F470558

General Info

Members Datasets Scaffolds Average Seq Length
627 346 1254 356

Family's Representative Sequence

Representative Sequence 3300013104|Ga0157370_10000055|Ga0157370_10000055108
Length 377
Sequence MPVPALRRLSLALGLLCFIPHGFAETWPAADWAMTPAAASPAIEALETYAFPTRDDDSRKGIRTDALLVIRDGQIIYERYAGPTKASTPHLAWSVSKSILATTLGVAYGKGLFKLDDPAAKFYPPMNAHPQVKIGHLLNWASGLGWQEGYEYAPVRSSVVAMLYTHGRSDMAAFAASFDQAATPGTRFLYSSGDANVLAAALRGMVGDEAYKDYPWTALFEPLGITSAVWETDASGTFVGSSYAYLTARDLARIGLLMQRDGRWADQQVLPKAWVDFNRTPFANYQPSKETEGDAVPGGQWWLNVAVPGAAKPWPDAPDDTFAALGHWGQALYVLPAQKLVVVRYADDRDKTYSHNELLKRVEAAFAPTAQTAAEAK

Samples

Sample ID Description Type Environment
1 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
2 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
3 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
4 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
5 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
6 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
7 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
8 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
9 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
10 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
11 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
12 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
13 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
14 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
15 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
16 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
17 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
18 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
19 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
23 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
24 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
25 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
26 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
27 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
28 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
29 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
30 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
31 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
32 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
33 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
34 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
35 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
36 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
37 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
38 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
39 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
40 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
41 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
42 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
43 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
44 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
45 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
46 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
47 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
48 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
49 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
50 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
51 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
52 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
53 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
54 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
55 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
56 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
57 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
58 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
59 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
60 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
61 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
62 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
63 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
64 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
65 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
66 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
79 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
80 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
81 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
82 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
84 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
85 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
86 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
87 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
88 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
89 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
90 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
91 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
92 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
93 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
94 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
95 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
96 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
97 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
98 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
99 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
100 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
101 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
102 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
103 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
104 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
105 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
106 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
107 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
108 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
109 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
110 3300042120 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 Metagenome Rhizosphere
111 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
112 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
113 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
114 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
115 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
116 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
117 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
118 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
119 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
120 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
121 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
122 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
123 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
124 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
125 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
126 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
127 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
128 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
129 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
130 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
131 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
132 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
133 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
134 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
135 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
136 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
137 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
138 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
139 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
140 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
141 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
142 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
143 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
144 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
145 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
146 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
147 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
148 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
149 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
150 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
151 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
152 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
153 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
154 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
155 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
156 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
157 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
158 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
159 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
160 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
161 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
162 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
163 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
164 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
165 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
166 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
167 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
168 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
169 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
170 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
171 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
172 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
173 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
174 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
175 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
176 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
177 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
178 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
179 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
180 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
181 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
182 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
183 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
184 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
185 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
186 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
187 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
188 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
189 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
190 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
191 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
192 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
193 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
194 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
195 3300053135 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere Metagenome Endosphere
196 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
197 2511231006 Pseudomonas sp. GM17 Isolate Nodule
198 2511231010 Pseudomonas sp. GM25 Isolate Nodule
199 2511231031 Pseudomonas sp. GM16 Isolate Nodule
200 2512047018 Pseudomonas chlororaphis chlororaphis GP72 Isolate Rhizosphere
201 2554235132 Pseudomonas aeruginosa PGPR2 Isolate Unclassified
202 2554235231 Pseudomonas putida MTCC 5279 Isolate Unclassified
203 2554235341 Pseudomonas protegens CHA0 Isolate Rhizosphere
204 2582580891 Pseudomonas chlororaphis YL-1 Isolate Unclassified
205 2597489887 Pseudomonas chlororaphis aureofaciens 30-84 Isolate Rhizosphere
206 2597489888 Pseudomonas fluorescens SS101 Isolate Rhizosphere
207 2597489889 Pseudomonas synxantha BG33R Isolate Rhizosphere
208 2599185155 Pseudomonas sp. NFACC10-1 Isolate Rhizoplane
209 2599185160 Pseudomonas sp. NFPP25 Isolate Rhizoplane
210 2599185161 Pseudomonas sp. NFPP09 Isolate Rhizoplane
211 2599185162 Pseudomonas sp. NFPP10 Isolate Rhizoplane
212 2599185163 Pseudomonas sp. NFPP12 Isolate Rhizoplane
213 2599185164 Pseudomonas sp. NFPP13 Isolate Rhizoplane
214 2599185165 Pseudomonas sp. NFPP18 Isolate Rhizoplane
215 2599185166 Pseudomonas sp. NFPP08 Isolate Rhizoplane
216 2599185167 Pseudomonas sp. NFPP28 Isolate Rhizoplane
217 2599185168 Pseudomonas sp. NFPP05 Isolate Rhizoplane
218 2599185179 Pseudomonas sp. NFR09 Isolate Rhizoplane
219 2599185181 Pseudomonas sp. NFPP17 Isolate Rhizoplane
220 2599185182 Pseudomonas sp. NFPP19 Isolate Rhizoplane
221 2599185185 Pseudomonas sp. NFPP07 Isolate Rhizoplane
222 2599185186 Pseudomonas sp. NFPP15 Isolate Rhizoplane
223 2599185188 Pseudomonas sp. NFACC45 Isolate Rhizoplane
224 2599185189 Pseudomonas sp. NFPP02 Isolate Rhizoplane
225 2599185190 Pseudomonas sp. NFPP04 Isolate Rhizoplane
226 2599185191 Pseudomonas sp. NFPP24 Isolate Rhizoplane
227 2599185212 Pseudomonas sp. NFACC15-1 Isolate Rhizoplane
228 2599185257 Pseudomonas sp. NFACC41-3 Isolate Rhizoplane
229 2599185288 Pseudomonas sp. NFACC25 Isolate Rhizoplane
230 2599185290 Pseudomonas sp. NFPP11 Isolate Rhizoplane
231 2599185300 Pseudomonas sp. NFACC39-1 Isolate Rhizoplane
232 2599185302 Pseudomonas sp. NFACC43 Isolate Rhizoplane
233 2599185303 Pseudomonas sp. NFACC42-2 Isolate Rhizoplane
234 2599185304 Pseudomonas sp. NFACC47-1 Isolate Rhizoplane
235 2599185306 Pseudomonas sp. NFACC16-2 Isolate Rhizoplane
236 2599185308 Pseudomonas sp. NFACC17-2 Isolate Rhizoplane
237 2599185309 Pseudomonas sp. NFACC49-2 Isolate Rhizoplane
238 2599185310 Pseudomonas sp. NFACC09-4 Isolate Rhizoplane
239 2599185311 Pseudomonas sp. NFACC04-2 Isolate Rhizoplane
240 2599185312 Pseudomonas sp. NFACC32-1 Isolate Rhizoplane
241 2599185314 Pseudomonas sp. NFACC23-1 Isolate Rhizoplane
242 2599185316 Pseudomonas sp. NFACC52 Isolate Rhizoplane
243 2599185317 Pseudomonas sp. NFACC06-1 Isolate Rhizoplane
244 2599185318 Pseudomonas sp. NFACC13-1 Isolate Rhizoplane
245 2599185319 Pseudomonas sp. NFACC24-1 Isolate Rhizoplane
246 2599185320 Pseudomonas sp. NFACC36 Isolate Rhizoplane
247 2599185322 Pseudomonas sp. NFACC14 Isolate Rhizoplane
248 2599185323 Pseudomonas sp. NFACC37-1 Isolate Rhizoplane
249 2599185325 Pseudomonas sp. NFACC56-3 Isolate Rhizoplane
250 2599185356 Pseudomonas sp. NFPP14 Isolate Rhizoplane
251 2600254930 Pseudomonas sp. NFIX10 Isolate Rhizoplane
252 2600254931 Pseudomonas sp. NFIX28 Isolate Rhizoplane
253 2600255296 Pseudomonas sp. NFR02 Isolate Rhizoplane
254 2600255313 Pseudomonas sp. NFPP16 Isolate Rhizoplane
255 2606217733 Pseudomonas aeruginosa NFHH01 Isolate Rhizoplane
256 2619619299 Pseudomonas veronii R4 Genome sequencing Isolate Unclassified
257 2643221571 Pseudomonas sp. Root569 Isolate Unclassified
258 2643221713 Pseudomonas sp. Root9 Isolate Unclassified
259 2651869719 Genome Sequence of Pseudomonas fluorescens UM270 Isolate Rhizosphere
260 2667528171 Pseudomonas sp. NFPP22 Isolate Rhizoplane
261 2667528176 Pseudomonas sp. NFACC11-2 Isolate Rhizoplane
262 2671180172 Pseudomonas sp. NFIX51 Isolate Rhizoplane
263 2675903420 Pseudomonas fluorescens Ps006 Isolate Unclassified
264 2675903515 Pseudomonas thivervalensis DSM 13194 Isolate Unclassified
265 2713897148 Pseudomonas fluorescens SF39a Isolate Rhizosphere
266 2721755607 Pseudomonas fluorescens Pt14 Isolate Rhizosphere
267 2738541265 Pseudomonas sp. GV077 Isolate Unclassified
268 2738541282 Pseudomonas sp. GV058 Isolate Unclassified
269 2738541294 Pseudomonas sp. GV087 Isolate Unclassified
270 2738541303 Pseudomonas sp. GV105 Isolate Unclassified
271 2738541309 Pseudomonas sp. GV047 Isolate Unclassified
272 2738543020 Pseudomonas sp. GV054 Isolate Unclassified
273 2738543021 Pseudomonas sp. GV071 Isolate Unclassified
274 2740892503 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
275 2744054620 Pseudomonas thivervalensis LMG 21626 Isolate Unclassified
276 2765235841 Pseudomonas putida AA7 Isolate Unclassified
277 2791355520 Pseudomonas sp. s211(2017) Isolate Unclassified
278 2806310737 Pseudomonas mosselii BS011 Isolate Unclassified
279 2806310745 Pseudomonas mosselii PtA1 Isolate Unclassified
280 2808606373 Pseudomonas sp. SLBN-2 Isolate Unclassified
281 2808606385 Pseudomonas sp. SJZ103 Isolate Rhizosphere
282 2808606388 Pseudomonas sp. SJZ094 Isolate Rhizosphere
283 2811994881 Pseudomonas sp. SLBN-26 Isolate Unclassified
284 2816332298 Pseudomonas veronii R02 Isolate Rhizosphere
285 2818991464 Pseudomonas protegens 3295 Isolate Rhizosphere
286 2825651385 Pseudomonas brassicacearum L13-6-12 Isolate Rhizosphere
287 2826581358 Pseudomonas viridiflava CDRTc14 Isolate Unclassified
288 2834028612 Pseudomonas fluorescens 513 Isolate Unclassified
289 2842805378 Pseudomonas sp. R-72599 Isolate Unclassified
290 2842815866 Pseudomonas sp. R-72210 Isolate Unclassified
291 2842826826 Pseudomonas sp. R-72172 Isolate Unclassified
292 2842837860 Pseudomonas sp. R-72102 Isolate Unclassified
293 2842849001 Pseudomonas sp. R-72008 Isolate Unclassified
294 2842854478 Pseudomonas sp. R-71998 Isolate Unclassified
295 2844665904 Pseudomonas protegens H1F10C Isolate Unclassified
296 2852612431 Pseudomonas sp. SJZ073 Isolate Rhizosphere
297 2852667396 Pseudomonas sp. JAI120 Isolate Rhizosphere
298 2860867994 Pseudomonas sp. R1-43-08 Isolate Rhizosphere
299 2908446538 Pseudomonas sp. R76 Isolate Rhizosphere
300 2917070673 Pseudomonas protegens CHA0 Isolate Rhizosphere
301 2919481497 Pseudomonas brassicacearum 3432 Isolate Unclassified
302 2919487758 Pseudomonas koreensis 3441 Isolate Unclassified
303 2923153595 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
304 2923519811 Pseudomonas otitidis SLBN-103 Isolate Rhizosphere
305 2929189879 Pseudomonas sp. R-71842 Hybrid assembly Isolate Unclassified
306 2931369376 Pseudomonas fluorescens DR133 Isolate Rhizosphere
307 2931390751 Pseudomonas sp. DR208 Isolate Rhizosphere
308 2935353572 Pseudomonas protegens TECH19 Isolate Unclassified
309 2939651529 Pseudomonas sp. 2835 Isolate Rhizosphere
310 2945928738 Pseudomonas cedrina W1I11 Isolate Rhizosphere
311 2945961074 Pseudomonas sp. W2I6 Isolate Rhizosphere
312 2946006987 Pseudomonas sp. W3I7 Isolate Rhizosphere
313 2946027586 Pseudomonas sp. W4I3 Isolate Rhizosphere
314 2947233263 Pseudomonas synxantha W2I4 Isolate Rhizosphere
315 2969304461 Pseudomonas sp. R84 Isolate Rhizosphere
316 2974289157 Pseudomonas fluorescens SORGH_AS 191 Isolate Unclassified
317 2984286254 Pseudomonas chlororaphis aurantiaca JD37 Isolate Rhizosphere
318 2998139840 Pseudomonas iranensis SWRI54 Isolate Rhizosphere
319 3007395558 Pseudomonas chlororaphis PCL1601 Isolate Rhizosphere
320 3007419365 Pseudomonas vanderleydeniana RW8P3 Isolate Unclassified
321 3007614139 Pseudomonas sp. PB106 Isolate Unclassified
322 3007718800 Pseudomonas fluorescens BW11P2 Isolate Rhizosphere
323 3007803356 Pseudomonas sp. CM27 Isolate Unclassified
324 3007855910 Pseudomonas khorasanensis SWRI153 Isolate Rhizosphere
325 3007866637 Pseudomonas marvdashtae SWRI102 Isolate Rhizosphere
326 637000220 Pseudomonas protegens Pf-5 Isolate Rhizoplane
327 8015687852 Pseudomonas chlororaphis aurantiaca RP4 Isolate Rhizosphere
328 8019769354 Pseudomonas sp. MSSRFD41 Isolate Rhizosphere
329 8029995093 Pseudomonas atacamensis SM1 Isolate Rhizosphere
330 8052494512 Pseudomonas putida LD6 Isolate Unclassified
331 8054285046 Pseudomonas petroselini MAFF 311096 Isolate Nodule
332 8054347763 Pseudomonas carnis NWU Be30 Isolate Unclassified
333 8054503363 Pseudomonas sivasensis BsEB-1 Isolate Unclassified
334 8054929484 Pseudomonas vlassakiae RW4S1 Isolate Rhizosphere
335 8055770955 Pseudomonas chlororaphis qlu-1 Isolate Rhizosphere
336 8055817908 Pseudomonas pergaminensis 1008 Isolate Rhizosphere
337 8056115690 Pseudomonas muyukensis COW39 Isolate Rhizosphere
338 8056120720 Pseudomonas maumuensis COW77 Isolate Rhizosphere
339 8056131705 Pseudomonas asgharzadehiana SWRI132 Isolate Rhizosphere
340 8056137416 Pseudomonas fakonensis COW40 Isolate Rhizosphere
341 8056143049 Pseudomonas alvandae SWRI17 Isolate Rhizosphere
342 8056148874 Pseudomonas khavaziana SWRI124 Isolate Rhizosphere
343 8056161164 Pseudomonas azadiae SWRI103 Isolate Rhizosphere
344 8056166840 Pseudomonas triticicola SWRI88 Isolate Rhizosphere
345 8056172158 Pseudomonas ekonensis COR58 Isolate Rhizosphere
346 8057798959 Pseudomonas piscis BW16M1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 76.08
Metatranscriptomes 0
Isolates 23.92

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.29
Nodule 2.07
Rhizoplane 8.93
Rhizosphere 65.39
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157370_10000055 3300013104 Bacteria 118355
2 JGI25162J39368_1000054 3300002737 Bacteria 147779
3 JGI25162J39368_1000132 3300002737 Bacteria 80803
4 JGI25163J39215_1000196 3300002771 Bacteria 23468
5 JGI25163J39215_1000501 3300002771 Bacteria 11658
6 JGI25164J39214_1000029 3300002772 Bacteria 147779
7 JGI25164J39214_1000106 3300002772 Bacteria 80803
8 JGI25165J46597_1000111 3300003214 Bacteria 147779
9 JGI25165J46597_1000217 3300003214 Bacteria 80803
10 Ga0055538_1000082 3300003751 Bacteria 84434
11 Ga0055539_1000121 3300003752 Bacteria 84434
12 Ga0055533_1000129 3300003756 Bacteria 84434
13 Ga0055532_1000104 3300003758 Bacteria 91442
14 Ga0055525_1000167 3300003759 Bacteria 84434
15 Ga0055535_1004640 3300003761 Bacteria 3263
16 Ga0055536_1000043 3300003781 Bacteria 124663
17 Ga0055536_1000351 3300003781 Bacteria 34244
18 Ga0055530_10000031 3300003791 Bacteria 122117
19 Ga0055530_10000383 3300003791 Bacteria 39787
20 Ga0055540_1000230 3300003792 Bacteria 51911
21 Ga0055540_1000341 3300003792 Bacteria 39787
22 Ga0055541_1000081 3300003841 Bacteria 84434
23 Ga0065714_10065614 3300005288 Bacteria 9160
24 Ga0065714_10140945 3300005288 Bacteria 1172
25 Ga0065704_10002628 3300005289 Bacteria 5114
26 Ga0065704_10090744 3300005289 Bacteria 2766
27 Ga0065704_10094696 3300005289 Bacteria 2529
28 Ga0065712_10068085 3300005290 Bacteria 15225
29 Ga0065712_10070272 3300005290 Bacteria 6159
30 Ga0070670_100003000 3300005331 Bacteria 13978
31 Ga0070661_100000238 3300005344 Bacteria 45456
32 Ga0070669_100000150 3300005353 Bacteria 62681
33 Ga0070662_100003244 3300005457 Bacteria 10117
34 Ga0068853_100093210 3300005539 Bacteria 2651
35 Ga0070665_100019898 3300005548 Bacteria 6740
36 Ga0070665_100083065 3300005548 Bacteria 3208
37 Ga0070664_100001048 3300005564 Bacteria 21723
38 Ga0068854_100003503 3300005578 Bacteria 9807
39 Ga0068851_10000182 3300005834 Bacteria 31167
40 Ga0075364_10111091 3300006051 Bacteria 1829
41 Ga0075432_10000336 3300006058 Bacteria 13380
42 Ga0099823_1000062 3300006944 Bacteria 51683
43 Ga0079104_1000134 3300006946 Bacteria 103774
44 Ga0079104_1006226 3300006946 Bacteria 4565
45 Ga0099826_10028717 3300006948 Bacteria 4062
46 Ga0105251_10000004 3300009011 Bacteria 285212
47 Ga0105251_10000519 3300009011 Bacteria 36305
48 Ga0105251_10009608 3300009011 Bacteria 5694
49 Ga0105251_10011273 3300009011 Bacteria 5115
50 Ga0105251_10014616 3300009011 Bacteria 4329
51 Ga0105251_10030980 3300009011 Bacteria 2680
52 Ga0105244_10005059 3300009036 Bacteria 8869
53 Ga0105244_10005631 3300009036 Bacteria 8276
54 Ga0105244_10006175 3300009036 Bacteria 7813
55 Ga0105244_10006499 3300009036 Bacteria 7550
56 Ga0105244_10009033 3300009036 Bacteria 6167
57 Ga0105244_10010658 3300009036 Bacteria 5559
58 Ga0105244_10012170 3300009036 Bacteria 5106
59 Ga0105244_10013498 3300009036 Bacteria 4773
60 Ga0105244_10019511 3300009036 Bacteria 3782
61 Ga0105244_10027330 3300009036 Bacteria 3076
62 Ga0105244_10027364 3300009036 Bacteria 3073
63 Ga0105244_10033797 3300009036 Bacteria 2695
64 Ga0105250_10000118 3300009092 Bacteria 71419
65 Ga0105250_10000179 3300009092 Bacteria 54856
66 Ga0105250_10004447 3300009092 Bacteria 6451
67 Ga0105243_10000450 3300009148 Bacteria 42853
68 Ga0105243_10012626 3300009148 Bacteria 6380
69 Ga0105243_10021987 3300009148 Bacteria 4844
70 Ga0105243_10053071 3300009148 Bacteria 3214
71 Ga0105242_10003316 3300009176 Bacteria 12526
72 Ga0105237_10001417 3300009545 Bacteria 31682
73 Ga0105246_10007263 3300011119 Bacteria 6787
74 Ga0157345_1000317 3300012498 Bacteria 6101
75 Ga0157373_10000309 3300013100 Bacteria 39589
76 Ga0157373_10006208 3300013100 Bacteria 8927
77 Ga0157373_10029742 3300013100 Bacteria 3932
78 Ga0157373_10034929 3300013100 Bacteria 3610
79 Ga0157373_10046460 3300013100 Bacteria 3098
80 Ga0157373_10120230 3300013100 Bacteria 1846
81 Ga0157373_10172798 3300013100 Bacteria 1520
82 Ga0157371_10000795 3300013102 Bacteria 36211
83 Ga0157371_10018410 3300013102 Bacteria 5165
84 Ga0157370_10101827 3300013104 Bacteria 2690
85 Ga0157369_10010798 3300013105 Bacteria 10398
86 Ga0157369_10014243 3300013105 Bacteria 8985
87 Ga0157369_10022032 3300013105 Bacteria 7120
88 Ga0157369_10050325 3300013105 Bacteria 4513
89 Ga0157369_10082425 3300013105 Bacteria 3441
90 Ga0163162_10001527 3300013306 Bacteria 21568
91 Ga0157375_10000770 3300013308 Bacteria 28095
92 Ga0157375_10212776 3300013308 Bacteria 2091
93 Ga0182008_10000138 3300014497 Bacteria 55773
94 Ga0182008_10003721 3300014497 Bacteria 9098
95 Ga0182006_1004515 3300015261 Bacteria 6851
96 Ga0182006_1012362 3300015261 Bacteria 3731
97 Ga0182006_1021529 3300015261 Bacteria 2688
98 Ga0163161_10009779 3300017792 Bacteria 6646
99 Ga0163161_10083508 3300017792 Bacteria 2354
100 Ga0163161_10129614 3300017792 Bacteria 1901
101 Ga0163161_10238456 3300017792 Bacteria 1414
102 Ga0209435_100662 3300025206 Bacteria 6107
103 Ga0209760_100015 3300025207 Bacteria 176281
104 Ga0209760_100047 3300025207 Bacteria 107520
105 Ga0209784_100015 3300025224 Bacteria 482117
106 Ga0209566_100012 3300025225 Bacteria 482281
107 Ga0209674_100027 3300025226 Bacteria 482281
108 Ga0209147_100019 3300025229 Bacteria 482139
109 Ga0209563_100031 3300025230 Bacteria 482281
110 Ga0209563_102306 3300025230 Bacteria 4385
111 Ga0207427_100001 3300025231 Bacteria 1410763
112 Ga0207427_100029 3300025231 Bacteria 376678
113 Ga0209437_100003 3300025233 Bacteria 1517827
114 Ga0209437_100009 3300025233 Bacteria 915954
115 Ga0209437_104508 3300025233 Bacteria 2448
116 Ga0209258_100250 3300025242 Bacteria 97656
117 Ga0209646_1000263 3300025246 Bacteria 51493
118 Ga0209677_100016 3300025253 Bacteria 482117
119 Ga0209759_1015996 3300025256 Bacteria 1914
120 Ga0209233_1000007 3300025261 Bacteria 1411234
121 Ga0209233_1000032 3300025261 Bacteria 623596
122 Ga0209676_1000033 3300025292 Bacteria 463236
123 Ga0209676_1000080 3300025292 Bacteria 287400
124 Ga0209676_1000181 3300025292 Bacteria 147350
125 Ga0209676_1009528 3300025292 Bacteria 4180
126 Ga0209050_1000009 3300025298 Bacteria 1047265
127 Ga0209050_1000117 3300025298 Bacteria 202979
128 Ga0209051_1000053 3300025303 Bacteria 281564
129 Ga0209051_1000077 3300025303 Bacteria 202959
130 Ga0207656_10000026 3300025321 Bacteria 86789
131 Ga0207696_1000022 3300025711 Bacteria 427529
132 Ga0207696_1000044 3300025711 Bacteria 300953
133 Ga0207696_1000111 3300025711 Bacteria 155243
134 Ga0207696_1002980 3300025711 Bacteria 7910
135 Ga0207655_1000005 3300025728 Bacteria 917277
136 Ga0207655_1000435 3300025728 Bacteria 55875
137 Ga0207655_1001682 3300025728 Bacteria 19490
138 Ga0207655_1002331 3300025728 Bacteria 15567
139 Ga0207655_1004894 3300025728 Bacteria 9292
140 Ga0207655_1007033 3300025728 Bacteria 7367
141 Ga0207655_1012259 3300025728 Bacteria 5026
142 Ga0207655_1023411 3300025728 Bacteria 3064
143 Ga0207655_1048349 3300025728 Bacteria 1747
144 Ga0207713_1000013 3300025735 Bacteria 475751
145 Ga0207713_1000574 3300025735 Bacteria 36506
146 Ga0207713_1002530 3300025735 Bacteria 13231
147 Ga0207713_1008926 3300025735 Bacteria 5704
148 Ga0207713_1010066 3300025735 Bacteria 5268
149 Ga0207713_1022654 3300025735 Bacteria 2975
150 Ga0207713_1026062 3300025735 Bacteria 2687
151 Ga0207671_10000436 3300025914 Bacteria 57399
152 Ga0207649_10000002 3300025920 Bacteria 498633
153 Ga0207681_10000475 3300025923 Bacteria 28041
154 Ga0207650_10000341 3300025925 Bacteria 45117
155 Ga0207650_10000543 3300025925 Bacteria 30748
156 Ga0207686_10003220 3300025934 Bacteria 8777
157 Ga0207709_10000278 3300025935 Bacteria 59633
158 Ga0207709_10004751 3300025935 Bacteria 7797
159 Ga0207709_10009627 3300025935 Bacteria 5322
160 Ga0207679_10000006 3300025945 Bacteria 498868
161 Ga0207639_10075164 3300026041 Bacteria 2656
162 Ga0209281_1000172 3300027111 Bacteria 151766
163 Ga0209281_1004255 3300027111 Bacteria 4349
164 Ga0209281_1007354 3300027111 Bacteria 2769
165 Ga0209281_1019052 3300027111 Bacteria 1360
166 Ga0209389_1000005 3300027296 Bacteria 232255
167 Ga0209371_1000842 3300027312 Bacteria 25067
168 Ga0207428_10170734 3300027907 Bacteria 1647
169 Ga0268266_10004538 3300028379 Bacteria 13263
170 Ga0268266_10103348 3300028379 Bacteria 2514
171 Ga0268256_1000779 3300030500 Bacteria 23085
172 Ga0314311_1016558 3300030733 Bacteria 2171
173 Ga0316178_1121715 3300030735 Bacteria 7690
174 Ga0316183_1196223 3300030742 Bacteria 1745
175 Ga0316183_1205945 3300030742 Bacteria 2945
176 Ga0316181_1002344 3300030744 Bacteria 2100
177 Ga0265340_10061335 3300031247 Bacteria 1799
178 Ga0265316_10172908 3300031344 Bacteria 1611
179 Ga0307408_100000653 3300031548 Bacteria 29111
180 Ga0307405_10000489 3300031731 Bacteria 14923
181 Ga0307405_10007647 3300031731 Bacteria 5424
182 Ga0307405_10008680 3300031731 Bacteria 5163
183 Ga0307413_10053048 3300031824 Bacteria 2452
184 Ga0307406_10019318 3300031901 Bacteria 3997
185 Ga0307412_10001818 3300031911 Bacteria 11808
186 Ga0307412_10012714 3300031911 Bacteria 4910
187 Ga0307412_10038731 3300031911 Bacteria 3072
188 Ga0307412_10076585 3300031911 Bacteria 2298
189 Ga0307412_10127412 3300031911 Bacteria 1843
190 Ga0307409_100169180 3300031995 Bacteria 1921
191 Ga0307414_10232641 3300032004 Bacteria 1520
192 Ga0307411_10023183 3300032005 Bacteria 3671
193 Ga0307411_10055766 3300032005 Bacteria 2601
194 Ga0307510_10031786 3300033180 Bacteria 5954
195 Ga0439438_001959 3300041405 Bacteria 8995
196 Ga0439438_004047 3300041405 Bacteria 5755
197 Ga0439438_004550 3300041405 Bacteria 5286
198 Ga0439438_004944 3300041405 Bacteria 4984
199 Ga0439447_003016 3300041407 Bacteria 6025
200 Ga0439447_007174 3300041407 Bacteria 3560
201 Ga0439447_008598 3300041407 Bacteria 3153
202 Ga0439447_035774 3300041407 Bacteria 1229
203 Ga0439466_0000109 3300041411 Bacteria 31597
204 Ga0439466_0001687 3300041411 Bacteria 8624
205 Ga0439466_0002735 3300041411 Bacteria 6901
206 Ga0439466_0022972 3300041411 Bacteria 2196
207 Ga0439466_0039153 3300041411 Bacteria 1590
208 Ga0439431_0001788 3300041997 Bacteria 4756
209 Ga0439437_000317 3300042000 Bacteria 4538
210 Ga0439432_002225 3300042006 Bacteria 7315
211 Ga0439432_008384 3300042006 Bacteria 3629
212 Ga0439432_017733 3300042006 Bacteria 2387
213 Ga0439451_000747 3300042009 Bacteria 6177
214 Ga0439451_005394 3300042009 Bacteria 2607
215 Ga0439452_000047 3300042010 Bacteria 127643
216 Ga0439452_005638 3300042010 Bacteria 4009
217 Ga0439452_022367 3300042010 Bacteria 1636
218 Ga0439456_000236 3300042013 Bacteria 14764
219 Ga0439456_003084 3300042013 Bacteria 3367
220 Ga0439456_003130 3300042013 Bacteria 3344
221 Ga0439463_000470 3300042016 Bacteria 11223
222 Ga0450911_000008 3300042115 Bacteria 168304
223 Ga0450911_001166 3300042115 Bacteria 6454
224 Ga0450917_002819 3300042120 Bacteria 1249
225 Ga0450902_000048 3300042137 Bacteria 10854
226 Ga0450905_000032 3300042142 Bacteria 11860
227 Ga0450906_004060 3300042145 Bacteria 3097
228 Ga0450910_001588 3300042147 Bacteria 2895
229 Ga0450909_002018 3300042185 Bacteria 2863
230 Ga0439459_0004407 3300042438 Bacteria 2264
231 Ga0495617_014353 3300046452 Bacteria 2693
232 Ga0495617_014602 3300046452 Bacteria 2669
233 Ga0495617_027069 3300046452 Bacteria 1930
234 Ga0495617_037439 3300046452 Bacteria 1624
235 Ga0495627_002079 3300046453 Bacteria 10190
236 Ga0495627_004422 3300046453 Bacteria 5884
237 Ga0495627_005489 3300046453 Bacteria 5103
238 Ga0495627_005498 3300046453 Bacteria 5095
239 Ga0495590_0010583 3300046457 Bacteria 3461
240 Ga0495591_002494 3300046458 Bacteria 10193
241 Ga0495591_008262 3300046458 Bacteria 4287
242 Ga0495591_010368 3300046458 Bacteria 3618
243 Ga0495591_013002 3300046458 Bacteria 3068
244 Ga0495591_013103 3300046458 Bacteria 3052
245 Ga0495591_017646 3300046458 Bacteria 2443
246 Ga0495653_0032718 3300046463 Bacteria 4126
247 Ga0495653_0092924 3300046463 Bacteria 2201
248 Ga0495650_0005934 3300046471 Bacteria 7756
249 Ga0495650_0006445 3300046471 Bacteria 7307
250 Ga0495605_0000016 3300046474 Bacteria 289508
251 Ga0495605_0000031 3300046474 Bacteria 213242
252 Ga0495605_0006884 3300046474 Bacteria 6493
253 Ga0495584_0022969 3300046491 Bacteria 3164
254 Ga0495584_0031869 3300046491 Bacteria 2668
255 Ga0495584_0035880 3300046491 Bacteria 2505
256 Ga0495585_0015905 3300046492 Bacteria 4365
257 Ga0495585_0031336 3300046492 Bacteria 3018
258 Ga0495585_0071382 3300046492 Bacteria 1893
259 Ga0495594_0011345 3300046499 Bacteria 4629
260 Ga0495596_0029772 3300046500 Bacteria 2187
261 Ga0495607_0014593 3300046501 Bacteria 5108
262 Ga0495607_0035323 3300046501 Bacteria 3024
263 Ga0495607_0041290 3300046501 Bacteria 2741
264 Ga0495607_0132279 3300046501 Bacteria 1296
265 Ga0495607_0179726 3300046501 Bacteria 1061
266 Ga0495583_0000041 3300046506 Bacteria 234707
267 Ga0495583_0002147 3300046506 Bacteria 17608
268 Ga0495583_0008721 3300046506 Bacteria 6157
269 Ga0495583_0011476 3300046506 Bacteria 5083
270 Ga0495606_0000518 3300046507 Bacteria 62348
271 Ga0495606_0007473 3300046507 Bacteria 9763
272 Ga0495606_0031442 3300046507 Bacteria 3690
273 Ga0495606_0046178 3300046507 Bacteria 2880
274 Ga0495606_0063822 3300046507 Bacteria 2346
275 Ga0495606_0101388 3300046507 Bacteria 1752
276 Ga0495610_0009356 3300046512 Bacteria 6203
277 Ga0495610_0010391 3300046512 Bacteria 5789
278 Ga0495610_0012134 3300046512 Bacteria 5208
279 Ga0495610_0014085 3300046512 Bacteria 4717
280 Ga0495610_0035212 3300046512 Bacteria 2572
281 Ga0495616_0003419 3300046513 Bacteria 10173
282 Ga0495616_0011323 3300046513 Bacteria 5119
283 Ga0495616_0026953 3300046513 Bacteria 3053
284 Ga0495616_0043606 3300046513 Bacteria 2278
285 Ga0495620_0000036 3300046515 Bacteria 115279
286 Ga0495620_0002402 3300046515 Bacteria 10842
287 Ga0495620_0009912 3300046515 Bacteria 5042
288 Ga0495620_0010866 3300046515 Bacteria 4781
289 Ga0495620_0023458 3300046515 Bacteria 2948
290 Ga0495620_0045604 3300046515 Bacteria 1896
291 Ga0495631_0011499 3300046518 Bacteria 4352
292 Ga0495631_0021085 3300046518 Bacteria 3036
293 Ga0495632_0000300 3300046519 Bacteria 47863
294 Ga0495632_0002650 3300046519 Bacteria 13436
295 Ga0495632_0026753 3300046519 Bacteria 3031
296 Ga0495632_0031941 3300046519 Bacteria 2716
297 Ga0495632_0039401 3300046519 Bacteria 2385
298 Ga0495637_0008140 3300046520 Bacteria 5159
299 Ga0495637_0018640 3300046520 Bacteria 3217
300 Ga0495637_0023608 3300046520 Bacteria 2792
301 Ga0495637_0055290 3300046520 Bacteria 1646
302 Ga0495643_0000116 3300046522 Bacteria 130165
303 Ga0495643_0000973 3300046522 Bacteria 29349
304 Ga0495643_0002157 3300046522 Bacteria 16156
305 Ga0495643_0009775 3300046522 Bacteria 5932
306 Ga0495643_0013310 3300046522 Bacteria 4927
307 Ga0495643_0031781 3300046522 Bacteria 2935
308 Ga0495643_0037214 3300046522 Bacteria 2671
309 Ga0495643_0048903 3300046522 Bacteria 2283
310 Ga0495644_0014545 3300046523 Bacteria 3013
311 Ga0495648_0000482 3300046524 Bacteria 42727
312 Ga0495648_0002901 3300046524 Bacteria 15419
313 Ga0495648_0015782 3300046524 Bacteria 5464
314 Ga0495648_0027473 3300046524 Bacteria 3807
315 Ga0495648_0034587 3300046524 Bacteria 3286
316 Ga0495648_0036283 3300046524 Bacteria 3183
317 Ga0495648_0040810 3300046524 Bacteria 2937
318 Ga0495648_0041042 3300046524 Bacteria 2926
319 Ga0495654_0002768 3300046530 Bacteria 11053
320 Ga0495654_0009317 3300046530 Bacteria 5381
321 Ga0495654_0010481 3300046530 Bacteria 5040
322 Ga0495654_0013010 3300046530 Bacteria 4458
323 Ga0495654_0032980 3300046530 Bacteria 2623
324 Ga0495654_0041534 3300046530 Bacteria 2287
325 Ga0495654_0090797 3300046530 Bacteria 1417
326 Ga0495587_0138761 3300046536 Bacteria 1388
327 Ga0495609_0000015 3300046538 Bacteria 322474
328 Ga0495609_0000050 3300046538 Bacteria 154752
329 Ga0495609_0008507 3300046538 Bacteria 5022
330 Ga0495609_0008604 3300046538 Bacteria 4983
331 Ga0495609_0034684 3300046538 Bacteria 2286
332 Ga0495597_0002994 3300046542 Bacteria 10196
333 Ga0495597_0020765 3300046542 Bacteria 3055
334 Ga0495622_0019233 3300046557 Bacteria 3180
335 Ga0495622_0168166 3300046557 Bacteria 987
336 Ga0495633_0000363 3300046558 Bacteria 48912
337 Ga0495633_0023784 3300046558 Bacteria 3032
338 Ga0495668_0015749 3300046616 Bacteria 4407
339 Ga0495668_0021021 3300046616 Bacteria 3748
340 Ga0495668_0042222 3300046616 Bacteria 2539
341 Ga0495634_0042913 3300046642 Bacteria 3066
342 Ga0495611_0004875 3300046648 Bacteria 5761
343 Ga0495625_0019384 3300046660 Bacteria 5277
344 Ga0495625_0021151 3300046660 Bacteria 5012
345 Ga0495625_0072542 3300046660 Bacteria 2414
346 Ga0495661_0000046 3300046665 Bacteria 148306
347 Ga0495661_0000419 3300046665 Bacteria 44795
348 Ga0495661_0012029 3300046665 Bacteria 5855
349 Ga0495661_0038712 3300046665 Bacteria 2967
350 Ga0495661_0048829 3300046665 Bacteria 2569
351 Ga0495646_0129497 3300046680 Bacteria 1421
352 Ga0495613_0026485 3300046689 Bacteria 4318
353 Ga0495624_0015665 3300046690 Bacteria 5112
354 Ga0495670_0008312 3300046691 Bacteria 5101
355 Ga0495671_0007510 3300046692 Bacteria 6207
356 Ga0495671_0026350 3300046692 Bacteria 3015
357 Ga0495671_0027028 3300046692 Bacteria 2967
358 Ga0495671_0035590 3300046692 Bacteria 2527
359 Ga0495649_0001605 3300046694 Bacteria 16843
360 Ga0495649_0007717 3300046694 Bacteria 6533
361 Ga0495649_0030980 3300046694 Bacteria 2951
362 Ga0495649_0063406 3300046694 Bacteria 1985
363 Ga0495649_0077057 3300046694 Bacteria 1784
364 Ga0495649_0096825 3300046694 Bacteria 1570
365 Ga0495589_0001272 3300046794 Bacteria 14933
366 Ga0495589_0009447 3300046794 Bacteria 5072
367 Ga0495589_0034247 3300046794 Bacteria 2550
368 Ga0495600_0050439 3300046809 Bacteria 2715
369 Ga0495660_0001371 3300046810 Bacteria 16777
370 Ga0495660_0013784 3300046810 Bacteria 4684
371 Ga0495660_0019639 3300046810 Bacteria 3879
372 Ga0495660_0026805 3300046810 Bacteria 3263
373 Ga0495660_0030768 3300046810 Bacteria 3022
374 Ga0495660_0031006 3300046810 Bacteria 3008
375 Ga0495660_0032544 3300046810 Bacteria 2927
376 Ga0495660_0046326 3300046810 Bacteria 2384
377 Ga0495660_0095309 3300046810 Bacteria 1539
378 Ga0495660_0122569 3300046810 Bacteria 1313
379 Ga0495672_0019254 3300047320 Bacteria 4506
380 Ga0495672_0028094 3300047320 Bacteria 3565
381 Ga0495672_0040604 3300047320 Bacteria 2820
382 Ga0495676_0048737 3300047321 Bacteria 3412
383 Ga0495676_0057866 3300047321 Bacteria 3053
384 Ga0495680_0143054 3300047322 Bacteria 1748
385 Ga0495683_0000219 3300047323 Bacteria 53978
386 Ga0495683_0079642 3300047323 Bacteria 1599
387 Ga0495679_001326 3300047446 Bacteria 14358
388 Ga0495679_004751 3300047446 Bacteria 6159
389 Ga0495679_006773 3300047446 Bacteria 4876
390 Ga0495679_007777 3300047446 Bacteria 4427
391 Ga0495679_008106 3300047446 Bacteria 4300
392 Ga0495673_0002364 3300047469 Bacteria 13392
393 Ga0495673_0003187 3300047469 Bacteria 10966
394 Ga0495673_0010556 3300047469 Bacteria 5013
395 Ga0495673_0022765 3300047469 Bacteria 3063
396 Ga0495673_0026381 3300047469 Bacteria 2779
397 Ga0495673_0084882 3300047469 Bacteria 1304
398 Ga0495681_0012284 3300047470 Bacteria 5042
399 Ga0495681_0029738 3300047470 Bacteria 2791
400 Ga0495681_0030297 3300047470 Bacteria 2757
401 Ga0495681_0044294 3300047470 Bacteria 2140
402 Ga0495681_0080093 3300047470 Bacteria 1459
403 Ga0495684_0108409 3300047471 Bacteria 2097
404 Ga0495686_0052622 3300047472 Bacteria 2552
405 Ga0495686_0079140 3300047472 Bacteria 2011
406 Ga0495593_0036330 3300047673 Bacteria 2671
407 Ga0495602_0032448 3300048088 Bacteria 4916
408 Ga0495626_0001639 3300048091 Bacteria 17352
409 Ga0495626_0004825 3300048091 Bacteria 8128
410 Ga0495626_0026627 3300048091 Bacteria 2815
411 Ga0495626_0066716 3300048091 Bacteria 1626
412 Ga0496101_0351817 3300048904 Bacteria 1158
413 Ga0496110_0056402 3300048913 Bacteria 3457
414 Ga0496112_0045170 3300048915 Bacteria 4318
415 Ga0496114_0013286 3300048917 Bacteria 6600
416 Ga0496116_0000126 3300048919 Bacteria 160425
417 Ga0496116_0013365 3300048919 Bacteria 6626
418 Ga0496117_0000950 3300048920 Bacteria 44286
419 Ga0496117_0003179 3300048920 Bacteria 19524
420 Ga0496117_0008772 3300048920 Bacteria 9539
421 Ga0496117_0008900 3300048920 Bacteria 9460
422 Ga0496117_0010006 3300048920 Bacteria 8714
423 Ga0496118_0005407 3300048921 Bacteria 14531
424 Ga0496118_0009723 3300048921 Bacteria 9653
425 Ga0496118_0012212 3300048921 Bacteria 8273
426 Ga0496118_0154353 3300048921 Bacteria 1431
427 Ga0496119_0007398 3300048922 Bacteria 9902
428 Ga0496120_0005071 3300048923 Bacteria 10660
429 Ga0496120_0033312 3300048923 Bacteria 3096
430 Ga0496121_0000142 3300048924 Bacteria 160072
431 Ga0496121_0024828 3300048924 Bacteria 5716
432 Ga0496121_0026606 3300048924 Bacteria 5443
433 Ga0496121_0055606 3300048924 Bacteria 3295
434 Ga0496121_0058010 3300048924 Bacteria 3204
435 Ga0496122_0003666 3300048925 Bacteria 19940
436 Ga0496122_0005968 3300048925 Bacteria 14255
437 Ga0496122_0006314 3300048925 Bacteria 13653
438 Ga0496122_0099909 3300048925 Bacteria 1943
439 Ga0496122_0128376 3300048925 Bacteria 1617
440 Ga0496123_0001376 3300048926 Bacteria 34095
441 Ga0496123_0004116 3300048926 Bacteria 15589
442 Ga0496123_0027754 3300048926 Bacteria 4209
443 Ga0496123_0030008 3300048926 Bacteria 3989
444 Ga0496123_0061148 3300048926 Bacteria 2422
445 Ga0496124_0000145 3300048927 Bacteria 146878
446 Ga0496124_0006162 3300048927 Bacteria 13148
447 Ga0496124_0018471 3300048927 Bacteria 6528
448 Ga0496124_0027503 3300048927 Bacteria 5104
449 Ga0496124_0047626 3300048927 Bacteria 3666
450 Ga0496124_0067435 3300048927 Bacteria 2977
451 Ga0496124_0072026 3300048927 Bacteria 2862
452 Ga0496124_0125791 3300048927 Bacteria 2042
453 Ga0496124_0150907 3300048927 Bacteria 1823
454 Ga0496125_0000439 3300048928 Bacteria 75971
455 Ga0496125_0009144 3300048928 Bacteria 10248
456 Ga0496125_0027716 3300048928 Bacteria 5128
457 Ga0496125_0056410 3300048928 Bacteria 3190
458 Ga0496125_0079966 3300048928 Bacteria 2504
459 Ga0496125_0100061 3300048928 Bacteria 2138
460 Ga0496125_0159787 3300048928 Bacteria 1532
461 Ga0496126_0043455 3300048929 Bacteria 4145
462 Ga0496126_0060157 3300048929 Bacteria 3417
463 Ga0496126_0068457 3300048929 Bacteria 3169
464 Ga0495678_000039 3300049459 Bacteria 191665
465 Ga0495678_022159 3300049459 Bacteria 2783
466 Ga0495678_022306 3300049459 Bacteria 2770
467 Ga0495678_025381 3300049459 Bacteria 2545
468 Ga0495678_035340 3300049459 Bacteria 2049
469 Ga0495682_0000748 3300049460 Bacteria 20982
470 Ga0501034_0000020 3300049571 Bacteria 280294
471 Ga0501240_001822 3300049673 Bacteria 2152
472 Ga0501226_000005 3300049853 Bacteria 271019
473 nmdc:mga00v17_40896_c1 3300050491 Bacteria 2071
474 Ga0500572_005459 3300053111 Bacteria 2881
475 Ga0500621_050656 3300053126 Bacteria 1681
476 Ga0500659_0001441 3300053135 Bacteria 15093
477 Ga0500634_0008096 3300053161 Bacteria 5234
478 2511265926 2511231006 Bacteria 6794709
479 2511291819 2511231010 Bacteria 6373152
480 2511414619 2511231031 Bacteria 6558529
481 2512326414 2512047018 Bacteria 6663241
482 2554817185 2554235132 Bacteria 6772433
483 2555248934 2554235231 Bacteria 5215788
484 2555668320 2554235341 Bacteria 6867980
485 2583790701 2582580891 Bacteria 6800976
486 2597856532 2597489887 Bacteria 6666321
487 2597862649 2597489888 Bacteria 6179543
488 2597868492 2597489889 Bacteria 6297495
489 2599331241 2599185155 Bacteria 5827168
490 2599355321 2599185160 Bacteria 6844013
491 2599360859 2599185161 Bacteria 6960462
492 2599367181 2599185162 Bacteria 6957254
493 2599373971 2599185163 Bacteria 6995158
494 2599380427 2599185164 Bacteria 6841688
495 2599386874 2599185165 Bacteria 6843250
496 2599392829 2599185166 Bacteria 6959206
497 2599396749 2599185167 Bacteria 6353609
498 2599404596 2599185168 Bacteria 6997636
499 2599448735 2599185179 Bacteria 6611171
500 2599462155 2599185181 Bacteria 6844519
501 2599466802 2599185182 Bacteria 6883168
502 2599483215 2599185185 Bacteria 6652270
503 2599490753 2599185186 Bacteria 6831633
504 2599501477 2599185188 Bacteria 6164180
505 2599507719 2599185189 Bacteria 5862825
506 2599511506 2599185190 Bacteria 6285678
507 2599517546 2599185191 Bacteria 6297582
508 2599615438 2599185212 Bacteria 6765997
509 2599805114 2599185257 Bacteria 6492581
510 2599879956 2599185288 Bacteria 6666191
511 2599890880 2599185290 Bacteria 6289611
512 2599931776 2599185300 Bacteria 6062622
513 2599945457 2599185302 Bacteria 5954930
514 2599948463 2599185303 Bacteria 6512725
515 2599956575 2599185304 Bacteria 5951361
516 2599968316 2599185306 Bacteria 6637356
517 2599979503 2599185308 Bacteria 6621546
518 2599985503 2599185309 Bacteria 5969593
519 2599992295 2599185310 Bacteria 6014457
520 2599997800 2599185311 Bacteria 6354990
521 2600002457 2599185312 Bacteria 5912071
522 2600013315 2599185314 Bacteria 6621749
523 2600026138 2599185316 Bacteria 6320029
524 2600031497 2599185317 Bacteria 6435722
525 2600036424 2599185318 Bacteria 6961590
526 2600044974 2599185319 Bacteria 6637840
527 2600049990 2599185320 Bacteria 5963263
528 2600061938 2599185322 Bacteria 6763055
529 2600067165 2599185323 Bacteria 6688755
530 2600080116 2599185325 Bacteria 6324919
531 2600214777 2599185356 Bacteria 6843884
532 2600361298 2600254930 Bacteria 6431253
533 2600363824 2600254931 Bacteria 6734225
534 2601691226 2600255296 Bacteria 5784754
535 2601774518 2600255313 Bacteria 6842543
536 2608383021 2606217733 Bacteria 6360972
537 2621301221 2619619299 Bacteria 6649820
538 2643873141 2643221571 Bacteria 6228673
539 2644624322 2643221713 Bacteria 6554480
540 2652546865 2651869719 Bacteria 6047974
541 2671097923 2667528171 Bacteria 6900659
542 2671127726 2667528176 Bacteria 6724917
543 2671768152 2671180172 Bacteria 6495783
544 2677897378 2675903420 Bacteria 6247433
545 2678261901 2675903515 Bacteria 6580491
546 2715753024 2713897148 Bacteria 5883533
547 2723247525 2721755607 Bacteria 5841722
548 2738674010 2738541265 Bacteria 6594665
549 2738752403 2738541282 Bacteria 6593925
550 2738809422 2738541294 Bacteria 6925949
551 2738861444 2738541303 Bacteria 6591772
552 2738896782 2738541309 Bacteria 6926455
553 2739286431 2738543020 Bacteria 5718238
554 2739291744 2738543021 Bacteria 5718241
555 2743735948 2740892503 Bacteria 6855563
556 2745008249 2744054620 Bacteria 6551379
557 2765585781 2765235841 Bacteria 6137024
558 2794596062 2791355520 Bacteria 5948615
559 2807406795 2806310737 Bacteria 5751088
560 2807455127 2806310745 Bacteria 5742165
561 2808904774 2808606373 Bacteria 4423627
562 2808975579 2808606385 Bacteria 6711065
563 2808990782 2808606388 Bacteria 6706662
564 2812368474 2811994881 Bacteria 6298475
565 2817489415 2816332298 Bacteria 6852809
566 2819703007 2818991464 Bacteria 6907494
567 2825653376 2825651385 Bacteria 6715909
568 2826585613 2826581358 Bacteria 5963467
569 2834029326 2834028612 Bacteria 6354979
570 2842808799 2842805378 Bacteria 5385175
571 2842818471 2842815866 Bacteria 5947510
572 2842830257 2842826826 Bacteria 5974129
573 2842839929 2842837860 Bacteria 6066181
574 2842853172 2842849001 Bacteria 5924277
575 2842860028 2842854478 Bacteria 6143501
576 2844668843 2844665904 Bacteria 6817974
577 2852615187 2852612431 Bacteria 6885235
578 2852670155 2852667396 Bacteria 6885555
579 2860869369 2860867994 Bacteria 5645326
580 2908448239 2908446538 Bacteria 6829095
581 2917072087 2917070673 Bacteria 6868303
582 2919481514 2919481497 Bacteria 6907839
583 2919491801 2919487758 Bacteria 5929766
584 2923154958 2923153595 Bacteria 6870622
585 2923522531 2923519811 Bacteria 6298479
586 2929191344 2929189879 Bacteria 5930554
587 2931370976 2931369376 Bacteria 6847892
588 2931392346 2931390751 Bacteria 6273349
589 2935354259 2935353572 Unclassified 6955622
590 2939652544 2939651529 Bacteria 5895393
591 2945929234 2945928738 Bacteria 6053221
592 2945961597 2945961074 Bacteria 7342064
593 2946011497 2946006987 Bacteria 6705746
594 2946029564 2946027586 Bacteria 6049274
595 2947236159 2947233263 Bacteria 6439278
596 2969305904 2969304461 Bacteria 6601805
597 2974292483 2974289157 Bacteria 6080362
598 2984291072 2984286254 Bacteria 6702062
599 2998141324 2998139840 Bacteria 6073514
600 3007400485 3007395558 Bacteria 6755444
601 3007420956 3007419365 Bacteria 7026924
602 3007614939 3007614139 Bacteria 6053559
603 3007722979 3007718800 Bacteria 5971527
604 3007805215 3007803356 Bacteria 5931491
605 3007855937 3007855910 Bacteria 5637581
606 3007870686 3007866637 Bacteria 5899198
607 637318682 637000220 Bacteria 7074893
608 8015689190 8015687852 Bacteria 6613826
609 8019770878 8019769354 Bacteria 6924660
610 8029999422 8029995093 Bacteria 5990776
611 8052499042 8052494512 Bacteria 5765634
612 8054288805 8054285046 Bacteria 6919322
613 8054348899 8054347763 Bacteria 5901107
614 8054504910 8054503363 Bacteria 6101651
615 8054933150 8054929484 Bacteria 5599761
616 8055772310 8055770955 Bacteria 6827675
617 8055819369 8055817908 Bacteria 6609162
618 8056117326 8056115690 Bacteria 5527654
619 8056124971 8056120720 Bacteria 5758328
620 8056133277 8056131705 Bacteria 6107031
621 8056138475 8056137416 Bacteria 6147080
622 8056147588 8056143049 Bacteria 6307666
623 8056149519 8056148874 Bacteria 6479865
624 8056164685 8056161164 Bacteria 6106669
625 8056169731 8056166840 Bacteria 5820959
626 8056175838 8056172158 Bacteria 6133900
627 8057803631 8057798959 Bacteria 6713499
628 Ga0157370_10000055
629 JGI25162J39368_1000054
630 JGI25162J39368_1000132
631 JGI25163J39215_1000196
632 JGI25163J39215_1000501
633 JGI25164J39214_1000029
634 JGI25164J39214_1000106
635 JGI25165J46597_1000111
636 JGI25165J46597_1000217
637 Ga0055538_1000082
638 Ga0055539_1000121
639 Ga0055533_1000129
640 Ga0055532_1000104
641 Ga0055525_1000167
642 Ga0055535_1004640
643 Ga0055536_1000043
644 Ga0055536_1000351
645 Ga0055530_10000031
646 Ga0055530_10000383
647 Ga0055540_1000230
648 Ga0055540_1000341
649 Ga0055541_1000081
650 Ga0065714_10065614
651 Ga0065714_10140945
652 Ga0065704_10002628
653 Ga0065704_10090744
654 Ga0065704_10094696
655 Ga0065712_10068085
656 Ga0065712_10070272
657 Ga0070670_100003000
658 Ga0070661_100000238
659 Ga0070669_100000150
660 Ga0070662_100003244
661 Ga0068853_100093210
662 Ga0070665_100019898
663 Ga0070665_100083065
664 Ga0070664_100001048
665 Ga0068854_100003503
666 Ga0068851_10000182
667 Ga0075364_10111091
668 Ga0075432_10000336
669 Ga0099823_1000062
670 Ga0079104_1000134
671 Ga0079104_1006226
672 Ga0099826_10028717
673 Ga0105251_10000004
674 Ga0105251_10000519
675 Ga0105251_10009608
676 Ga0105251_10011273
677 Ga0105251_10014616
678 Ga0105251_10030980
679 Ga0105244_10005059
680 Ga0105244_10005631
681 Ga0105244_10006175
682 Ga0105244_10006499
683 Ga0105244_10009033
684 Ga0105244_10010658
685 Ga0105244_10012170
686 Ga0105244_10013498
687 Ga0105244_10019511
688 Ga0105244_10027330
689 Ga0105244_10027364
690 Ga0105244_10033797
691 Ga0105250_10000118
692 Ga0105250_10000179
693 Ga0105250_10004447
694 Ga0105243_10000450
695 Ga0105243_10012626
696 Ga0105243_10021987
697 Ga0105243_10053071
698 Ga0105242_10003316
699 Ga0105237_10001417
700 Ga0105246_10007263
701 Ga0157345_1000317
702 Ga0157373_10000309
703 Ga0157373_10006208
704 Ga0157373_10029742
705 Ga0157373_10034929
706 Ga0157373_10046460
707 Ga0157373_10120230
708 Ga0157373_10172798
709 Ga0157371_10000795
710 Ga0157371_10018410
711 Ga0157370_10101827
712 Ga0157369_10010798
713 Ga0157369_10014243
714 Ga0157369_10022032
715 Ga0157369_10050325
716 Ga0157369_10082425
717 Ga0163162_10001527
718 Ga0157375_10000770
719 Ga0157375_10212776
720 Ga0182008_10000138
721 Ga0182008_10003721
722 Ga0182006_1004515
723 Ga0182006_1012362
724 Ga0182006_1021529
725 Ga0163161_10009779
726 Ga0163161_10083508
727 Ga0163161_10129614
728 Ga0163161_10238456
729 Ga0209435_100662
730 Ga0209760_100015
731 Ga0209760_100047
732 Ga0209784_100015
733 Ga0209566_100012
734 Ga0209674_100027
735 Ga0209147_100019
736 Ga0209563_100031
737 Ga0209563_102306
738 Ga0207427_100001
739 Ga0207427_100029
740 Ga0209437_100003
741 Ga0209437_100009
742 Ga0209437_104508
743 Ga0209258_100250
744 Ga0209646_1000263
745 Ga0209677_100016
746 Ga0209759_1015996
747 Ga0209233_1000007
748 Ga0209233_1000032
749 Ga0209676_1000033
750 Ga0209676_1000080
751 Ga0209676_1000181
752 Ga0209676_1009528
753 Ga0209050_1000009
754 Ga0209050_1000117
755 Ga0209051_1000053
756 Ga0209051_1000077
757 Ga0207656_10000026
758 Ga0207696_1000022
759 Ga0207696_1000044
760 Ga0207696_1000111
761 Ga0207696_1002980
762 Ga0207655_1000005
763 Ga0207655_1000435
764 Ga0207655_1001682
765 Ga0207655_1002331
766 Ga0207655_1004894
767 Ga0207655_1007033
768 Ga0207655_1012259
769 Ga0207655_1023411
770 Ga0207655_1048349
771 Ga0207713_1000013
772 Ga0207713_1000574
773 Ga0207713_1002530
774 Ga0207713_1008926
775 Ga0207713_1010066
776 Ga0207713_1022654
777 Ga0207713_1026062
778 Ga0207671_10000436
779 Ga0207649_10000002
780 Ga0207681_10000475
781 Ga0207650_10000341
782 Ga0207650_10000543
783 Ga0207686_10003220
784 Ga0207709_10000278
785 Ga0207709_10004751
786 Ga0207709_10009627
787 Ga0207679_10000006
788 Ga0207639_10075164
789 Ga0209281_1000172
790 Ga0209281_1004255
791 Ga0209281_1007354
792 Ga0209281_1019052
793 Ga0209389_1000005
794 Ga0209371_1000842
795 Ga0207428_10170734
796 Ga0268266_10004538
797 Ga0268266_10103348
798 Ga0268256_1000779
799 Ga0314311_1016558
800 Ga0316178_1121715
801 Ga0316183_1196223
802 Ga0316183_1205945
803 Ga0316181_1002344
804 Ga0265340_10061335
805 Ga0265316_10172908
806 Ga0307408_100000653
807 Ga0307405_10000489
808 Ga0307405_10007647
809 Ga0307405_10008680
810 Ga0307413_10053048
811 Ga0307406_10019318
812 Ga0307412_10001818
813 Ga0307412_10012714
814 Ga0307412_10038731
815 Ga0307412_10076585
816 Ga0307412_10127412
817 Ga0307409_100169180
818 Ga0307414_10232641
819 Ga0307411_10023183
820 Ga0307411_10055766
821 Ga0307510_10031786
822 Ga0439438_001959
823 Ga0439438_004047
824 Ga0439438_004550
825 Ga0439438_004944
826 Ga0439447_003016
827 Ga0439447_007174
828 Ga0439447_008598
829 Ga0439447_035774
830 Ga0439466_0000109
831 Ga0439466_0001687
832 Ga0439466_0002735
833 Ga0439466_0022972
834 Ga0439466_0039153
835 Ga0439431_0001788
836 Ga0439437_000317
837 Ga0439432_002225
838 Ga0439432_008384
839 Ga0439432_017733
840 Ga0439451_000747
841 Ga0439451_005394
842 Ga0439452_000047
843 Ga0439452_005638
844 Ga0439452_022367
845 Ga0439456_000236
846 Ga0439456_003084
847 Ga0439456_003130
848 Ga0439463_000470
849 Ga0450911_000008
850 Ga0450911_001166
851 Ga0450917_002819
852 Ga0450902_000048
853 Ga0450905_000032
854 Ga0450906_004060
855 Ga0450910_001588
856 Ga0450909_002018
857 Ga0439459_0004407
858 Ga0495617_014353
859 Ga0495617_014602
860 Ga0495617_027069
861 Ga0495617_037439
862 Ga0495627_002079
863 Ga0495627_004422
864 Ga0495627_005489
865 Ga0495627_005498
866 Ga0495590_0010583
867 Ga0495591_002494
868 Ga0495591_008262
869 Ga0495591_010368
870 Ga0495591_013002
871 Ga0495591_013103
872 Ga0495591_017646
873 Ga0495653_0032718
874 Ga0495653_0092924
875 Ga0495650_0005934
876 Ga0495650_0006445
877 Ga0495605_0000016
878 Ga0495605_0000031
879 Ga0495605_0006884
880 Ga0495584_0022969
881 Ga0495584_0031869
882 Ga0495584_0035880
883 Ga0495585_0015905
884 Ga0495585_0031336
885 Ga0495585_0071382
886 Ga0495594_0011345
887 Ga0495596_0029772
888 Ga0495607_0014593
889 Ga0495607_0035323
890 Ga0495607_0041290
891 Ga0495607_0132279
892 Ga0495607_0179726
893 Ga0495583_0000041
894 Ga0495583_0002147
895 Ga0495583_0008721
896 Ga0495583_0011476
897 Ga0495606_0000518
898 Ga0495606_0007473
899 Ga0495606_0031442
900 Ga0495606_0046178
901 Ga0495606_0063822
902 Ga0495606_0101388
903 Ga0495610_0009356
904 Ga0495610_0010391
905 Ga0495610_0012134
906 Ga0495610_0014085
907 Ga0495610_0035212
908 Ga0495616_0003419
909 Ga0495616_0011323
910 Ga0495616_0026953
911 Ga0495616_0043606
912 Ga0495620_0000036
913 Ga0495620_0002402
914 Ga0495620_0009912
915 Ga0495620_0010866
916 Ga0495620_0023458
917 Ga0495620_0045604
918 Ga0495631_0011499
919 Ga0495631_0021085
920 Ga0495632_0000300
921 Ga0495632_0002650
922 Ga0495632_0026753
923 Ga0495632_0031941
924 Ga0495632_0039401
925 Ga0495637_0008140
926 Ga0495637_0018640
927 Ga0495637_0023608
928 Ga0495637_0055290
929 Ga0495643_0000116
930 Ga0495643_0000973
931 Ga0495643_0002157
932 Ga0495643_0009775
933 Ga0495643_0013310
934 Ga0495643_0031781
935 Ga0495643_0037214
936 Ga0495643_0048903
937 Ga0495644_0014545
938 Ga0495648_0000482
939 Ga0495648_0002901
940 Ga0495648_0015782
941 Ga0495648_0027473
942 Ga0495648_0034587
943 Ga0495648_0036283
944 Ga0495648_0040810
945 Ga0495648_0041042
946 Ga0495654_0002768
947 Ga0495654_0009317
948 Ga0495654_0010481
949 Ga0495654_0013010
950 Ga0495654_0032980
951 Ga0495654_0041534
952 Ga0495654_0090797
953 Ga0495587_0138761
954 Ga0495609_0000015
955 Ga0495609_0000050
956 Ga0495609_0008507
957 Ga0495609_0008604
958 Ga0495609_0034684
959 Ga0495597_0002994
960 Ga0495597_0020765
961 Ga0495622_0019233
962 Ga0495622_0168166
963 Ga0495633_0000363
964 Ga0495633_0023784
965 Ga0495668_0015749
966 Ga0495668_0021021
967 Ga0495668_0042222
968 Ga0495634_0042913
969 Ga0495611_0004875
970 Ga0495625_0019384
971 Ga0495625_0021151
972 Ga0495625_0072542
973 Ga0495661_0000046
974 Ga0495661_0000419
975 Ga0495661_0012029
976 Ga0495661_0038712
977 Ga0495661_0048829
978 Ga0495646_0129497
979 Ga0495613_0026485
980 Ga0495624_0015665
981 Ga0495670_0008312
982 Ga0495671_0007510
983 Ga0495671_0026350
984 Ga0495671_0027028
985 Ga0495671_0035590
986 Ga0495649_0001605
987 Ga0495649_0007717
988 Ga0495649_0030980
989 Ga0495649_0063406
990 Ga0495649_0077057
991 Ga0495649_0096825
992 Ga0495589_0001272
993 Ga0495589_0009447
994 Ga0495589_0034247
995 Ga0495600_0050439
996 Ga0495660_0001371
997 Ga0495660_0013784
998 Ga0495660_0019639
999 Ga0495660_0026805
1000 Ga0495660_0030768
1001 Ga0495660_0031006
1002 Ga0495660_0032544
1003 Ga0495660_0046326
1004 Ga0495660_0095309
1005 Ga0495660_0122569
1006 Ga0495672_0019254
1007 Ga0495672_0028094
1008 Ga0495672_0040604
1009 Ga0495676_0048737
1010 Ga0495676_0057866
1011 Ga0495680_0143054
1012 Ga0495683_0000219
1013 Ga0495683_0079642
1014 Ga0495679_001326
1015 Ga0495679_004751
1016 Ga0495679_006773
1017 Ga0495679_007777
1018 Ga0495679_008106
1019 Ga0495673_0002364
1020 Ga0495673_0003187
1021 Ga0495673_0010556
1022 Ga0495673_0022765
1023 Ga0495673_0026381
1024 Ga0495673_0084882
1025 Ga0495681_0012284
1026 Ga0495681_0029738
1027 Ga0495681_0030297
1028 Ga0495681_0044294
1029 Ga0495681_0080093
1030 Ga0495684_0108409
1031 Ga0495686_0052622
1032 Ga0495686_0079140
1033 Ga0495593_0036330
1034 Ga0495602_0032448
1035 Ga0495626_0001639
1036 Ga0495626_0004825
1037 Ga0495626_0026627
1038 Ga0495626_0066716
1039 Ga0496101_0351817
1040 Ga0496110_0056402
1041 Ga0496112_0045170
1042 Ga0496114_0013286
1043 Ga0496116_0000126
1044 Ga0496116_0013365
1045 Ga0496117_0000950
1046 Ga0496117_0003179
1047 Ga0496117_0008772
1048 Ga0496117_0008900
1049 Ga0496117_0010006
1050 Ga0496118_0005407
1051 Ga0496118_0009723
1052 Ga0496118_0012212
1053 Ga0496118_0154353
1054 Ga0496119_0007398
1055 Ga0496120_0005071
1056 Ga0496120_0033312
1057 Ga0496121_0000142
1058 Ga0496121_0024828
1059 Ga0496121_0026606
1060 Ga0496121_0055606
1061 Ga0496121_0058010
1062 Ga0496122_0003666
1063 Ga0496122_0005968
1064 Ga0496122_0006314
1065 Ga0496122_0099909
1066 Ga0496122_0128376
1067 Ga0496123_0001376
1068 Ga0496123_0004116
1069 Ga0496123_0027754
1070 Ga0496123_0030008
1071 Ga0496123_0061148
1072 Ga0496124_0000145
1073 Ga0496124_0006162
1074 Ga0496124_0018471
1075 Ga0496124_0027503
1076 Ga0496124_0047626
1077 Ga0496124_0067435
1078 Ga0496124_0072026
1079 Ga0496124_0125791
1080 Ga0496124_0150907
1081 Ga0496125_0000439
1082 Ga0496125_0009144
1083 Ga0496125_0027716
1084 Ga0496125_0056410
1085 Ga0496125_0079966
1086 Ga0496125_0100061
1087 Ga0496125_0159787
1088 Ga0496126_0043455
1089 Ga0496126_0060157
1090 Ga0496126_0068457
1091 Ga0495678_000039
1092 Ga0495678_022159
1093 Ga0495678_022306
1094 Ga0495678_025381
1095 Ga0495678_035340
1096 Ga0495682_0000748
1097 Ga0501034_0000020
1098 Ga0501240_001822
1099 Ga0501226_000005
1100 nmdc:mga00v17_40896_c1
1101 Ga0500572_005459
1102 Ga0500621_050656
1103 Ga0500659_0001441
1104 Ga0500634_0008096
1105 2511265926
1106 2511291819
1107 2511414619
1108 2512326414
1109 2554817185
1110 2555248934
1111 2555668320
1112 2583790701
1113 2597856532
1114 2597862649
1115 2597868492
1116 2599331241
1117 2599355321
1118 2599360859
1119 2599367181
1120 2599373971
1121 2599380427
1122 2599386874
1123 2599392829
1124 2599396749
1125 2599404596
1126 2599448735
1127 2599462155
1128 2599466802
1129 2599483215
1130 2599490753
1131 2599501477
1132 2599507719
1133 2599511506
1134 2599517546
1135 2599615438
1136 2599805114
1137 2599879956
1138 2599890880
1139 2599931776
1140 2599945457
1141 2599948463
1142 2599956575
1143 2599968316
1144 2599979503
1145 2599985503
1146 2599992295
1147 2599997800
1148 2600002457
1149 2600013315
1150 2600026138
1151 2600031497
1152 2600036424
1153 2600044974
1154 2600049990
1155 2600061938
1156 2600067165
1157 2600080116
1158 2600214777
1159 2600361298
1160 2600363824
1161 2601691226
1162 2601774518
1163 2608383021
1164 2621301221
1165 2643873141
1166 2644624322
1167 2652546865
1168 2671097923
1169 2671127726
1170 2671768152
1171 2677897378
1172 2678261901
1173 2715753024
1174 2723247525
1175 2738674010
1176 2738752403
1177 2738809422
1178 2738861444
1179 2738896782
1180 2739286431
1181 2739291744
1182 2743735948
1183 2745008249
1184 2765585781
1185 2794596062
1186 2807406795
1187 2807455127
1188 2808904774
1189 2808975579
1190 2808990782
1191 2812368474
1192 2817489415
1193 2819703007
1194 2825653376
1195 2826585613
1196 2834029326
1197 2842808799
1198 2842818471
1199 2842830257
1200 2842839929
1201 2842853172
1202 2842860028
1203 2844668843
1204 2852615187
1205 2852670155
1206 2860869369
1207 2908448239
1208 2917072087
1209 2919481514
1210 2919491801
1211 2923154958
1212 2923522531
1213 2929191344
1214 2931370976
1215 2931392346
1216 2935354259
1217 2939652544
1218 2945929234
1219 2945961597
1220 2946011497
1221 2946029564
1222 2947236159
1223 2969305904
1224 2974292483
1225 2984291072
1226 2998141324
1227 3007400485
1228 3007420956
1229 3007614939
1230 3007722979
1231 3007805215
1232 3007855937
1233 3007870686
1234 637318682
1235 8015689190
1236 8019770878
1237 8029999422
1238 8052499042
1239 8054288805
1240 8054348899
1241 8054504910
1242 8054933150
1243 8055772310
1244 8055819369
1245 8056117326
1246 8056124971
1247 8056133277
1248 8056138475
1249 8056147588
1250 8056149519
1251 8056164685
1252 8056169731
1253 8056175838
1254 8057803631

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00144

Beta-lactamase

Beta-lactamase

43

365

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
8dc1-assembly1.cif.gz_A structural and biochemical characterization of l. interrogans lsa45 reveals a penicillin-binding protein with esterase activity 0.8384 24 358
3vwp-assembly1.cif.gz_A-2 crystal structure of 6-aminohexanoate-dimer hydrolase s112a/g181d/r187s/h266n/d370y mutant complexd with 6-aminohexanoate 0.8125 39 358
3vwr-assembly1.cif.gz_A-2 crystal structure of 6-aminohexanoate-dimer hydrolase s112a/g181d/r187g/h266n/d370y mutant complexd with 6-aminohexanoate 0.812 39 358
2zm8-assembly1.cif.gz_A structure of 6-aminohexanoate-dimer hydrolase, s112a/d370y mutant complexed with 6-aminohexanoate-dimer 0.8108 39 358
3vwm-assembly1.cif.gz_A-2 crystal structure of 6-aminohexanoate-dimer hydrolase g181d/r187a/h266n/d370y mutant 0.8105 39 358
ID Description Score Start End Superfamily
3i7jB00 Alpha Beta;3-Layer(aba) Sandwich;Beta-lactamase;DD-peptidase/beta-lactamase superfamily 0.7943 37 362 3.40.710.10
3i7jB00 Alpha Beta;3-Layer(aba) Sandwich;Beta-lactamase;DD-peptidase/beta-lactamase superfamily 0.7916 37 362 3.40.710.10
4ivkA00 Alpha Beta;3-Layer(aba) Sandwich;Beta-lactamase;DD-peptidase/beta-lactamase superfamily 0.781 32 359 3.40.710.10
1wybA02 Alpha Beta;3-Layer(aba) Sandwich;Beta-lactamase;DD-peptidase/beta-lactamase superfamily 0.7776 31 358 3.40.710.10
af_P9WLZ3_5_376_3.40.710.10 Alpha Beta;3-Layer(aba) Sandwich;Beta-lactamase;DD-peptidase/beta-lactamase superfamily 0.775 62 340 3.40.710.10
ID Description Score Start End GO Terms
AF-A0A6L3MDD6-F1-model_v4 deleted 0.973 195 365
AF-A0A7U6M610-F1-model_v4 Beta-lactamase-related domain-containing protein 0.9667 16 360
AF-A0A3D4NG33-F1-model_v4 Serine hydrolase 0.965 72 365 GO:0016787
AF-A0A3D4NG33-F1-model_v4 Serine hydrolase 0.9618 72 365 GO:0016787
AF-A0A6L3MDD6-F1-model_v4 deleted 0.9616 195 365

Map