370_102161892 | 138 |
| 561 | 3300006353 | Ga0075370_10240800 | Ga0075370_102408002 | 138 |
| 562 | 3300006353 | Ga0075370_10377292 | Ga0075370_103772921 | 138 |
| 563 | 3300006353 | Ga0075370_10381802 | Ga0075370_103818022 | 138 |
| 564 | 3300009098 | Ga0105245_10262372 | Ga0105245_102623722 | 138 |
| 565 | 3300009148 | Ga0105243_10612929 | Ga0105243_106129292 | 138 |
| 566 | 3300013306 | Ga0163162_10151583 | Ga0163162_101515835 | 138 |
| 567 | 3300014325 | Ga0163163_10986068 | Ga0163163_109860682 | 138 |
| 568 | 3300025303 | Ga0209051_1139547 | Ga0209051_11395471 | 138 |
| 569 | 3300025929 | Ga0207664_10272145 | Ga0207664_102721452 | 138 |
| 570 | 3300025935 | Ga0207709_10025984 | Ga0207709_100259844 | 138 |
| 571 | 3300025986 | Ga0207658_11623964 | Ga0207658_116239641 | 138 |
| 572 | 3300026041 | Ga0207639_11204497 | Ga0207639_112044971 | 138 |
| 573 | 3300028380 | Ga0268265_10395609 | Ga0268265_103956091 | 138 |
| 574 | 3300035398 | Ga0316574_0282958 | Ga0316574_0282958_108_596 | 138 |
| 575 | 3300036647 | Ga0316582_0248477 | Ga0316582_0248477_33_521 | 138 |
| 576 | 3300036712 | Ga0316584_0507621 | Ga0316584_0507621_172_660 | 138 |
| 577 | 3300041410 | Ga0439461_0004147 | Ga0439461_0004147_11_427 | 138 |
| 578 | 3300041411 | Ga0439466_0001778 | Ga0439466_0001778_5483_5899 | 138 |
| 579 | 3300041491 | Ga0451833_1272580 | Ga0451833_1272580_204_623 | 138 |
| 580 | 3300041494 | Ga0451837_0069700 | Ga0451837_0069700_81_497 | 138 |
| 581 | 3300042002 | Ga0439442_019360 | Ga0439442_019360_28_444 | 138 |
| 582 | 3300042004 | Ga0439445_0013984 | Ga0439445_0013984_375_791 | 138 |
| 583 | 3300044683 | Ga0466965_0114769 | Ga0466965_0114769_108_548 | 138 |
| 584 | 3300044684 | Ga0466966_0008355 | Ga0466966_0008355_4930_5346 | 138 |
| 585 | 3300045976 | Ga0466967_0114830 | Ga0466967_0114830_172_588 | 138 |
| 586 | 3300046455 | Ga0495603_0863081 | Ga0495603_0863081_10_426 | 138 |
| 587 | 3300046616 | Ga0495668_0007547 | Ga0495668_0007547_5881_6297 | 138 |
| 588 | 3300046674 | Ga0495588_0059007 | Ga0495588_0059007_1160_1576 | 138 |
| 589 | 3300047315 | Ga0495581_0033746 | Ga0495581_0033746_234_650 | 138 |
| 590 | 3300047472 | Ga0495686_0430597 | Ga0495686_0430597_30_446 | 138 |
| 591 | 3300048903 | Ga0496100_0136503 | Ga0496100_0136503_734_1159 | 138 |
| 592 | 3300048904 | Ga0496101_0135681 | Ga0496101_0135681_674_1099 | 138 |
| 593 | 3300048904 | Ga0496101_0372075 | Ga0496101_0372075_346_762 | 138 |
| 594 | 3300048905 | Ga0496102_0263926 | Ga0496102_0263926_307_732 | 138 |
| 595 | 3300048907 | Ga0496104_0803690 | Ga0496104_0803690_412_837 | 138 |
| 596 | 3300048908 | Ga0496105_1047657 | Ga0496105_1047657_108_533 | 138 |
| 597 | 3300048911 | Ga0496108_0312947 | Ga0496108_0312947_11_427 | 138 |
| 598 | 3300048911 | Ga0496108_0595288 | Ga0496108_0595288_32_448 | 138 |
| 599 | 3300048912 | Ga0496109_1663013 | Ga0496109_1663013_144_560 | 138 |
| 600 | 3300048915 | Ga0496112_0740246 | Ga0496112_0740246_293_709 | 138 |
| 601 | 3300048916 | Ga0496113_0773204 | Ga0496113_0773204_102_518 | 138 |
| 602 | 3300048917 | Ga0496114_0153368 | Ga0496114_0153368_822_1247 | 138 |
| 603 | 3300048928 | Ga0496125_0164138 | Ga0496125_0164138_936_1352 | 138 |
| 604 | 3300048928 | Ga0496125_0370668 | Ga0496125_0370668_246_662 | 138 |
| 605 | 3300048929 | Ga0496126_0268113 | Ga0496126_0268113_908_1324 | 138 |
| 606 | 3300049579 | Ga0501043_0110085 | Ga0501043_0110085_1079_1495 | 138 |
| 607 | 3300049823 | Ga0501044_0013430 | Ga0501044_0013430_7743_8159 | 138 |
| 608 | 3300050489 | nmdc:mga03683_364764_c1 | nmdc:mga03683_364764_c1_12_428 | 138 |
| 609 | 3300050490 | nmdc:mga03n38_11224_c1 | nmdc:mga03n38_11224_c1_1304_1720 | 138 |
| 610 | 3300050490 | nmdc:mga03n38_48064_c1 | nmdc:mga03n38_48064_c1_203_622 | 138 |
| 611 | 3300050490 | nmdc:mga03n38_77273_c1 | nmdc:mga03n38_77273_c1_912_1328 | 138 |
| 612 | 3300050491 | nmdc:mga00v17_190852_c1 | nmdc:mga00v17_190852_c1_477_893 | 138 |
| 613 | 3300050491 | nmdc:mga00v17_460184_c1 | nmdc:mga00v17_460184_c1_56_472 | 138 |
| 614 | 3300050491 | nmdc:mga00v17_53005_c1 | nmdc:mga00v17_53005_c1_1819_2235 | 138 |
| 615 | 3300050491 | nmdc:mga00v17_61672_c1 | nmdc:mga00v17_61672_c1_851_1267 | 138 |
| 616 | 3300050496 | nmdc:mga07m45_123740_c1 | nmdc:mga07m45_123740_c1_410_826 | 138 |
| 617 | 3300050496 | nmdc:mga07m45_260086_c1 | nmdc:mga07m45_260086_c1_80_496 | 138 |
| 618 | 3300050496 | nmdc:mga07m45_283097_c1 | nmdc:mga07m45_283097_c1_263_679 | 138 |
| 619 | 3300050496 | nmdc:mga07m45_44871_c2 | nmdc:mga07m45_44871_c2_223_642 | 138 |
| 620 | 3300050496 | nmdc:mga07m45_457590_c1 | nmdc:mga07m45_457590_c1_102_518 | 138 |
| 621 | 3300050516 | nmdc:mga0sz30_108042_c1 | nmdc:mga0sz30_108042_c1_466_882 | 138 |
| 622 | 3300053080 | Ga0500635_0039739 | Ga0500635_0039739_472_888 | 138 |
| 623 | 3300053134 | Ga0500658_0103913 | Ga0500658_0103913_394_810 | 138 |
| 624 | 3300053139 | Ga0500568_0114134 | Ga0500568_0114134_458_874 | 138 |
| 625 | 3300053153 | Ga0500616_0008769 | Ga0500616_0008769_1090_1515 | 138 |
| 626 | 3300053154 | Ga0500619_218284 | Ga0500619_218284_45_461 | 138 |
| 627 | 3300053730 | Ga0500645_000163 | Ga0500645_000163_33464_33880 | 138 |
| 628 | iso_pu_bacteria | 2738541308 | 2738887912 | 138 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5dbk-assembly1.cif.gz_B | apo form of the quorum sensor nprr from b. thuringiensis | 0.857 | 42 | 121 |
| 3r9a-assembly1.cif.gz_B | human alanine-glyoxylate aminotransferase in complex with the tpr domain of human pex5p | 0.8394 | 31 | 119 |
| 7msn-assembly1.cif.gz_B | suns glycosin s-glycosyltransferase | 0.8064 | 31 | 124 |
| 8dtg-assembly1.cif.gz_A | cryo-em structure of arabidopsis spy alternative conformation 1 | 0.8025 | 31 | 136 |
| 8dth-assembly1.cif.gz_B | cryo-em structure of arabidopsis spy alternative conformation 2 | 0.799 | 31 | 136 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_O06310_16_142_1.10.3450.10 | Mainly Alpha;Orthogonal Bundle;Hyaluronidase domain-like;TTHA0068-like | 1 | 8 | 132 | 1.10.3450.10 |
| af_O06310_16_142_1.10.3450.10 | Mainly Alpha;Orthogonal Bundle;Hyaluronidase domain-like;TTHA0068-like | 0.9769 | 8 | 132 | 1.10.3450.10 |
| af_Q55DC8_22_207_1.25.40.10 | Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain | 0.9226 | 42 | 121 | 1.25.40.10 |
| af_I1KQK6_459_574_1.25.40.10 | Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain | 0.9165 | 31 | 121 | 1.25.40.10 |
| 4gyyC01 | Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain | 0.8803 | 31 | 129 | 1.25.40.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3D2VMA9-F1-model_v4 | DUF3151 domain-containing protein | 0.9982 | 10 | 134 |
|
| AF-A0A6G3X8B8-F1-model_v4 | DUF3151 domain-containing protein | 0.9971 | 9 | 101 |
|
| AF-A0A3G8JTH1-F1-model_v4 | DUF3151 domain-containing protein | 0.9949 | 14 | 137 |
|
| AF-K5B9H0-F1-model_v4 | Uncharacterized protein | 0.9948 | 4 | 137 |
|
| AF-A0A542NXM4-F1-model_v4 | deleted | 0.9947 | 4 | 137 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar