F470632

General Info

Members Datasets Scaffolds Average Seq Length
628 322 597 137

Family's Representative Sequence

Representative Sequence 3300006178|Ga0075367_10434599|Ga0075367_104345992
Length 129
Sequence MGDLLGPDPVLLPGDPAAEAELAASENPSIVAAAHPSASVAWAALAEKAVTAYAYARTGYHRGLDQLRRNGWKGFGPVPFNHQPNRGFLRCVAALAKAADTIGETDEYQRCLDLLDDCDPAARAELGLT

Samples

Sample ID Description Type Environment
1 2565956761 Rhodococcus qingshengii BKS 20-40 Isolate Rhizosphere
2 2643221715 Mycobacterium sp. Root265 Isolate Unclassified
3 2738541308 Rhodococcus sp. OK551 Isolate Unclassified
4 2738541356 Mycobacterium sp. OK887 Isolate Unclassified
5 2738543005 Rhodococcus sp. OK519 Isolate Unclassified
6 2738543011 Rhodococcus sp. OK611 Isolate Unclassified
7 2738543034 Rhodococcus sp. OK269 Isolate Unclassified
8 2751185725 Microbispora sp. NRRL B-24597 Isolate Unclassified
9 2751185792 Kitasatospora arboriphila NRRL B-24581 Isolate Unclassified
10 2816332139 Pseudonocardia kunmingensis DSM 45301 Isolate Unclassified
11 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
12 2889300758 Rhodococcus sp. PvR099 Isolate Rhizosphere
13 2902792274 Mycolicibacterium sp. P9-64 Isolate Unclassified
14 2902799365 Mycolicibacterium sp. P1-5 Isolate Unclassified
15 2904535858 Rhodococcus erythropolis 2017 Isolate Unclassified
16 2904765812 Rhodococcus fascians 1590 Isolate Rhizosphere
17 2904770941 Rhodococcus fascians 1339 Isolate Rhizosphere
18 2908811453 Rhodococcus sp. 1R11 Isolate Unclassified
19 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
20 2919420072 Rhodococcus fascians 3241 Isolate Rhizosphere
21 2919432681 Rhodococcus sp. 3258 Isolate Rhizosphere
22 2922554459 Rhodococcus sp. 66b Isolate Unclassified
23 2928142448 Prescottella equi DPS 2018 Isolate Unclassified
24 2929212328 Mycolicibacterium sp. R-73050 Hybrid assembly Isolate Unclassified
25 2932398195 Dietzia sp. 2505 Isolate Rhizosphere
26 2939582691 Mycolicibacterium sp. 624 Isolate Rhizosphere
27 2939743619 Rhodococcus sp. PvR044 Isolate Rhizosphere
28 2956939328 Lolliginicoccus suaedae LNNU 331112 Isolate Rhizosphere
29 2984523437 Rhodococcus sp. SORGH_AS303 Isolate Aerial Root
30 3001119090 Lolliginicoccus lacisalsi G463 Isolate Rhizosphere
31 3006486233 Streptomyces sp. BR123 Isolate Rhizosphere
32 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
33 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
34 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
35 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
36 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
37 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
38 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
39 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
40 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
41 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
42 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
43 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
44 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
45 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
46 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
47 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
48 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
49 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
50 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
51 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
52 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
53 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
54 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
55 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
56 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
57 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
58 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
59 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
60 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
61 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
62 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
63 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
64 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
65 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
66 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
67 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
68 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
69 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
70 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
71 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
72 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
73 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
74 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
75 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
76 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
77 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
78 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
79 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
80 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
81 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
82 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
83 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
84 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
85 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
86 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
87 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
88 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
89 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
90 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
91 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
92 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
93 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
94 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
95 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
96 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
97 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
98 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
99 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
100 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
101 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
102 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
103 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
104 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
105 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
106 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
107 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
108 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
109 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
110 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
111 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
112 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
113 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
114 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
115 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
116 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
117 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
118 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
119 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
120 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
121 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
122 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
123 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
124 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
125 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
126 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
127 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
128 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
129 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
130 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
131 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
132 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
133 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
134 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
135 3300009993 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG Metagenome Rhizosphere
136 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
137 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
138 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
139 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
140 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
141 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
142 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
143 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
144 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
145 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
146 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
147 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
148 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
149 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
150 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
151 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
152 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
153 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
154 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
155 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
218 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
219 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
220 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
221 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
222 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
223 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
224 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
225 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
226 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
227 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
228 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
229 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
230 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
231 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
232 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
233 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
234 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
235 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
236 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
237 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
238 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
239 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
240 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
241 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
242 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
243 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
244 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
245 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
246 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
247 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
248 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
249 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
250 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
251 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
252 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
253 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
254 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
255 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
256 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
257 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
258 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
259 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
260 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
261 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
262 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
263 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
264 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
265 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
266 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
267 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
268 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
269 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
270 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
271 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
272 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
273 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
274 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
275 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
276 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
277 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
278 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
279 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
280 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
281 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
282 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
283 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
284 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
285 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
286 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
287 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
288 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
289 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
290 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
291 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
292 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
293 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
294 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
295 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
296 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
297 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
298 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
299 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
300 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
301 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
302 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
303 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
304 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
305 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
306 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
307 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
308 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
309 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
310 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
311 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
312 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
313 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
314 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
315 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
316 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
317 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
318 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
319 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
320 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
321 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
322 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.9
Metatranscriptomes 0.16
Isolates 4.94

Biome Distribution

Category Percentage (%)
Aerial Root 0.16
Bulb 0
Endosphere 7.17
Nodule 0
Rhizoplane 10.35
Rhizosphere 77.07
Stem 0
Stem Tuber 0
Unclassified 5.25

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10042173 3300001989 Bacteria 1514
2 JGI24743J22301_10018902 3300001991 Bacteria 1305
3 JGI24735J21928_10106489 3300002067 Bacteria 806
4 JGI24735J21928_10224958 3300002067 Bacteria 545
5 JGI24750J21931_1011933 3300002070 Bacteria 1147
6 JGI24745J21846_1014878 3300002073 Bacteria 900
7 JGI24738J21930_10014628 3300002075 Bacteria 1681
8 JGI24749J21850_1001138 3300002076 Bacteria 3772
9 JGI24744J21845_10004535 3300002077 Bacteria 2870
10 JGI24034J26672_10007250 3300002239 Bacteria 1608
11 JGI24742J22300_10004587 3300002244 Bacteria 2265
12 Ga0070658_10745375 3300005327 Bacteria 850
13 Ga0070658_11960984 3300005327 Bacteria 505
14 Ga0070676_10003302 3300005328 Bacteria 8384
15 Ga0070683_100254556 3300005329 Bacteria 1670
16 Ga0070683_101099834 3300005329 Bacteria 763
17 Ga0070683_101561657 3300005329 Bacteria 634
18 Ga0070683_101576162 3300005329 Bacteria 631
19 Ga0070670_100984562 3300005331 Bacteria 766
20 Ga0070677_10358996 3300005333 Bacteria 757
21 Ga0068869_100006214 3300005334 Bacteria 7562
22 Ga0068869_100070150 3300005334 Bacteria 2592
23 Ga0068869_100258751 3300005334 Bacteria 1393
24 Ga0070666_10107736 3300005335 Bacteria 1925
25 Ga0070680_100216831 3300005336 Bacteria 1615
26 Ga0070682_100195266 3300005337 Bacteria 1424
27 Ga0070682_100304149 3300005337 Bacteria 1171
28 Ga0070682_100307199 3300005337 Bacteria 1166
29 Ga0070682_100948114 3300005337 Bacteria 710
30 Ga0068868_100000598 3300005338 Bacteria 24261
31 Ga0068868_100124807 3300005338 Bacteria 2102
32 Ga0068868_100808185 3300005338 Bacteria 846
33 Ga0070660_100798772 3300005339 Bacteria 793
34 Ga0070689_100335966 3300005340 Bacteria 1265
35 Ga0070691_10012130 3300005341 Bacteria 3947
36 Ga0070691_10236000 3300005341 Bacteria 975
37 Ga0070687_100149690 3300005343 Bacteria 1369
38 Ga0070661_100961635 3300005344 Bacteria 707
39 Ga0070692_10070532 3300005345 Bacteria 1861
40 Ga0070692_10557888 3300005345 Bacteria 751
41 Ga0070668_100005926 3300005347 Bacteria 9058
42 Ga0070668_100011482 3300005347 Bacteria 6594
43 Ga0070668_100346901 3300005347 Bacteria 1255
44 Ga0070668_100673881 3300005347 Bacteria 910
45 Ga0070669_100006306 3300005353 Bacteria 8550
46 Ga0070675_100429213 3300005354 Bacteria 1183
47 Ga0070671_100158444 3300005355 Bacteria 1913
48 Ga0070674_100001268 3300005356 Bacteria 13286
49 Ga0070674_100233831 3300005356 Bacteria 1436
50 Ga0070674_101700217 3300005356 Bacteria 571
51 Ga0070673_100487354 3300005364 Bacteria 1114
52 Ga0070688_100013586 3300005365 Bacteria 4597
53 Ga0070688_100222984 3300005365 Bacteria 1329
54 Ga0070659_100033509 3300005366 Bacteria 3989
55 Ga0070659_100061193 3300005366 Bacteria 2975
56 Ga0070659_101086965 3300005366 Bacteria 704
57 Ga0070667_100001266 3300005367 Bacteria 22917
58 Ga0070667_100163160 3300005367 Bacteria 1964
59 Ga0070714_100272375 3300005435 Bacteria 1570
60 Ga0070713_100572270 3300005436 Bacteria 1071
61 Ga0070710_10002134 3300005437 Bacteria 9377
62 Ga0070701_10001535 3300005438 Bacteria 8559
63 Ga0070711_100000399 3300005439 Bacteria 22400
64 Ga0070711_101058326 3300005439 Bacteria 698
65 Ga0070700_100023189 3300005441 Bacteria 3628
66 Ga0070700_100041790 3300005441 Bacteria 2812
67 Ga0070700_100088501 3300005441 Bacteria 2015
68 Ga0070700_100417693 3300005441 Bacteria 1013
69 Ga0070694_100071304 3300005444 Bacteria 2395
70 Ga0070694_100470033 3300005444 Bacteria 996
71 Ga0070708_100308638 3300005445 Bacteria 1490
72 Ga0070663_100000824 3300005455 Bacteria 16823
73 Ga0070663_100362238 3300005455 Bacteria 1176
74 Ga0070663_100523620 3300005455 Bacteria 987
75 Ga0070663_100866778 3300005455 Bacteria 778
76 Ga0070678_100009847 3300005456 Bacteria 5810
77 Ga0070678_100335327 3300005456 Bacteria 1295
78 Ga0070678_100438145 3300005456 Bacteria 1142
79 Ga0070678_100582178 3300005456 Bacteria 997
80 Ga0070678_100645077 3300005456 Bacteria 949
81 Ga0070678_101818482 3300005456 Bacteria 574
82 Ga0070662_100001067 3300005457 Bacteria 16714
83 Ga0070662_101592891 3300005457 Bacteria 563
84 Ga0070662_101986619 3300005457 Bacteria 502
85 Ga0070681_10526997 3300005458 Bacteria 1095
86 Ga0070681_10707306 3300005458 Bacteria 923
87 Ga0068867_100031064 3300005459 Bacteria 3855
88 Ga0068867_100198536 3300005459 Bacteria 1605
89 Ga0068867_101780083 3300005459 Bacteria 579
90 Ga0070685_10145206 3300005466 Bacteria 1498
91 Ga0070685_10164305 3300005466 Bacteria 1417
92 Ga0070685_10572054 3300005466 Bacteria 809
93 Ga0070679_100189091 3300005530 Bacteria 2029
94 Ga0070684_100109176 3300005535 Bacteria 2479
95 Ga0070684_100274728 3300005535 Bacteria 1543
96 Ga0070684_100759175 3300005535 Bacteria 906
97 Ga0068853_100001822 3300005539 Bacteria 15671
98 Ga0068853_100431796 3300005539 Bacteria 1237
99 Ga0070672_100339154 3300005543 Bacteria 1280
100 Ga0070672_100359812 3300005543 Bacteria 1242
101 Ga0070672_100456824 3300005543 Bacteria 1101
102 Ga0070686_100434292 3300005544 Bacteria 1006
103 Ga0070696_100003604 3300005546 Bacteria 10311
104 Ga0070696_100292558 3300005546 Bacteria 1245
105 Ga0070693_100014542 3300005547 Bacteria 4035
106 Ga0070693_100564533 3300005547 Bacteria 817
107 Ga0070665_100138784 3300005548 Bacteria 2434
108 Ga0070665_100277616 3300005548 Bacteria 1677
109 Ga0070665_100298116 3300005548 Bacteria 1615
110 Ga0070665_101846542 3300005548 Bacteria 610
111 Ga0070704_100000142 3300005549 Bacteria 27154
112 Ga0068855_100013561 3300005563 Bacteria 9830
113 Ga0068855_100214605 3300005563 Bacteria 2161
114 Ga0068855_102095093 3300005563 Bacteria 570
115 Ga0070664_100121064 3300005564 Bacteria 2291
116 Ga0070664_100763667 3300005564 Bacteria 903
117 Ga0068857_100498657 3300005577 Bacteria 1142
118 Ga0068854_100000132 3300005578 Bacteria 51381
119 Ga0068856_100082414 3300005614 Bacteria 3192
120 Ga0068856_100228963 3300005614 Bacteria 1874
121 Ga0068856_100302742 3300005614 Bacteria 1616
122 Ga0070702_100000433 3300005615 Bacteria 14899
123 Ga0070702_100567380 3300005615 Bacteria 845
124 Ga0070702_101735431 3300005615 Bacteria 520
125 Ga0068852_100041014 3300005616 Bacteria 3909
126 Ga0068852_100166125 3300005616 Bacteria 2065
127 Ga0068852_100344989 3300005616 Bacteria 1452
128 Ga0068859_100072721 3300005617 Bacteria 3475
129 Ga0068859_101375111 3300005617 Bacteria 778
130 Ga0068864_100063256 3300005618 Bacteria 3207
131 Ga0068864_100245745 3300005618 Bacteria 1659
132 Ga0068864_100861423 3300005618 Bacteria 893
133 Ga0068866_10000146 3300005718 Bacteria 31984
134 Ga0068866_10396827 3300005718 Bacteria 889
135 Ga0068861_100000573 3300005719 Bacteria 21796
136 Ga0068861_100066848 3300005719 Bacteria 2772
137 Ga0068861_100095142 3300005719 Bacteria 2358
138 Ga0068870_10030119 3300005840 Bacteria 2741
139 Ga0068870_10205280 3300005840 Bacteria 1197
140 Ga0068870_10845891 3300005840 Bacteria 642
141 Ga0068863_100239522 3300005841 Bacteria 1751
142 Ga0068858_100001434 3300005842 Bacteria 24529
143 Ga0068858_100057285 3300005842 Bacteria 3601
144 Ga0068858_100357762 3300005842 Bacteria 1399
145 Ga0068860_100000994 3300005843 Bacteria 31355
146 Ga0068860_100293233 3300005843 Bacteria 1592
147 Ga0068862_100001311 3300005844 Bacteria 23156
148 Ga0068862_100286425 3300005844 Bacteria 1511
149 Ga0068862_100632906 3300005844 Bacteria 1030
150 Ga0081538_10238705 3300005981 Bacteria 703
151 Ga0070717_10263979 3300006028 Bacteria 1524
152 Ga0070717_11068368 3300006028 Bacteria 735
153 Ga0070717_12160107 3300006028 Bacteria 500
154 Ga0075365_10346689 3300006038 Bacteria 1047
155 Ga0075363_100054745 3300006048 Bacteria 2135
156 Ga0075363_100259503 3300006048 Bacteria 1002
157 Ga0075363_100325804 3300006048 Bacteria 894
158 Ga0075363_100363698 3300006048 Bacteria 846
159 Ga0075363_100515004 3300006048 Bacteria 711
160 Ga0075364_10009617 3300006051 Bacteria 5807
161 Ga0075364_10231945 3300006051 Bacteria 1253
162 Ga0075432_10530079 3300006058 Bacteria 529
163 Ga0070715_10026657 3300006163 Bacteria 2301
164 Ga0070716_100009665 3300006173 Bacteria 4812
165 Ga0070716_100275711 3300006173 Bacteria 1158
166 Ga0070712_100001186 3300006175 Bacteria 15742
167 Ga0070712_100185238 3300006175 Bacteria 1625
168 Ga0075362_10061322 3300006177 Bacteria 1702
169 Ga0075367_10434599 3300006178 Bacteria 831
170 Ga0075369_10004548 3300006186 Bacteria 5134
171 Ga0097621_102051118 3300006237 Bacteria 546
172 Ga0075370_10093839 3300006353 Bacteria 1732
173 Ga0075370_10216189 3300006353 Bacteria 1132
174 Ga0075370_10240800 3300006353 Bacteria 1071
175 Ga0075370_10377292 3300006353 Bacteria 849
176 Ga0075370_10381802 3300006353 Bacteria 844
177 Ga0068871_100039359 3300006358 Bacteria 3783
178 Ga0068871_100450437 3300006358 Bacteria 1153
179 Ga0075431_101062825 3300006847 Bacteria 775
180 Ga0068865_100012460 3300006881 Bacteria 5352
181 Ga0068865_100345252 3300006881 Bacteria 1204
182 Ga0068865_101001626 3300006881 Bacteria 732
183 Ga0097620_100072714 3300006931 Bacteria 3475
184 Ga0097620_101375069 3300006931 Bacteria 778
185 Ga0105240_10511999 3300009093 Bacteria 1333
186 Ga0111539_10307347 3300009094 Bacteria 1845
187 Ga0105245_10019281 3300009098 Bacteria 5972
188 Ga0105245_10142444 3300009098 Bacteria 2259
189 Ga0105245_10262372 3300009098 Bacteria 1682
190 Ga0105245_10528998 3300009098 Bacteria 1198
191 Ga0105247_10000186 3300009101 Bacteria 60603
192 Ga0105247_10022867 3300009101 Bacteria 3766
193 Ga0105247_11283111 3300009101 Bacteria 587
194 Ga0105243_10042425 3300009148 Bacteria 3561
195 Ga0105243_10076509 3300009148 Bacteria 2719
196 Ga0105243_10115903 3300009148 Bacteria 2250
197 Ga0105243_10341808 3300009148 Bacteria 1371
198 Ga0105243_10423136 3300009148 Bacteria 1243
199 Ga0105243_10612929 3300009148 Bacteria 1049
200 Ga0105243_11752511 3300009148 Bacteria 651
201 Ga0105241_10161928 3300009174 Bacteria 1840
202 Ga0105241_11160796 3300009174 Bacteria 730
203 Ga0105242_10000731 3300009176 Bacteria 25618
204 Ga0105242_11296302 3300009176 Bacteria 752
205 Ga0105248_10004274 3300009177 Bacteria 15808
206 Ga0105248_10047837 3300009177 Bacteria 4797
207 Ga0105237_10011100 3300009545 Bacteria 9548
208 Ga0105237_10178722 3300009545 Bacteria 2122
209 Ga0105237_10953395 3300009545 Bacteria 865
210 Ga0105238_10354713 3300009551 Bacteria 1456
211 Ga0105238_10815157 3300009551 Bacteria 949
212 Ga0105249_10016009 3300009553 Bacteria 6646
213 Ga0105249_10107042 3300009553 Bacteria 2638
214 Ga0105249_12674214 3300009553 Bacteria 571
215 Ga0105028_109213 3300009993 Bacteria 1034
216 Ga0105239_10112590 3300010375 Bacteria 3017
217 Ga0105239_10115948 3300010375 Bacteria 2972
218 Ga0105239_10150126 3300010375 Bacteria 2601
219 Ga0105239_10305173 3300010375 Bacteria 1793
220 Ga0105239_10963053 3300010375 Bacteria 980
221 Ga0105246_10392896 3300011119 Bacteria 1150
222 Ga0105246_11160707 3300011119 Bacteria 709
223 Ga0157371_10240060 3300013102 Bacteria 1303
224 Ga0157371_10497114 3300013102 Bacteria 900
225 Ga0157370_10310101 3300013104 Bacteria 1456
226 Ga0157369_10128133 3300013105 Bacteria 2690
227 Ga0157369_10200934 3300013105 Bacteria 2092
228 Ga0157374_10057709 3300013296 Bacteria 3626
229 Ga0157374_10074957 3300013296 Bacteria 3197
230 Ga0157374_10336331 3300013296 Bacteria 1498
231 Ga0157378_10019603 3300013297 Bacteria 5945
232 Ga0157378_10261854 3300013297 Bacteria 1660
233 Ga0163162_10015890 3300013306 Bacteria 7356
234 Ga0163162_10151583 3300013306 Bacteria 2436
235 Ga0157372_10421476 3300013307 Bacteria 1556
236 Ga0157372_11505648 3300013307 Bacteria 775
237 Ga0157375_10027086 3300013308 Bacteria 5354
238 Ga0157375_10180507 3300013308 Bacteria 2262
239 Ga0157375_10280643 3300013308 Bacteria 1829
240 Ga0157375_10489831 3300013308 Bacteria 1394
241 Ga0157375_11301788 3300013308 Bacteria 854
242 Ga0157375_13599876 3300013308 Bacteria 515
243 Ga0163163_10283008 3300014325 Bacteria 1710
244 Ga0163163_10986068 3300014325 Bacteria 906
245 Ga0157380_10002376 3300014326 Bacteria 12644
246 Ga0157380_10446030 3300014326 Bacteria 1241
247 Ga0157380_11692201 3300014326 Bacteria 690
248 Ga0182008_10119269 3300014497 Bacteria 1310
249 Ga0157377_10266987 3300014745 Bacteria 1116
250 Ga0157377_10566145 3300014745 Bacteria 805
251 Ga0157377_10960479 3300014745 Bacteria 644
252 Ga0157379_10000419 3300014968 Bacteria 34325
253 Ga0157379_10254416 3300014968 Bacteria 1595
254 Ga0157376_10130616 3300014969 Bacteria 2241
255 Ga0157376_10165081 3300014969 Bacteria 2011
256 Ga0163161_10001582 3300017792 Bacteria 16779
257 Ga0163161_10160882 3300017792 Bacteria 1712
258 Ga0163161_10298168 3300017792 Bacteria 1269
259 Ga0206354_11658198 3300020081 Bacteria 508
260 Ga0209051_1139547 3300025303 Bacteria 585
261 Ga0207656_10312248 3300025321 Bacteria 780
262 Ga0207692_10003683 3300025898 Bacteria 6008
263 Ga0207642_10000332 3300025899 Bacteria 14184
264 Ga0207642_10255211 3300025899 Bacteria 997
265 Ga0207710_10006318 3300025900 Bacteria 5067
266 Ga0207710_10321888 3300025900 Bacteria 784
267 Ga0207688_10004409 3300025901 Bacteria 7658
268 Ga0207688_10033488 3300025901 Bacteria 2843
269 Ga0207688_10066672 3300025901 Bacteria 2036
270 Ga0207688_10186490 3300025901 Bacteria 1239
271 Ga0207680_10123326 3300025903 Bacteria 1697
272 Ga0207685_10001049 3300025905 Bacteria 5426
273 Ga0207645_10046073 3300025907 Bacteria 2786
274 Ga0207643_10015756 3300025908 Bacteria 4117
275 Ga0207705_10580038 3300025909 Bacteria 872
276 Ga0207705_10761541 3300025909 Bacteria 752
277 Ga0207654_10763276 3300025911 Bacteria 697
278 Ga0207707_10597003 3300025912 Bacteria 935
279 Ga0207695_10622179 3300025913 Bacteria 961
280 Ga0207671_10032443 3300025914 Bacteria 3888
281 Ga0207671_10077323 3300025914 Bacteria 2491
282 Ga0207671_10415195 3300025914 Bacteria 1071
283 Ga0207693_10000172 3300025915 Bacteria 58877
284 Ga0207693_10235235 3300025915 Bacteria 1439
285 Ga0207663_10001208 3300025916 Bacteria 11932
286 Ga0207663_11168287 3300025916 Bacteria 619
287 Ga0207660_10182840 3300025917 Bacteria 1629
288 Ga0207662_10155727 3300025918 Bacteria 1456
289 Ga0207657_10076906 3300025919 Bacteria 2815
290 Ga0207657_10184341 3300025919 Bacteria 1686
291 Ga0207657_10399323 3300025919 Bacteria 1081
292 Ga0207657_10518229 3300025919 Bacteria 933
293 Ga0207649_10735390 3300025920 Bacteria 767
294 Ga0207652_10356240 3300025921 Bacteria 1321
295 Ga0207652_10376906 3300025921 Bacteria 1281
296 Ga0207652_10743014 3300025921 Bacteria 873
297 Ga0207681_10014848 3300025923 Bacteria 4850
298 Ga0207694_10275939 3300025924 Bacteria 1380
299 Ga0207694_10905040 3300025924 Bacteria 746
300 Ga0207650_10137217 3300025925 Bacteria 1920
301 Ga0207659_11341581 3300025926 Bacteria 614
302 Ga0207687_10004141 3300025927 Bacteria 9717
303 Ga0207687_10030832 3300025927 Bacteria 3619
304 Ga0207687_10245951 3300025927 Bacteria 1420
305 Ga0207687_11194169 3300025927 Bacteria 654
306 Ga0207664_10272145 3300025929 Bacteria 1484
307 Ga0207664_10381193 3300025929 Bacteria 1252
308 Ga0207664_10876566 3300025929 Bacteria 806
309 Ga0207644_10052303 3300025931 Bacteria 2935
310 Ga0207644_10245025 3300025931 Bacteria 1428
311 Ga0207690_10049980 3300025932 Bacteria 2789
312 Ga0207690_10227839 3300025932 Bacteria 1429
313 Ga0207690_11635698 3300025932 Bacteria 538
314 Ga0207706_10054685 3300025933 Bacteria 3522
315 Ga0207706_10100218 3300025933 Bacteria 2548
316 Ga0207706_11112174 3300025933 Bacteria 660
317 Ga0207686_10058000 3300025934 Bacteria 2439
318 Ga0207709_10003310 3300025935 Bacteria 9654
319 Ga0207709_10025984 3300025935 Bacteria 3359
320 Ga0207709_10110554 3300025935 Bacteria 1836
321 Ga0207709_10317073 3300025935 Bacteria 1165
322 Ga0207709_11062432 3300025935 Bacteria 664
323 Ga0207670_10469425 3300025936 Bacteria 1017
324 Ga0207669_10000124 3300025937 Bacteria 38397
325 Ga0207669_10145933 3300025937 Bacteria 1650
326 Ga0207704_10004389 3300025938 Bacteria 6453
327 Ga0207704_10225033 3300025938 Bacteria 1391
328 Ga0207704_10234468 3300025938 Bacteria 1367
329 Ga0207665_10026800 3300025939 Bacteria 3806
330 Ga0207665_10088162 3300025939 Bacteria 2146
331 Ga0207691_10085377 3300025940 Bacteria 2833
332 Ga0207691_10120971 3300025940 Bacteria 2320
333 Ga0207711_10173891 3300025941 Bacteria 1955
334 Ga0207689_10024871 3300025942 Bacteria 5020
335 Ga0207689_10290241 3300025942 Bacteria 1355
336 Ga0207689_10464069 3300025942 Bacteria 1059
337 Ga0207679_10076351 3300025945 Bacteria 2545
338 Ga0207667_10065657 3300025949 Bacteria 3784
339 Ga0207667_11559511 3300025949 Bacteria 630
340 Ga0207651_10141206 3300025960 Bacteria 1861
341 Ga0207712_10030188 3300025961 Bacteria 3642
342 Ga0207712_10075694 3300025961 Bacteria 2434
343 Ga0207668_10001759 3300025972 Bacteria 12659
344 Ga0207668_10002901 3300025972 Bacteria 10061
345 Ga0207668_10240598 3300025972 Bacteria 1464
346 Ga0207668_10279205 3300025972 Bacteria 1369
347 Ga0207668_10346901 3300025972 Bacteria 1240
348 Ga0207640_10001238 3300025981 Bacteria 13910
349 Ga0207658_10004718 3300025986 Bacteria 9440
350 Ga0207658_10558132 3300025986 Bacteria 1025
351 Ga0207658_11085558 3300025986 Bacteria 731
352 Ga0207658_11623964 3300025986 Bacteria 591
353 Ga0207677_10129767 3300026023 Bacteria 1911
354 Ga0207677_10740620 3300026023 Bacteria 875
355 Ga0207677_11022953 3300026023 Bacteria 750
356 Ga0207703_10016310 3300026035 Bacteria 5791
357 Ga0207703_10069667 3300026035 Bacteria 2901
358 Ga0207703_10275600 3300026035 Bacteria 1526
359 Ga0207703_10321258 3300026035 Bacteria 1418
360 Ga0207703_11006815 3300026035 Bacteria 799
361 Ga0207639_10023258 3300026041 Bacteria 4474
362 Ga0207639_10109132 3300026041 Bacteria 2251
363 Ga0207639_11204497 3300026041 Bacteria 711
364 Ga0207639_11597208 3300026041 Bacteria 612
365 Ga0207678_10007789 3300026067 Bacteria 9463
366 Ga0207678_10055806 3300026067 Bacteria 3402
367 Ga0207678_10491006 3300026067 Bacteria 1070
368 Ga0207678_10749006 3300026067 Bacteria 861
369 Ga0207708_10002732 3300026075 Bacteria 12963
370 Ga0207708_10053197 3300026075 Bacteria 3084
371 Ga0207708_10701128 3300026075 Bacteria 865
372 Ga0207702_10258063 3300026078 Bacteria 1640
373 Ga0207702_10386889 3300026078 Bacteria 1346
374 Ga0207702_10418823 3300026078 Bacteria 1295
375 Ga0207702_11090575 3300026078 Bacteria 792
376 Ga0207641_10293487 3300026088 Bacteria 1533
377 Ga0207641_10812994 3300026088 Bacteria 925
378 Ga0207648_10044350 3300026089 Bacteria 3901
379 Ga0207648_10049169 3300026089 Bacteria 3691
380 Ga0207648_12167460 3300026089 Bacteria 516
381 Ga0207676_10705026 3300026095 Bacteria 978
382 Ga0207676_11097869 3300026095 Bacteria 786
383 Ga0207674_10165726 3300026116 Bacteria 2164
384 Ga0207675_100000554 3300026118 Bacteria 36519
385 Ga0207675_100039045 3300026118 Bacteria 4431
386 Ga0207675_100102772 3300026118 Bacteria 2693
387 Ga0207683_10000486 3300026121 Bacteria 36689
388 Ga0207683_10098306 3300026121 Bacteria 2611
389 Ga0207683_10289515 3300026121 Bacteria 1498
390 Ga0207683_10423081 3300026121 Bacteria 1227
391 Ga0207683_11009015 3300026121 Bacteria 772
392 Ga0207698_10226873 3300026142 Bacteria 1692
393 Ga0207698_10424008 3300026142 Bacteria 1277
394 Ga0268266_10107036 3300028379 Bacteria 2472
395 Ga0268266_10149568 3300028379 Bacteria 2103
396 Ga0268266_10765909 3300028379 Bacteria 932
397 Ga0268266_11277518 3300028379 Bacteria 709
398 Ga0268265_10007213 3300028380 Bacteria 7511
399 Ga0268265_10085812 3300028380 Bacteria 2500
400 Ga0268265_10395609 3300028380 Bacteria 1276
401 Ga0268265_10607910 3300028380 Bacteria 1046
402 Ga0268264_10006786 3300028381 Bacteria 9617
403 Ga0268264_10792574 3300028381 Bacteria 946
404 Ga0268264_11014747 3300028381 Bacteria 837
405 Ga0307511_10196288 3300030521 Bacteria 1057
406 Ga0307513_10018498 3300031456 Bacteria 8322
407 Ga0307416_101743536 3300032002 Bacteria 727
408 Ga0373948_0077707 3300034817 Bacteria 753
409 Ga0373949_0015882 3300035090 Bacteria 1685
410 Ga0373951_0167916 3300035091 Bacteria 624
411 Ga0373941_0206154 3300035115 Bacteria 750
412 Ga0373960_0047966 3300035121 Bacteria 1258
413 Ga0373942_0235218 3300035207 Bacteria 618
414 Ga0373962_0225014 3300035242 Bacteria 643
415 Ga0316574_0282958 3300035398 Bacteria 1056
416 Ga0316574_0319711 3300035398 Bacteria 985
417 Ga0373931_0076920 3300035691 Bacteria 1834
418 Ga0316582_0248477 3300036647 Bacteria 1219
419 Ga0316584_0507621 3300036712 Bacteria 846
420 Ga0316584_0736675 3300036712 Bacteria 673
421 Ga0436365_0011767 3300039437 Bacteria 7798
422 Ga0436363_0933205 3300039450 Bacteria 847
423 Ga0439461_0004147 3300041410 Bacteria 2409
424 Ga0439466_0001778 3300041411 Bacteria 8426
425 Ga0451833_1272580 3300041491 Bacteria 673
426 Ga0451837_0069700 3300041494 Bacteria 938
427 Ga0439442_019360 3300042002 Bacteria 1408
428 Ga0439445_0013984 3300042004 Bacteria 1949
429 Ga0439457_106053 3300042014 Bacteria 657
430 Ga0439459_0020402 3300042438 Bacteria 1264
431 Ga0466972_0004922 3300044658 Bacteria 6704
432 Ga0466965_0024314 3300044683 Bacteria 2929
433 Ga0466965_0114769 3300044683 Bacteria 1387
434 Ga0466966_0008355 3300044684 Bacteria 6857
435 Ga0466961_0984763 3300044693 Bacteria 501
436 Ga0466963_0345388 3300044694 Bacteria 1048
437 Ga0466964_0043724 3300044706 Bacteria 1818
438 Ga0466964_0384833 3300044706 Bacteria 729
439 Ga0466971_0049913 3300044719 Bacteria 1883
440 Ga0466968_0002213 3300044735 Bacteria 7099
441 Ga0466968_0004456 3300044735 Bacteria 5239
442 Ga0466970_0024731 3300044765 Bacteria 3141
443 Ga0466970_0082957 3300044765 Bacteria 1734
444 Ga0466957_0016121 3300044842 Bacteria 4367
445 Ga0466957_0253836 3300044842 Bacteria 1170
446 Ga0466957_0341809 3300044842 Bacteria 1014
447 Ga0466957_0436408 3300044842 Bacteria 900
448 Ga0466960_0002339 3300044901 Bacteria 7124
449 Ga0466960_0066696 3300044901 Bacteria 1780
450 Ga0466959_0034186 3300045049 Bacteria 3761
451 Ga0466959_0367025 3300045049 Bacteria 980
452 Ga0466958_0115274 3300045836 Bacteria 1679
453 Ga0466958_0264408 3300045836 Bacteria 1101
454 Ga0466967_0013771 3300045976 Bacteria 6268
455 Ga0466967_0019262 3300045976 Bacteria 5483
456 Ga0466967_0030816 3300045976 Bacteria 4505
457 Ga0466967_0040907 3300045976 Bacteria 3993
458 Ga0466967_0114830 3300045976 Bacteria 2479
459 Ga0466967_2136082 3300045976 Bacteria 556
460 Ga0495603_0675906 3300046455 Bacteria 591
461 Ga0495603_0863081 3300046455 Bacteria 515
462 Ga0495650_0042092 3300046471 Bacteria 1948
463 Ga0495583_0009710 3300046506 Bacteria 5716
464 Ga0495606_0064739 3300046507 Bacteria 2325
465 Ga0495648_0004576 3300046524 Bacteria 11781
466 Ga0495654_0124018 3300046530 Bacteria 1166
467 Ga0495668_0007547 3300046616 Bacteria 6939
468 Ga0495668_0017605 3300046616 Bacteria 4141
469 Ga0495611_0350617 3300046648 Bacteria 677
470 Ga0495588_0059007 3300046674 Bacteria 1984
471 Ga0495671_0148330 3300046692 Bacteria 1142
472 Ga0495671_0467865 3300046692 Bacteria 602
473 Ga0495649_0420926 3300046694 Bacteria 669
474 Ga0495581_0033746 3300047315 Bacteria 2962
475 Ga0495672_0004629 3300047320 Bacteria 11167
476 Ga0495673_0001554 3300047469 Bacteria 17987
477 Ga0495686_0430597 3300047472 Bacteria 704
478 Ga0496100_0002220 3300048903 Bacteria 9806
479 Ga0496100_0003746 3300048903 Bacteria 7959
480 Ga0496100_0023748 3300048903 Bacteria 3730
481 Ga0496100_0136503 3300048903 Bacteria 1733
482 Ga0496101_0000115 3300048904 Bacteria 79334
483 Ga0496101_0002076 3300048904 Bacteria 12201
484 Ga0496101_0013674 3300048904 Bacteria 5444
485 Ga0496101_0135681 3300048904 Bacteria 1872
486 Ga0496101_0372075 3300048904 Bacteria 1124
487 Ga0496101_0583405 3300048904 Bacteria 884
488 Ga0496102_0000009 3300048905 Bacteria 344149
489 Ga0496102_0161621 3300048905 Bacteria 2107
490 Ga0496102_0163592 3300048905 Bacteria 2093
491 Ga0496102_0263926 3300048905 Bacteria 1623
492 Ga0496102_1039609 3300048905 Bacteria 739
493 Ga0496103_0000051 3300048906 Bacteria 150397
494 Ga0496103_0000694 3300048906 Bacteria 25093
495 Ga0496104_0156146 3300048907 Bacteria 2189
496 Ga0496104_0161538 3300048907 Bacteria 2149
497 Ga0496104_0209137 3300048907 Bacteria 1863
498 Ga0496104_0803690 3300048907 Bacteria 847
499 Ga0496105_0043866 3300048908 Bacteria 3688
500 Ga0496105_0317182 3300048908 Bacteria 1250
501 Ga0496105_1047657 3300048908 Bacteria 608
502 Ga0496105_1208028 3300048908 Bacteria 556
503 Ga0496105_1416987 3300048908 Bacteria 503
504 Ga0496106_0007463 3300048909 Bacteria 8081
505 Ga0496106_0030201 3300048909 Bacteria 4040
506 Ga0496106_0370685 3300048909 Bacteria 1150
507 Ga0496106_1014592 3300048909 Bacteria 652
508 Ga0496107_0002211 3300048910 Bacteria 12504
509 Ga0496107_0005423 3300048910 Bacteria 8731
510 Ga0496107_0129246 3300048910 Bacteria 1864
511 Ga0496107_0522096 3300048910 Bacteria 880
512 Ga0496108_0011728 3300048911 Bacteria 7128
513 Ga0496108_0063412 3300048911 Bacteria 3112
514 Ga0496108_0174488 3300048911 Bacteria 1860
515 Ga0496108_0312947 3300048911 Bacteria 1368
516 Ga0496108_0482030 3300048911 Bacteria 1083
517 Ga0496108_0595288 3300048911 Bacteria 964
518 Ga0496109_0013155 3300048912 Bacteria 7161
519 Ga0496109_0048342 3300048912 Bacteria 3871
520 Ga0496109_0119090 3300048912 Bacteria 2458
521 Ga0496109_0878304 3300048912 Bacteria 834
522 Ga0496109_1663013 3300048912 Bacteria 572
523 Ga0496110_0042561 3300048913 Bacteria 3964
524 Ga0496110_0310543 3300048913 Bacteria 1436
525 Ga0496110_0496499 3300048913 Bacteria 1111
526 Ga0496110_1240730 3300048913 Bacteria 654
527 Ga0496111_0041398 3300048914 Bacteria 3306
528 Ga0496111_0069410 3300048914 Bacteria 2563
529 Ga0496111_0428171 3300048914 Bacteria 977
530 Ga0496111_0921758 3300048914 Bacteria 628
531 Ga0496112_0029795 3300048915 Bacteria 5280
532 Ga0496112_0740246 3300048915 Bacteria 910
533 Ga0496113_0177215 3300048916 Bacteria 1689
534 Ga0496113_0773204 3300048916 Bacteria 764
535 Ga0496114_0000470 3300048917 Bacteria 29501
536 Ga0496114_0001282 3300048917 Bacteria 18984
537 Ga0496114_0153368 3300048917 Bacteria 1999
538 Ga0496114_0185915 3300048917 Bacteria 1816
539 Ga0496114_0575829 3300048917 Bacteria 994
540 Ga0496114_0890975 3300048917 Bacteria 771
541 Ga0496114_0969792 3300048917 Bacteria 733
542 Ga0496115_0005314 3300048918 Bacteria 9365
543 Ga0496116_0000141 3300048919 Bacteria 150405
544 Ga0496117_0000019 3300048920 Bacteria 469256
545 Ga0496118_0000020 3300048921 Bacteria 470521
546 Ga0496119_0001032 3300048922 Bacteria 35641
547 Ga0496120_0002480 3300048923 Bacteria 18572
548 Ga0496121_0000510 3300048924 Bacteria 74197
549 Ga0496125_0164138 3300048928 Bacteria 1504
550 Ga0496125_0370668 3300048928 Bacteria 847
551 Ga0496126_0001641 3300048929 Bacteria 33823
552 Ga0496126_0055657 3300048929 Bacteria 3578
553 Ga0496126_0268113 3300048929 Bacteria 1417
554 Ga0501032_0006575 3300049569 Bacteria 8535
555 Ga0501033_0111628 3300049570 Bacteria 1989
556 Ga0501034_0004273 3300049571 Bacteria 15940
557 Ga0501036_0016856 3300049572 Bacteria 6103
558 Ga0501037_0002477 3300049573 Bacteria 13336
559 Ga0501043_0002246 3300049579 Bacteria 16438
560 Ga0501043_0110085 3300049579 Bacteria 2163
561 Ga0501047_0014204 3300049581 Bacteria 7568
562 Ga0501048_0001569 3300049582 Bacteria 17372
563 Ga0501070_0001570 3300049586 Bacteria 20304
564 Ga0501073_0176539 3300049589 Bacteria 1478
565 Ga0501080_0196997 3300049742 Bacteria 1850
566 Ga0501035_0021057 3300049822 Bacteria 5994
567 Ga0501044_0004782 3300049823 Bacteria 15149
568 Ga0501044_0013430 3300049823 Bacteria 8856
569 nmdc:mga03683_364764_c1 3300050489 Bacteria 685
570 nmdc:mga03n38_11224_c1 3300050490 Bacteria 3329
571 nmdc:mga03n38_48064_c1 3300050490 Bacteria 1891
572 nmdc:mga03n38_77273_c1 3300050490 Bacteria 1555
573 nmdc:mga00v17_190852_c1 3300050491 Bacteria 1323
574 nmdc:mga00v17_460184_c1 3300050491 Bacteria 826
575 nmdc:mga00v17_53005_c1 3300050491 Bacteria 2471
576 nmdc:mga00v17_61672_c1 3300050491 Bacteria 2305
577 nmdc:mga0yw44_695815_c1 3300050492 Bacteria 690
578 nmdc:mga0yw44_701714_c1 3300050492 Bacteria 687
579 nmdc:mga0yw44_889122_c1 3300050492 Bacteria 604
580 nmdc:mga07m45_123740_c1 3300050496 Bacteria 1495
581 nmdc:mga07m45_260086_c1 3300050496 Bacteria 1010
582 nmdc:mga07m45_283097_c1 3300050496 Bacteria 964
583 nmdc:mga07m45_44871_c2 3300050496 Bacteria 1027
584 nmdc:mga07m45_457590_c1 3300050496 Bacteria 740
585 nmdc:mga0sz30_108042_c1 3300050516 Bacteria 1218
586 nmdc:mga0sz30_175055_c1 3300050516 Bacteria 951
587 Ga0500635_0039739 3300053080 Bacteria 1567
588 Ga0495655_0160238 3300053083 Bacteria 713
589 Ga0500643_007330 3300053087 Bacteria 4471
590 Ga0500628_043986 3300053129 Bacteria 1032
591 Ga0500658_0103913 3300053134 Bacteria 1243
592 Ga0500568_0114134 3300053139 Bacteria 1009
593 Ga0500616_0008769 3300053153 Bacteria 6228
594 Ga0500616_0031789 3300053153 Bacteria 2889
595 Ga0500619_218284 3300053154 Bacteria 636
596 Ga0500627_0313827 3300053158 Bacteria 682
597 Ga0500645_000163 3300053730 Bacteria 51808

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300006178 Ga0075367_10434599 Ga0075367_104345992 129
2 3300006028 Ga0070717_11068368 Ga0070717_110683682 130
3 3300005345 Ga0070692_10557888 Ga0070692_105578882 131
4 iso_pu_bacteria 2643221715 2644639058 131
5 iso_pu_bacteria 2852635781 2852639879 132
6 iso_pu_bacteria 2912723979 2912724177 132
7 3300005535 Ga0070684_100759175 Ga0070684_1007591751 133
8 3300013104 Ga0157370_10310101 Ga0157370_103101012 133
9 3300020081 Ga0206354_11658198 Ga0206354_116581981 133
10 3300025321 Ga0207656_10312248 Ga0207656_103122481 133
11 3300035398 Ga0316574_0319711 Ga0316574_0319711_264_668 133
12 3300036712 Ga0316584_0736675 Ga0316584_0736675_237_641 133
13 3300042014 Ga0439457_106053 Ga0439457_106053_229_633 133
14 3300048908 Ga0496105_1208028 Ga0496105_1208028_58_462 133
15 3300048911 Ga0496108_0063412 Ga0496108_0063412_131_535 133
16 3300048912 Ga0496109_0119090 Ga0496109_0119090_1827_2231 133
17 3300048914 Ga0496111_0041398 Ga0496111_0041398_805_1209 133
18 iso_pu_bacteria 2816332139 2816506113 133
19 iso_pu_bacteria 3006486233 3006492221 133
20 3300005329 Ga0070683_100254556 Ga0070683_1002545562 134
21 3300005334 Ga0068869_100258751 Ga0068869_1002587512 134
22 3300005337 Ga0070682_100195266 Ga0070682_1001952662 134
23 3300005341 Ga0070691_10236000 Ga0070691_102360002 134
24 3300005355 Ga0070671_100158444 Ga0070671_1001584441 134
25 3300005441 Ga0070700_100041790 Ga0070700_1000417903 134
26 3300005441 Ga0070700_100417693 Ga0070700_1004176931 134
27 3300005459 Ga0068867_101780083 Ga0068867_1017800831 134
28 3300005535 Ga0070684_100274728 Ga0070684_1002747282 134
29 3300006881 Ga0068865_100345252 Ga0068865_1003452522 134
30 3300009148 Ga0105243_10115903 Ga0105243_101159032 134
31 3300014326 Ga0157380_11692201 Ga0157380_116922012 134
32 3300025912 Ga0207707_10597003 Ga0207707_105970032 134
33 3300025935 Ga0207709_10110554 Ga0207709_101105542 134
34 3300025942 Ga0207689_10464069 Ga0207689_104640692 134
35 3300026075 Ga0207708_10701128 Ga0207708_107011282 134
36 3300026089 Ga0207648_12167460 Ga0207648_121674601 134
37 3300044694 Ga0466963_0345388 Ga0466963_0345388_245_649 134
38 3300044842 Ga0466957_0253836 Ga0466957_0253836_109_513 134
39 3300045976 Ga0466967_0019262 Ga0466967_0019262_882_1286 134
40 3300048929 Ga0496126_0055657 Ga0496126_0055657_110_526 134
41 iso_pu_bacteria 2565956761 2566991719 134
42 iso_pu_bacteria 2751185725 2753038474 134
43 iso_pu_bacteria 2751185792 2753327061 134
44 iso_pu_bacteria 2889300758 2889305256 134
45 iso_pu_bacteria 2902792274 2902794319 134
46 iso_pu_bacteria 2902799365 2902802766 134
47 iso_pu_bacteria 2904535858 2904541226 134
48 iso_pu_bacteria 2904765812 2904767834 134
49 iso_pu_bacteria 2904770941 2904774390 134
50 iso_pu_bacteria 2908811453 2908813479 134
51 iso_pu_bacteria 2919420072 2919423737 134
52 iso_pu_bacteria 2919432681 2919436345 134
53 iso_pu_bacteria 2922554459 2922560871 134
54 iso_pu_bacteria 2928142448 2928143398 134
55 iso_pu_bacteria 2929212328 2929213030 134
56 iso_pu_bacteria 2932398195 2932401813 134
57 iso_pu_bacteria 2939582691 2939587193 134
58 iso_pu_bacteria 2956939328 2956942264 134
59 iso_pu_bacteria 2984523437 2984527538 134
60 iso_pu_bacteria 3001119090 3001122013 134
61 3300001991 JGI24743J22301_10018902 JGI24743J22301_100189022 135
62 3300002067 JGI24735J21928_10106489 JGI24735J21928_101064892 135
63 3300002070 JGI24750J21931_1011933 JGI24750J21931_10119332 135
64 3300002073 JGI24745J21846_1014878 JGI24745J21846_10148782 135
65 3300002075 JGI24738J21930_10014628 JGI24738J21930_100146283 135
66 3300002076 JGI24749J21850_1001138 JGI24749J21850_10011382 135
67 3300002077 JGI24744J21845_10004535 JGI24744J21845_100045352 135
68 3300002239 JGI24034J26672_10007250 JGI24034J26672_100072502 135
69 3300002244 JGI24742J22300_10004587 JGI24742J22300_100045872 135
70 3300005328 Ga0070676_10003302 Ga0070676_100033029 135
71 3300005333 Ga0070677_10358996 Ga0070677_103589961 135
72 3300005334 Ga0068869_100006214 Ga0068869_1000062147 135
73 3300005335 Ga0070666_10107736 Ga0070666_101077363 135
74 3300005336 Ga0070680_100216831 Ga0070680_1002168312 135
75 3300005337 Ga0070682_100307199 Ga0070682_1003071992 135
76 3300005338 Ga0068868_100000598 Ga0068868_1000005987 135
77 3300005341 Ga0070691_10012130 Ga0070691_100121302 135
78 3300005353 Ga0070669_100006306 Ga0070669_1000063068 135
79 3300005356 Ga0070674_100001268 Ga0070674_10000126813 135
80 3300005365 Ga0070688_100013586 Ga0070688_1000135864 135
81 3300005366 Ga0070659_100033509 Ga0070659_1000335094 135
82 3300005436 Ga0070713_100572270 Ga0070713_1005722702 135
83 3300005437 Ga0070710_10002134 Ga0070710_100021346 135
84 3300005438 Ga0070701_10001535 Ga0070701_100015354 135
85 3300005439 Ga0070711_100000399 Ga0070711_1000003993 135
86 3300005441 Ga0070700_100023189 Ga0070700_1000231893 135
87 3300005444 Ga0070694_100071304 Ga0070694_1000713043 135
88 3300005445 Ga0070708_100308638 Ga0070708_1003086382 135
89 3300005455 Ga0070663_100000824 Ga0070663_10000082415 135
90 3300005455 Ga0070663_100866778 Ga0070663_1008667782 135
91 3300005456 Ga0070678_100009847 Ga0070678_1000098472 135
92 3300005456 Ga0070678_100438145 Ga0070678_1004381452 135
93 3300005456 Ga0070678_100645077 Ga0070678_1006450772 135
94 3300005458 Ga0070681_10526997 Ga0070681_105269971 135
95 3300005459 Ga0068867_100031064 Ga0068867_1000310645 135
96 3300005466 Ga0070685_10145206 Ga0070685_101452062 135
97 3300005466 Ga0070685_10572054 Ga0070685_105720542 135
98 3300005539 Ga0068853_100001822 Ga0068853_10000182215 135
99 3300005543 Ga0070672_100359812 Ga0070672_1003598122 135
100 3300005544 Ga0070686_100434292 Ga0070686_1004342921 135
101 3300005546 Ga0070696_100003604 Ga0070696_1000036041 135
102 3300005547 Ga0070693_100014542 Ga0070693_1000145422 135
103 3300005548 Ga0070665_100138784 Ga0070665_1001387844 135
104 3300005549 Ga0070704_100000142 Ga0070704_10000014214 135
105 3300005563 Ga0068855_100013561 Ga0068855_10001356111 135
106 3300005578 Ga0068854_100000132 Ga0068854_10000013230 135
107 3300005614 Ga0068856_100228963 Ga0068856_1002289633 135
108 3300005615 Ga0070702_100567380 Ga0070702_1005673801 135
109 3300005617 Ga0068859_100072721 Ga0068859_1000727215 135
110 3300005618 Ga0068864_100063256 Ga0068864_1000632561 135
111 3300005618 Ga0068864_100861423 Ga0068864_1008614232 135
112 3300005718 Ga0068866_10000146 Ga0068866_1000014623 135
113 3300005719 Ga0068861_100000573 Ga0068861_10000057318 135
114 3300005719 Ga0068861_100066848 Ga0068861_1000668484 135
115 3300005840 Ga0068870_10205280 Ga0068870_102052802 135
116 3300005841 Ga0068863_100239522 Ga0068863_1002395223 135
117 3300005842 Ga0068858_100001434 Ga0068858_1000014346 135
118 3300005842 Ga0068858_100357762 Ga0068858_1003577622 135
119 3300005843 Ga0068860_100000994 Ga0068860_1000009943 135
120 3300005843 Ga0068860_100293233 Ga0068860_1002932332 135
121 3300005844 Ga0068862_100001311 Ga0068862_10000131123 135
122 3300005844 Ga0068862_100632906 Ga0068862_1006329062 135
123 3300006038 Ga0075365_10346689 Ga0075365_103466892 135
124 3300006163 Ga0070715_10026657 Ga0070715_100266573 135
125 3300006173 Ga0070716_100009665 Ga0070716_1000096655 135
126 3300006173 Ga0070716_100275711 Ga0070716_1002757111 135
127 3300006175 Ga0070712_100001186 Ga0070712_1000011863 135
128 3300006175 Ga0070712_100185238 Ga0070712_1001852382 135
129 3300006358 Ga0068871_100039359 Ga0068871_1000393594 135
130 3300006881 Ga0068865_100012460 Ga0068865_1000124603 135
131 3300006881 Ga0068865_101001626 Ga0068865_1010016262 135
132 3300006931 Ga0097620_100072714 Ga0097620_1000727145 135
133 3300009098 Ga0105245_10019281 Ga0105245_100192816 135
134 3300009098 Ga0105245_10528998 Ga0105245_105289982 135
135 3300009101 Ga0105247_10000186 Ga0105247_1000018623 135
136 3300009101 Ga0105247_10022867 Ga0105247_100228673 135
137 3300009148 Ga0105243_10042425 Ga0105243_100424253 135
138 3300009148 Ga0105243_10076509 Ga0105243_100765093 135
139 3300009174 Ga0105241_11160796 Ga0105241_111607962 135
140 3300009176 Ga0105242_10000731 Ga0105242_100007314 135
141 3300009177 Ga0105248_10004274 Ga0105248_1000427415 135
142 3300009177 Ga0105248_10047837 Ga0105248_100478372 135
143 3300009545 Ga0105237_10011100 Ga0105237_1001110011 135
144 3300009545 Ga0105237_10178722 Ga0105237_101787224 135
145 3300009553 Ga0105249_10016009 Ga0105249_100160097 135
146 3300010375 Ga0105239_10115948 Ga0105239_101159484 135
147 3300010375 Ga0105239_10150126 Ga0105239_101501263 135
148 3300013102 Ga0157371_10240060 Ga0157371_102400602 135
149 3300013296 Ga0157374_10057709 Ga0157374_100577092 135
150 3300013297 Ga0157378_10019603 Ga0157378_100196036 135
151 3300013306 Ga0163162_10015890 Ga0163162_100158908 135
152 3300013308 Ga0157375_10027086 Ga0157375_100270863 135
153 3300013308 Ga0157375_10180507 Ga0157375_101805072 135
154 3300013308 Ga0157375_10489831 Ga0157375_104898312 135
155 3300013308 Ga0157375_11301788 Ga0157375_113017881 135
156 3300014326 Ga0157380_10002376 Ga0157380_100023768 135
157 3300014968 Ga0157379_10000419 Ga0157379_1000041935 135
158 3300014968 Ga0157379_10254416 Ga0157379_102544162 135
159 3300014969 Ga0157376_10165081 Ga0157376_101650813 135
160 3300017792 Ga0163161_10001582 Ga0163161_100015822 135
161 3300017792 Ga0163161_10160882 Ga0163161_101608822 135
162 3300025898 Ga0207692_10003683 Ga0207692_100036836 135
163 3300025899 Ga0207642_10000332 Ga0207642_100003328 135
164 3300025900 Ga0207710_10006318 Ga0207710_100063183 135
165 3300025901 Ga0207688_10033488 Ga0207688_100334882 135
166 3300025901 Ga0207688_10186490 Ga0207688_101864901 135
167 3300025903 Ga0207680_10123326 Ga0207680_101233262 135
168 3300025905 Ga0207685_10001049 Ga0207685_100010496 135
169 3300025907 Ga0207645_10046073 Ga0207645_100460733 135
170 3300025911 Ga0207654_10763276 Ga0207654_107632762 135
171 3300025914 Ga0207671_10032443 Ga0207671_100324435 135
172 3300025914 Ga0207671_10077323 Ga0207671_100773232 135
173 3300025915 Ga0207693_10000172 Ga0207693_1000017220 135
174 3300025915 Ga0207693_10235235 Ga0207693_102352352 135
175 3300025916 Ga0207663_10001208 Ga0207663_100012088 135
176 3300025917 Ga0207660_10182840 Ga0207660_101828402 135
177 3300025919 Ga0207657_10518229 Ga0207657_105182292 135
178 3300025921 Ga0207652_10376906 Ga0207652_103769062 135
179 3300025923 Ga0207681_10014848 Ga0207681_100148483 135
180 3300025927 Ga0207687_10004141 Ga0207687_100041417 135
181 3300025927 Ga0207687_10245951 Ga0207687_102459512 135
182 3300025931 Ga0207644_10245025 Ga0207644_102450252 135
183 3300025932 Ga0207690_10049980 Ga0207690_100499804 135
184 3300025933 Ga0207706_10100218 Ga0207706_101002184 135
185 3300025934 Ga0207686_10058000 Ga0207686_100580002 135
186 3300025935 Ga0207709_10003310 Ga0207709_100033105 135
187 3300025937 Ga0207669_10000124 Ga0207669_1000012434 135
188 3300025937 Ga0207669_10145933 Ga0207669_101459332 135
189 3300025938 Ga0207704_10004389 Ga0207704_100043897 135
190 3300025938 Ga0207704_10225033 Ga0207704_102250332 135
191 3300025939 Ga0207665_10026800 Ga0207665_100268003 135
192 3300025939 Ga0207665_10088162 Ga0207665_100881621 135
193 3300025940 Ga0207691_10085377 Ga0207691_100853774 135
194 3300025941 Ga0207711_10173891 Ga0207711_101738912 135
195 3300025949 Ga0207667_10065657 Ga0207667_100656573 135
196 3300025961 Ga0207712_10075694 Ga0207712_100756942 135
197 3300025972 Ga0207668_10001759 Ga0207668_100017594 135
198 3300025972 Ga0207668_10002901 Ga0207668_100029017 135
199 3300025972 Ga0207668_10279205 Ga0207668_102792052 135
200 3300025981 Ga0207640_10001238 Ga0207640_1000123812 135
201 3300025986 Ga0207658_10004718 Ga0207658_100047185 135
202 3300025986 Ga0207658_11085558 Ga0207658_110855582 135
203 3300026023 Ga0207677_10129767 Ga0207677_101297672 135
204 3300026035 Ga0207703_10016310 Ga0207703_100163103 135
205 3300026035 Ga0207703_10275600 Ga0207703_102756002 135
206 3300026035 Ga0207703_10321258 Ga0207703_103212582 135
207 3300026041 Ga0207639_10023258 Ga0207639_100232582 135
208 3300026041 Ga0207639_11597208 Ga0207639_115972081 135
209 3300026067 Ga0207678_10007789 Ga0207678_100077899 135
210 3300026067 Ga0207678_10749006 Ga0207678_107490061 135
211 3300026075 Ga0207708_10002732 Ga0207708_100027322 135
212 3300026078 Ga0207702_10258063 Ga0207702_102580632 135
213 3300026078 Ga0207702_10418823 Ga0207702_104188232 135
214 3300026088 Ga0207641_10293487 Ga0207641_102934873 135
215 3300026089 Ga0207648_10044350 Ga0207648_100443505 135
216 3300026095 Ga0207676_10705026 Ga0207676_107050262 135
217 3300026118 Ga0207675_100000554 Ga0207675_1000005542 135
218 3300026118 Ga0207675_100102772 Ga0207675_1001027722 135
219 3300026121 Ga0207683_10000486 Ga0207683_1000048638 135
220 3300026121 Ga0207683_10289515 Ga0207683_102895151 135
221 3300026121 Ga0207683_11009015 Ga0207683_110090152 135
222 3300028379 Ga0268266_10149568 Ga0268266_101495682 135
223 3300028379 Ga0268266_10765909 Ga0268266_107659092 135
224 3300028380 Ga0268265_10007213 Ga0268265_100072136 135
225 3300028380 Ga0268265_10607910 Ga0268265_106079102 135
226 3300028381 Ga0268264_10006786 Ga0268264_100067867 135
227 3300028381 Ga0268264_11014747 Ga0268264_110147472 135
228 3300031456 Ga0307513_10018498 Ga0307513_1001849810 135
229 3300032002 Ga0307416_101743536 Ga0307416_1017435362 135
230 3300034817 Ga0373948_0077707 Ga0373948_0077707_189_596 135
231 3300035090 Ga0373949_0015882 Ga0373949_0015882_704_1111 135
232 3300035091 Ga0373951_0167916 Ga0373951_0167916_150_557 135
233 3300035121 Ga0373960_0047966 Ga0373960_0047966_722_1129 135
234 3300035207 Ga0373942_0235218 Ga0373942_0235218_155_562 135
235 3300035242 Ga0373962_0225014 Ga0373962_0225014_126_533 135
236 3300035691 Ga0373931_0076920 Ga0373931_0076920_513_920 135
237 3300042438 Ga0439459_0020402 Ga0439459_0020402_558_965 135
238 3300044683 Ga0466965_0024314 Ga0466965_0024314_2286_2693 135
239 3300044693 Ga0466961_0984763 Ga0466961_0984763_65_472 135
240 3300044706 Ga0466964_0043724 Ga0466964_0043724_223_630 135
241 3300044719 Ga0466971_0049913 Ga0466971_0049913_70_477 135
242 3300044735 Ga0466968_0002213 Ga0466968_0002213_2904_3311 135
243 3300044765 Ga0466970_0024731 Ga0466970_0024731_377_784 135
244 3300044842 Ga0466957_0016121 Ga0466957_0016121_459_866 135
245 3300044901 Ga0466960_0002339 Ga0466960_0002339_4685_5092 135
246 3300045049 Ga0466959_0034186 Ga0466959_0034186_1227_1634 135
247 3300045836 Ga0466958_0115274 Ga0466958_0115274_1254_1661 135
248 3300045976 Ga0466967_0013771 Ga0466967_0013771_3109_3516 135
249 3300045976 Ga0466967_0040907 Ga0466967_0040907_983_1390 135
250 3300046455 Ga0495603_0675906 Ga0495603_0675906_98_505 135
251 3300046506 Ga0495583_0009710 Ga0495583_0009710_253_660 135
252 3300046507 Ga0495606_0064739 Ga0495606_0064739_548_955 135
253 3300046524 Ga0495648_0004576 Ga0495648_0004576_4997_5404 135
254 3300046530 Ga0495654_0124018 Ga0495654_0124018_544_951 135
255 3300046616 Ga0495668_0017605 Ga0495668_0017605_1730_2137 135
256 3300046648 Ga0495611_0350617 Ga0495611_0350617_215_622 135
257 3300046692 Ga0495671_0148330 Ga0495671_0148330_282_689 135
258 3300046692 Ga0495671_0467865 Ga0495671_0467865_160_567 135
259 3300047320 Ga0495672_0004629 Ga0495672_0004629_5549_5956 135
260 3300047469 Ga0495673_0001554 Ga0495673_0001554_15876_16283 135
261 3300048903 Ga0496100_0002220 Ga0496100_0002220_3736_4143 135
262 3300048903 Ga0496100_0003746 Ga0496100_0003746_1706_2113 135
263 3300048903 Ga0496100_0023748 Ga0496100_0023748_1903_2310 135
264 3300048904 Ga0496101_0000115 Ga0496101_0000115_47507_47914 135
265 3300048904 Ga0496101_0002076 Ga0496101_0002076_1705_2112 135
266 3300048904 Ga0496101_0013674 Ga0496101_0013674_2728_3135 135
267 3300048905 Ga0496102_0000009 Ga0496102_0000009_23063_23470 135
268 3300048905 Ga0496102_0163592 Ga0496102_0163592_1273_1680 135
269 3300048905 Ga0496102_1039609 Ga0496102_1039609_105_512 135
270 3300048906 Ga0496103_0000051 Ga0496103_0000051_23063_23470 135
271 3300048906 Ga0496103_0000694 Ga0496103_0000694_2345_2752 135
272 3300048907 Ga0496104_0156146 Ga0496104_0156146_65_472 135
273 3300048907 Ga0496104_0209137 Ga0496104_0209137_498_905 135
274 3300048908 Ga0496105_0043866 Ga0496105_0043866_1287_1694 135
275 3300048908 Ga0496105_0317182 Ga0496105_0317182_513_920 135
276 3300048909 Ga0496106_0007463 Ga0496106_0007463_1701_2108 135
277 3300048909 Ga0496106_0030201 Ga0496106_0030201_1563_1970 135
278 3300048909 Ga0496106_0370685 Ga0496106_0370685_39_446 135
279 3300048910 Ga0496107_0002211 Ga0496107_0002211_1440_1847 135
280 3300048910 Ga0496107_0005423 Ga0496107_0005423_7252_7659 135
281 3300048910 Ga0496107_0129246 Ga0496107_0129246_1322_1729 135
282 3300048911 Ga0496108_0174488 Ga0496108_0174488_531_938 135
283 3300048912 Ga0496109_0048342 Ga0496109_0048342_3293_3700 135
284 3300048913 Ga0496110_1240730 Ga0496110_1240730_66_473 135
285 3300048917 Ga0496114_0000470 Ga0496114_0000470_28942_29349 135
286 3300048917 Ga0496114_0001282 Ga0496114_0001282_15018_15425 135
287 3300048917 Ga0496114_0185915 Ga0496114_0185915_973_1380 135
288 3300048917 Ga0496114_0575829 Ga0496114_0575829_157_579 135
289 3300048918 Ga0496115_0005314 Ga0496115_0005314_5115_5522 135
290 3300048919 Ga0496116_0000141 Ga0496116_0000141_126947_127354 135
291 3300048920 Ga0496117_0000019 Ga0496117_0000019_445787_446194 135
292 3300048921 Ga0496118_0000020 Ga0496118_0000020_23063_23470 135
293 3300048922 Ga0496119_0001032 Ga0496119_0001032_34214_34621 135
294 3300048923 Ga0496120_0002480 Ga0496120_0002480_13606_14013 135
295 3300048924 Ga0496121_0000510 Ga0496121_0000510_23063_23470 135
296 3300048929 Ga0496126_0001641 Ga0496126_0001641_22816_23223 135
297 3300050492 nmdc:mga0yw44_695815_c1 nmdc:mga0yw44_695815_c1_260_667 135
298 3300050492 nmdc:mga0yw44_889122_c1 nmdc:mga0yw44_889122_c1_104_511 135
299 3300050516 nmdc:mga0sz30_175055_c1 nmdc:mga0sz30_175055_c1_366_773 135
300 3300053087 Ga0500643_007330 Ga0500643_007330_1004_1411 135
301 3300053153 Ga0500616_0031789 Ga0500616_0031789_1419_1826 135
302 3300053158 Ga0500627_0313827 Ga0500627_0313827_202_609 135
303 3300025929 Ga0207664_10381193 Ga0207664_103811932 136
304 iso_pu_bacteria 2738541356 2739144811 136
305 3300005327 Ga0070658_10745375 Ga0070658_107453751 137
306 3300005327 Ga0070658_11960984 Ga0070658_119609841 137
307 3300005329 Ga0070683_101099834 Ga0070683_1010998342 137
308 3300005329 Ga0070683_101561657 Ga0070683_1015616571 137
309 3300005329 Ga0070683_101576162 Ga0070683_1015761621 137
310 3300005331 Ga0070670_100984562 Ga0070670_1009845622 137
311 3300005334 Ga0068869_100070150 Ga0068869_1000701502 137
312 3300005337 Ga0070682_100304149 Ga0070682_1003041492 137
313 3300005337 Ga0070682_100948114 Ga0070682_1009481141 137
314 3300005338 Ga0068868_100808185 Ga0068868_1008081851 137
315 3300005339 Ga0070660_100798772 Ga0070660_1007987721 137
316 3300005340 Ga0070689_100335966 Ga0070689_1003359662 137
317 3300005343 Ga0070687_100149690 Ga0070687_1001496901 137
318 3300005344 Ga0070661_100961635 Ga0070661_1009616351 137
319 3300005345 Ga0070692_10070532 Ga0070692_100705322 137
320 3300005347 Ga0070668_100346901 Ga0070668_1003469012 137
321 3300005354 Ga0070675_100429213 Ga0070675_1004292132 137
322 3300005356 Ga0070674_100233831 Ga0070674_1002338312 137
323 3300005356 Ga0070674_101700217 Ga0070674_1017002171 137
324 3300005364 Ga0070673_100487354 Ga0070673_1004873541 137
325 3300005365 Ga0070688_100222984 Ga0070688_1002229841 137
326 3300005366 Ga0070659_100061193 Ga0070659_1000611933 137
327 3300005366 Ga0070659_101086965 Ga0070659_1010869652 137
328 3300005367 Ga0070667_100163160 Ga0070667_1001631603 137
329 3300005439 Ga0070711_101058326 Ga0070711_1010583262 137
330 3300005441 Ga0070700_100088501 Ga0070700_1000885012 137
331 3300005444 Ga0070694_100470033 Ga0070694_1004700332 137
332 3300005455 Ga0070663_100362238 Ga0070663_1003622382 137
333 3300005455 Ga0070663_100523620 Ga0070663_1005236201 137
334 3300005456 Ga0070678_100335327 Ga0070678_1003353272 137
335 3300005456 Ga0070678_100582178 Ga0070678_1005821782 137
336 3300005456 Ga0070678_101818482 Ga0070678_1018184821 137
337 3300005457 Ga0070662_101592891 Ga0070662_1015928911 137
338 3300005457 Ga0070662_101986619 Ga0070662_1019866191 137
339 3300005458 Ga0070681_10707306 Ga0070681_107073062 137
340 3300005459 Ga0068867_100198536 Ga0068867_1001985362 137
341 3300005466 Ga0070685_10164305 Ga0070685_101643052 137
342 3300005530 Ga0070679_100189091 Ga0070679_1001890912 137
343 3300005535 Ga0070684_100109176 Ga0070684_1001091762 137
344 3300005539 Ga0068853_100431796 Ga0068853_1004317962 137
345 3300005543 Ga0070672_100339154 Ga0070672_1003391541 137
346 3300005543 Ga0070672_100456824 Ga0070672_1004568242 137
347 3300005546 Ga0070696_100292558 Ga0070696_1002925582 137
348 3300005547 Ga0070693_100564533 Ga0070693_1005645331 137
349 3300005548 Ga0070665_100277616 Ga0070665_1002776162 137
350 3300005548 Ga0070665_100298116 Ga0070665_1002981162 137
351 3300005548 Ga0070665_101846542 Ga0070665_1018465421 137
352 3300005563 Ga0068855_100214605 Ga0068855_1002146052 137
353 3300005563 Ga0068855_102095093 Ga0068855_1020950931 137
354 3300005564 Ga0070664_100121064 Ga0070664_1001210643 137
355 3300005564 Ga0070664_100763667 Ga0070664_1007636672 137
356 3300005577 Ga0068857_100498657 Ga0068857_1004986571 137
357 3300005614 Ga0068856_100082414 Ga0068856_1000824144 137
358 3300005614 Ga0068856_100302742 Ga0068856_1003027422 137
359 3300005616 Ga0068852_100041014 Ga0068852_1000410146 137
360 3300005616 Ga0068852_100166125 Ga0068852_1001661252 137
361 3300005616 Ga0068852_100344989 Ga0068852_1003449892 137
362 3300005617 Ga0068859_101375111 Ga0068859_1013751111 137
363 3300005618 Ga0068864_100245745 Ga0068864_1002457451 137
364 3300005718 Ga0068866_10396827 Ga0068866_103968271 137
365 3300005719 Ga0068861_100095142 Ga0068861_1000951421 137
366 3300005840 Ga0068870_10030119 Ga0068870_100301194 137
367 3300005840 Ga0068870_10845891 Ga0068870_108458912 137
368 3300005842 Ga0068858_100057285 Ga0068858_1000572852 137
369 3300005844 Ga0068862_100286425 Ga0068862_1002864252 137
370 3300005981 Ga0081538_10238705 Ga0081538_102387052 137
371 3300006028 Ga0070717_10263979 Ga0070717_102639792 137
372 3300006028 Ga0070717_12160107 Ga0070717_121601071 137
373 3300006058 Ga0075432_10530079 Ga0075432_105300791 137
374 3300006237 Ga0097621_102051118 Ga0097621_1020511182 137
375 3300006358 Ga0068871_100450437 Ga0068871_1004504372 137
376 3300006847 Ga0075431_101062825 Ga0075431_1010628252 137
377 3300006931 Ga0097620_101375069 Ga0097620_1013750691 137
378 3300009093 Ga0105240_10511999 Ga0105240_105119991 137
379 3300009094 Ga0111539_10307347 Ga0111539_103073472 137
380 3300009098 Ga0105245_10142444 Ga0105245_101424443 137
381 3300009101 Ga0105247_11283111 Ga0105247_112831112 137
382 3300009148 Ga0105243_10341808 Ga0105243_103418082 137
383 3300009148 Ga0105243_10423136 Ga0105243_104231362 137
384 3300009148 Ga0105243_11752511 Ga0105243_117525112 137
385 3300009174 Ga0105241_10161928 Ga0105241_101619282 137
386 3300009176 Ga0105242_11296302 Ga0105242_112963021 137
387 3300009545 Ga0105237_10953395 Ga0105237_109533952 137
388 3300009551 Ga0105238_10354713 Ga0105238_103547132 137
389 3300009551 Ga0105238_10815157 Ga0105238_108151571 137
390 3300009553 Ga0105249_10107042 Ga0105249_101070423 137
391 3300009553 Ga0105249_12674214 Ga0105249_126742141 137
392 3300009993 Ga0105028_109213 Ga0105028_1092132 137
393 3300010375 Ga0105239_10112590 Ga0105239_101125904 137
394 3300010375 Ga0105239_10305173 Ga0105239_103051732 137
395 3300010375 Ga0105239_10963053 Ga0105239_109630532 137
396 3300011119 Ga0105246_10392896 Ga0105246_103928962 137
397 3300011119 Ga0105246_11160707 Ga0105246_111607071 137
398 3300013102 Ga0157371_10497114 Ga0157371_104971142 137
399 3300013105 Ga0157369_10128133 Ga0157369_101281333 137
400 3300013105 Ga0157369_10200934 Ga0157369_102009343 137
401 3300013296 Ga0157374_10074957 Ga0157374_100749572 137
402 3300013296 Ga0157374_10336331 Ga0157374_103363312 137
403 3300013297 Ga0157378_10261854 Ga0157378_102618544 137
404 3300013307 Ga0157372_10421476 Ga0157372_104214762 137
405 3300013307 Ga0157372_11505648 Ga0157372_115056481 137
406 3300013308 Ga0157375_10280643 Ga0157375_102806432 137
407 3300013308 Ga0157375_13599876 Ga0157375_135998761 137
408 3300014325 Ga0163163_10283008 Ga0163163_102830082 137
409 3300014326 Ga0157380_10446030 Ga0157380_104460302 137
410 3300014497 Ga0182008_10119269 Ga0182008_101192692 137
411 3300014745 Ga0157377_10266987 Ga0157377_102669872 137
412 3300014745 Ga0157377_10566145 Ga0157377_105661452 137
413 3300014745 Ga0157377_10960479 Ga0157377_109604792 137
414 3300014969 Ga0157376_10130616 Ga0157376_101306162 137
415 3300017792 Ga0163161_10298168 Ga0163161_102981682 137
416 3300025899 Ga0207642_10255211 Ga0207642_102552112 137
417 3300025900 Ga0207710_10321888 Ga0207710_103218882 137
418 3300025901 Ga0207688_10004409 Ga0207688_100044099 137
419 3300025901 Ga0207688_10066672 Ga0207688_100666722 137
420 3300025908 Ga0207643_10015756 Ga0207643_100157562 137
421 3300025909 Ga0207705_10580038 Ga0207705_105800381 137
422 3300025909 Ga0207705_10761541 Ga0207705_107615412 137
423 3300025913 Ga0207695_10622179 Ga0207695_106221791 137
424 3300025914 Ga0207671_10415195 Ga0207671_104151951 137
425 3300025916 Ga0207663_11168287 Ga0207663_111682872 137
426 3300025918 Ga0207662_10155727 Ga0207662_101557271 137
427 3300025919 Ga0207657_10076906 Ga0207657_100769062 137
428 3300025919 Ga0207657_10184341 Ga0207657_101843412 137
429 3300025919 Ga0207657_10399323 Ga0207657_103993232 137
430 3300025920 Ga0207649_10735390 Ga0207649_107353902 137
431 3300025921 Ga0207652_10356240 Ga0207652_103562401 137
432 3300025921 Ga0207652_10743014 Ga0207652_107430141 137
433 3300025924 Ga0207694_10275939 Ga0207694_102759392 137
434 3300025924 Ga0207694_10905040 Ga0207694_109050401 137
435 3300025925 Ga0207650_10137217 Ga0207650_101372173 137
436 3300025926 Ga0207659_11341581 Ga0207659_113415811 137
437 3300025927 Ga0207687_10030832 Ga0207687_100308322 137
438 3300025927 Ga0207687_11194169 Ga0207687_111941692 137
439 3300025929 Ga0207664_10876566 Ga0207664_108765662 137
440 3300025931 Ga0207644_10052303 Ga0207644_100523032 137
441 3300025932 Ga0207690_10227839 Ga0207690_102278391 137
442 3300025932 Ga0207690_11635698 Ga0207690_116356981 137
443 3300025933 Ga0207706_10054685 Ga0207706_100546851 137
444 3300025933 Ga0207706_11112174 Ga0207706_111121742 137
445 3300025935 Ga0207709_10317073 Ga0207709_103170731 137
446 3300025935 Ga0207709_11062432 Ga0207709_110624322 137
447 3300025936 Ga0207670_10469425 Ga0207670_104694251 137
448 3300025938 Ga0207704_10234468 Ga0207704_102344682 137
449 3300025940 Ga0207691_10120971 Ga0207691_101209713 137
450 3300025942 Ga0207689_10024871 Ga0207689_100248714 137
451 3300025942 Ga0207689_10290241 Ga0207689_102902412 137
452 3300025945 Ga0207679_10076351 Ga0207679_100763513 137
453 3300025949 Ga0207667_11559511 Ga0207667_115595111 137
454 3300025960 Ga0207651_10141206 Ga0207651_101412062 137
455 3300025961 Ga0207712_10030188 Ga0207712_100301882 137
456 3300025972 Ga0207668_10240598 Ga0207668_102405983 137
457 3300025972 Ga0207668_10346901 Ga0207668_103469012 137
458 3300025986 Ga0207658_10558132 Ga0207658_105581321 137
459 3300026023 Ga0207677_10740620 Ga0207677_107406202 137
460 3300026023 Ga0207677_11022953 Ga0207677_110229532 137
461 3300026035 Ga0207703_10069667 Ga0207703_100696672 137
462 3300026035 Ga0207703_11006815 Ga0207703_110068152 137
463 3300026041 Ga0207639_10109132 Ga0207639_101091321 137
464 3300026067 Ga0207678_10055806 Ga0207678_100558062 137
465 3300026067 Ga0207678_10491006 Ga0207678_104910062 137
466 3300026075 Ga0207708_10053197 Ga0207708_100531974 137
467 3300026078 Ga0207702_10386889 Ga0207702_103868892 137
468 3300026078 Ga0207702_11090575 Ga0207702_110905752 137
469 3300026088 Ga0207641_10812994 Ga0207641_108129942 137
470 3300026089 Ga0207648_10049169 Ga0207648_100491694 137
471 3300026095 Ga0207676_11097869 Ga0207676_110978691 137
472 3300026116 Ga0207674_10165726 Ga0207674_101657262 137
473 3300026118 Ga0207675_100039045 Ga0207675_1000390457 137
474 3300026121 Ga0207683_10098306 Ga0207683_100983062 137
475 3300026121 Ga0207683_10423081 Ga0207683_104230812 137
476 3300026142 Ga0207698_10226873 Ga0207698_102268732 137
477 3300026142 Ga0207698_10424008 Ga0207698_104240082 137
478 3300028379 Ga0268266_10107036 Ga0268266_101070363 137
479 3300028379 Ga0268266_11277518 Ga0268266_112775181 137
480 3300028380 Ga0268265_10085812 Ga0268265_100858123 137
481 3300028381 Ga0268264_10792574 Ga0268264_107925742 137
482 3300030521 Ga0307511_10196288 Ga0307511_101962882 137
483 3300035115 Ga0373941_0206154 Ga0373941_0206154_274_702 137
484 3300039437 Ga0436365_0011767 Ga0436365_0011767_5631_6065 137
485 3300039450 Ga0436363_0933205 Ga0436363_0933205_130_543 137
486 3300044658 Ga0466972_0004922 Ga0466972_0004922_4966_5379 137
487 3300044706 Ga0466964_0384833 Ga0466964_0384833_127_540 137
488 3300044735 Ga0466968_0004456 Ga0466968_0004456_529_942 137
489 3300044765 Ga0466970_0082957 Ga0466970_0082957_554_967 137
490 3300044842 Ga0466957_0341809 Ga0466957_0341809_357_770 137
491 3300044842 Ga0466957_0436408 Ga0466957_0436408_156_569 137
492 3300044901 Ga0466960_0066696 Ga0466960_0066696_238_702 137
493 3300045049 Ga0466959_0367025 Ga0466959_0367025_245_658 137
494 3300045836 Ga0466958_0264408 Ga0466958_0264408_121_585 137
495 3300045976 Ga0466967_0030816 Ga0466967_0030816_2910_3374 137
496 3300045976 Ga0466967_2136082 Ga0466967_2136082_45_473 137
497 3300046471 Ga0495650_0042092 Ga0495650_0042092_492_905 137
498 3300046694 Ga0495649_0420926 Ga0495649_0420926_176_589 137
499 3300048904 Ga0496101_0583405 Ga0496101_0583405_124_537 137
500 3300048905 Ga0496102_0161621 Ga0496102_0161621_1114_1542 137
501 3300048907 Ga0496104_0161538 Ga0496104_0161538_390_803 137
502 3300048908 Ga0496105_1416987 Ga0496105_1416987_29_457 137
503 3300048909 Ga0496106_1014592 Ga0496106_1014592_17_430 137
504 3300048910 Ga0496107_0522096 Ga0496107_0522096_142_555 137
505 3300048911 Ga0496108_0011728 Ga0496108_0011728_3656_4069 137
506 3300048911 Ga0496108_0482030 Ga0496108_0482030_271_699 137
507 3300048912 Ga0496109_0013155 Ga0496109_0013155_6179_6592 137
508 3300048912 Ga0496109_0878304 Ga0496109_0878304_166_594 137
509 3300048913 Ga0496110_0042561 Ga0496110_0042561_947_1360 137
510 3300048913 Ga0496110_0310543 Ga0496110_0310543_18_446 137
511 3300048913 Ga0496110_0496499 Ga0496110_0496499_207_635 137
512 3300048914 Ga0496111_0069410 Ga0496111_0069410_1493_1906 137
513 3300048914 Ga0496111_0428171 Ga0496111_0428171_379_807 137
514 3300048914 Ga0496111_0921758 Ga0496111_0921758_137_565 137
515 3300048915 Ga0496112_0029795 Ga0496112_0029795_1705_2118 137
516 3300048916 Ga0496113_0177215 Ga0496113_0177215_1050_1463 137
517 3300048917 Ga0496114_0890975 Ga0496114_0890975_77_505 137
518 3300048917 Ga0496114_0969792 Ga0496114_0969792_67_495 137
519 3300049569 Ga0501032_0006575 Ga0501032_0006575_4353_4766 137
520 3300049570 Ga0501033_0111628 Ga0501033_0111628_800_1213 137
521 3300049571 Ga0501034_0004273 Ga0501034_0004273_11302_11715 137
522 3300049572 Ga0501036_0016856 Ga0501036_0016856_3463_3876 137
523 3300049573 Ga0501037_0002477 Ga0501037_0002477_1624_2037 137
524 3300049579 Ga0501043_0002246 Ga0501043_0002246_8991_9404 137
525 3300049581 Ga0501047_0014204 Ga0501047_0014204_773_1186 137
526 3300049582 Ga0501048_0001569 Ga0501048_0001569_2933_3346 137
527 3300049586 Ga0501070_0001570 Ga0501070_0001570_3741_4154 137
528 3300049589 Ga0501073_0176539 Ga0501073_0176539_1024_1437 137
529 3300049742 Ga0501080_0196997 Ga0501080_0196997_643_1056 137
530 3300049822 Ga0501035_0021057 Ga0501035_0021057_1228_1641 137
531 3300049823 Ga0501044_0004782 Ga0501044_0004782_8123_8536 137
532 3300050492 nmdc:mga0yw44_701714_c1 nmdc:mga0yw44_701714_c1_112_525 137
533 3300053083 Ga0495655_0160238 Ga0495655_0160238_129_542 137
534 3300053129 Ga0500628_043986 Ga0500628_043986_449_862 137
535 iso_pu_bacteria 2738543005 2739202384 137
536 iso_pu_bacteria 2738543011 2739235642 137
537 iso_pu_bacteria 2738543034 2739362365 137
538 iso_pu_bacteria 2939743619 2939746886 137
539 3300001989 JGI24739J22299_10042173 JGI24739J22299_100421733 138
540 3300002067 JGI24735J21928_10224958 JGI24735J21928_102249581 138
541 3300005338 Ga0068868_100124807 Ga0068868_1001248071 138
542 3300005347 Ga0070668_100005926 Ga0070668_1000059267 138
543 3300005347 Ga0070668_100011482 Ga0070668_1000114824 138
544 3300005347 Ga0070668_100673881 Ga0070668_1006738812 138
545 3300005367 Ga0070667_100001266 Ga0070667_10000126611 138
546 3300005435 Ga0070714_100272375 Ga0070714_1002723752 138
547 3300005457 Ga0070662_100001067 Ga0070662_10000106714 138
548 3300005615 Ga0070702_100000433 Ga0070702_10000043313 138
549 3300005615 Ga0070702_101735431 Ga0070702_1017354311 138
550 3300006048 Ga0075363_100054745 Ga0075363_1000547453 138
551 3300006048 Ga0075363_100259503 Ga0075363_1002595032 138
552 3300006048 Ga0075363_100325804 Ga0075363_1003258042 138
553 3300006048 Ga0075363_100363698 Ga0075363_1003636982 138
554 3300006048 Ga0075363_100515004 Ga0075363_1005150041 138
555 3300006051 Ga0075364_10009617 Ga0075364_100096173 138
556 3300006051 Ga0075364_10231945 Ga0075364_102319452 138
557 3300006177 Ga0075362_10061322 Ga0075362_100613223 138
558 3300006186 Ga0075369_10004548 Ga0075369_100045487 138
559 3300006353 Ga0075370_10093839 Ga0075370_100938392 138
560 3300006353 Ga0075370_10216189 Ga0075370_102161892 138
561 3300006353 Ga0075370_10240800 Ga0075370_102408002 138
562 3300006353 Ga0075370_10377292 Ga0075370_103772921 138
563 3300006353 Ga0075370_10381802 Ga0075370_103818022 138
564 3300009098 Ga0105245_10262372 Ga0105245_102623722 138
565 3300009148 Ga0105243_10612929 Ga0105243_106129292 138
566 3300013306 Ga0163162_10151583 Ga0163162_101515835 138
567 3300014325 Ga0163163_10986068 Ga0163163_109860682 138
568 3300025303 Ga0209051_1139547 Ga0209051_11395471 138
569 3300025929 Ga0207664_10272145 Ga0207664_102721452 138
570 3300025935 Ga0207709_10025984 Ga0207709_100259844 138
571 3300025986 Ga0207658_11623964 Ga0207658_116239641 138
572 3300026041 Ga0207639_11204497 Ga0207639_112044971 138
573 3300028380 Ga0268265_10395609 Ga0268265_103956091 138
574 3300035398 Ga0316574_0282958 Ga0316574_0282958_108_596 138
575 3300036647 Ga0316582_0248477 Ga0316582_0248477_33_521 138
576 3300036712 Ga0316584_0507621 Ga0316584_0507621_172_660 138
577 3300041410 Ga0439461_0004147 Ga0439461_0004147_11_427 138
578 3300041411 Ga0439466_0001778 Ga0439466_0001778_5483_5899 138
579 3300041491 Ga0451833_1272580 Ga0451833_1272580_204_623 138
580 3300041494 Ga0451837_0069700 Ga0451837_0069700_81_497 138
581 3300042002 Ga0439442_019360 Ga0439442_019360_28_444 138
582 3300042004 Ga0439445_0013984 Ga0439445_0013984_375_791 138
583 3300044683 Ga0466965_0114769 Ga0466965_0114769_108_548 138
584 3300044684 Ga0466966_0008355 Ga0466966_0008355_4930_5346 138
585 3300045976 Ga0466967_0114830 Ga0466967_0114830_172_588 138
586 3300046455 Ga0495603_0863081 Ga0495603_0863081_10_426 138
587 3300046616 Ga0495668_0007547 Ga0495668_0007547_5881_6297 138
588 3300046674 Ga0495588_0059007 Ga0495588_0059007_1160_1576 138
589 3300047315 Ga0495581_0033746 Ga0495581_0033746_234_650 138
590 3300047472 Ga0495686_0430597 Ga0495686_0430597_30_446 138
591 3300048903 Ga0496100_0136503 Ga0496100_0136503_734_1159 138
592 3300048904 Ga0496101_0135681 Ga0496101_0135681_674_1099 138
593 3300048904 Ga0496101_0372075 Ga0496101_0372075_346_762 138
594 3300048905 Ga0496102_0263926 Ga0496102_0263926_307_732 138
595 3300048907 Ga0496104_0803690 Ga0496104_0803690_412_837 138
596 3300048908 Ga0496105_1047657 Ga0496105_1047657_108_533 138
597 3300048911 Ga0496108_0312947 Ga0496108_0312947_11_427 138
598 3300048911 Ga0496108_0595288 Ga0496108_0595288_32_448 138
599 3300048912 Ga0496109_1663013 Ga0496109_1663013_144_560 138
600 3300048915 Ga0496112_0740246 Ga0496112_0740246_293_709 138
601 3300048916 Ga0496113_0773204 Ga0496113_0773204_102_518 138
602 3300048917 Ga0496114_0153368 Ga0496114_0153368_822_1247 138
603 3300048928 Ga0496125_0164138 Ga0496125_0164138_936_1352 138
604 3300048928 Ga0496125_0370668 Ga0496125_0370668_246_662 138
605 3300048929 Ga0496126_0268113 Ga0496126_0268113_908_1324 138
606 3300049579 Ga0501043_0110085 Ga0501043_0110085_1079_1495 138
607 3300049823 Ga0501044_0013430 Ga0501044_0013430_7743_8159 138
608 3300050489 nmdc:mga03683_364764_c1 nmdc:mga03683_364764_c1_12_428 138
609 3300050490 nmdc:mga03n38_11224_c1 nmdc:mga03n38_11224_c1_1304_1720 138
610 3300050490 nmdc:mga03n38_48064_c1 nmdc:mga03n38_48064_c1_203_622 138
611 3300050490 nmdc:mga03n38_77273_c1 nmdc:mga03n38_77273_c1_912_1328 138
612 3300050491 nmdc:mga00v17_190852_c1 nmdc:mga00v17_190852_c1_477_893 138
613 3300050491 nmdc:mga00v17_460184_c1 nmdc:mga00v17_460184_c1_56_472 138
614 3300050491 nmdc:mga00v17_53005_c1 nmdc:mga00v17_53005_c1_1819_2235 138
615 3300050491 nmdc:mga00v17_61672_c1 nmdc:mga00v17_61672_c1_851_1267 138
616 3300050496 nmdc:mga07m45_123740_c1 nmdc:mga07m45_123740_c1_410_826 138
617 3300050496 nmdc:mga07m45_260086_c1 nmdc:mga07m45_260086_c1_80_496 138
618 3300050496 nmdc:mga07m45_283097_c1 nmdc:mga07m45_283097_c1_263_679 138
619 3300050496 nmdc:mga07m45_44871_c2 nmdc:mga07m45_44871_c2_223_642 138
620 3300050496 nmdc:mga07m45_457590_c1 nmdc:mga07m45_457590_c1_102_518 138
621 3300050516 nmdc:mga0sz30_108042_c1 nmdc:mga0sz30_108042_c1_466_882 138
622 3300053080 Ga0500635_0039739 Ga0500635_0039739_472_888 138
623 3300053134 Ga0500658_0103913 Ga0500658_0103913_394_810 138
624 3300053139 Ga0500568_0114134 Ga0500568_0114134_458_874 138
625 3300053153 Ga0500616_0008769 Ga0500616_0008769_1090_1515 138
626 3300053154 Ga0500619_218284 Ga0500619_218284_45_461 138
627 3300053730 Ga0500645_000163 Ga0500645_000163_33464_33880 138
628 iso_pu_bacteria 2738541308 2738887912 138

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF11349

DUF3151

Protein of unknown function (DUF3151)

5

125

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
5dbk-assembly1.cif.gz_B apo form of the quorum sensor nprr from b. thuringiensis 0.857 42 121
3r9a-assembly1.cif.gz_B human alanine-glyoxylate aminotransferase in complex with the tpr domain of human pex5p 0.8394 31 119
7msn-assembly1.cif.gz_B suns glycosin s-glycosyltransferase 0.8064 31 124
8dtg-assembly1.cif.gz_A cryo-em structure of arabidopsis spy alternative conformation 1 0.8025 31 136
8dth-assembly1.cif.gz_B cryo-em structure of arabidopsis spy alternative conformation 2 0.799 31 136
ID Description Score Start End Superfamily
af_O06310_16_142_1.10.3450.10 Mainly Alpha;Orthogonal Bundle;Hyaluronidase domain-like;TTHA0068-like 1 8 132 1.10.3450.10
af_O06310_16_142_1.10.3450.10 Mainly Alpha;Orthogonal Bundle;Hyaluronidase domain-like;TTHA0068-like 0.9769 8 132 1.10.3450.10
af_Q55DC8_22_207_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.9226 42 121 1.25.40.10
af_I1KQK6_459_574_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.9165 31 121 1.25.40.10
4gyyC01 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.8803 31 129 1.25.40.10
ID Description Score Start End GO Terms
AF-A0A3D2VMA9-F1-model_v4 DUF3151 domain-containing protein 0.9982 10 134
AF-A0A6G3X8B8-F1-model_v4 DUF3151 domain-containing protein 0.9971 9 101
AF-A0A3G8JTH1-F1-model_v4 DUF3151 domain-containing protein 0.9949 14 137
AF-K5B9H0-F1-model_v4 Uncharacterized protein 0.9948 4 137
AF-A0A542NXM4-F1-model_v4 deleted 0.9947 4 137

Feature Viewer

pLDDT pTM Quality
93.64 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map