F470418

General Info

Members Datasets Scaffolds Average Seq Length
625 338 1251 243

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|3006425503|3006428799
Length 243
Sequence TQAVILAGGQGSRLRPYTDDRPKPMVEIPGTGTPIIGHQLAWLADEGVTDVVVSCGHLAEVLQSWLAEAGEWLPLRITTVVEDEPLGRGGGLKLAAASLPHPGRPWYATNSDVWTRFSLREMAAFHQERDAVATLALARPRIPWGVVETNAFGHVLDFIEAPPSPYPVNAGVYVFSPSFAGLLPDRGDHERTTFPRLARDRRLAGYPLPLGAYWRAIDTAKDLAKAAEELAGLRGSDPSTPEG

Samples

Sample ID Description Type Environment
1 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
2 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
10 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
11 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
12 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
13 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
14 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
15 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
16 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
17 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
18 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
19 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
20 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
21 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
22 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
23 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
24 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
25 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
26 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
27 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
28 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
29 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
30 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
31 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
32 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
33 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
34 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
35 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
42 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
45 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
46 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
48 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
49 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
50 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
51 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
52 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
53 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
54 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
55 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
56 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
57 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
58 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
59 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
60 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
61 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
62 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
63 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
64 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
65 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
66 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
67 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
68 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
69 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
70 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
71 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
72 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
73 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
74 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
75 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
76 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
77 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
78 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
79 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
80 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
81 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
82 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
83 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
84 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
85 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
86 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
87 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
88 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
89 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
90 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
91 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
92 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
93 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
94 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
95 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
96 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
97 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
98 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
99 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
100 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
101 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
102 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
103 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
104 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
105 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
106 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
107 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
108 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
109 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
110 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
111 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
112 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
113 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
114 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
115 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
116 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
117 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
118 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
119 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
120 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
121 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
122 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
123 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
124 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
125 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
126 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
127 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
128 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
129 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
130 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
131 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
132 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
133 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
134 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
135 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
136 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
137 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
138 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
139 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
140 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
141 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
142 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
143 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
144 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
145 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
146 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
147 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
148 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
149 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
150 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
151 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
152 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
153 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
154 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
155 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
156 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
157 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
158 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
159 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
160 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
161 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
162 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
163 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
164 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
165 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
166 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
167 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
168 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
169 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
170 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
171 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
172 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
173 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
174 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
175 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
176 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
177 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
178 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
179 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
180 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
181 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
182 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
183 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
184 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
185 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
186 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
187 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
188 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
189 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
190 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
191 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
192 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
193 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
194 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
195 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
196 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
197 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
198 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
199 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
200 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
201 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
202 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
203 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
204 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
205 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
206 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
207 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
208 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
209 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
210 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
211 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
212 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
213 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
214 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
215 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
216 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
217 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
218 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
219 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
220 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
221 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
222 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
223 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
224 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
225 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
226 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
227 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
228 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
229 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
230 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
231 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
232 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
233 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
234 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
235 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
236 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
237 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
238 3006425503 Streptomyces zingiberis PLAI1-29 Isolate Unclassified
239 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
240 2554235005 Streptomyces violaceusniger SPC6 Isolate Rhizosphere
241 2582581312 Streptomyces atratus OK008 Isolate Rhizosphere
242 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
243 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
244 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
245 2616644941 Streptomyces atratus OK807 Isolate Rhizosphere
246 2643221548 Streptomyces sp. Root55 Isolate Unclassified
247 2643221578 Streptomyces sp. Root63 Isolate Unclassified
248 2643221587 Streptomyces sp. Root66D1 Isolate Unclassified
249 2643221601 Kitasatospora sp. Root187 Isolate Unclassified
250 2643221631 Kitasatospora sp. Root107 Isolate Unclassified
251 2643221647 Streptomyces sp. Root369 Isolate Unclassified
252 2643221670 Streptomyces sp. Root431 Isolate Unclassified
253 2643221673 Streptomyces sp. Root1295 Isolate Unclassified
254 2643221677 Streptomyces sp. Root1304 Isolate Unclassified
255 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
256 2643221682 Streptomyces sp. Root1319 Isolate Unclassified
257 2643221714 Streptomyces sp. Root264 Isolate Unclassified
258 2767802112 Streptomyces avicenniae NRRL B-24776 Isolate Rhizosphere
259 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
260 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
261 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
262 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
263 2791355406 Streptomyces rhizosphaericus NRRL B-24304 Isolate Unclassified
264 2802429296 Streptomyces sampsonii KJ40 Isolate Rhizosphere
265 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
266 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
267 2808606448 Streptomyces sp. 193411 Isolate Unclassified
268 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
269 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
270 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
271 2818991463 Streptomyces argenteolus 3259 Isolate Rhizosphere
272 2818991472 Kitasatospora viridis DSM 44826 Isolate Rhizosphere
273 2837268691 Jiangella endophytica KE2-3 Isolate Rhizosphere
274 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
275 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
276 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
277 2862290372 Streptomyces triticagri NEAU-YY421 Isolate Rhizosphere
278 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
279 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
280 2862574272 Streptomyces sp. AcE210 Isolate Nodule
281 2862705112 Streptomyces triticirhizae NEAU-YY642 Isolate Rhizosphere
282 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
283 2867346516 Streptomyces radicis AZ1-7 Isolate Unclassified
284 2867428634 Streptomyces sp. RP5T Isolate Unclassified
285 2867475112 Streptomyces sp. TM32 Isolate Unclassified
286 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
287 2875391855 Streptomyces cavourensis 1AS2a Isolate Rhizosphere
288 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
289 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
290 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
291 2912757875 Streptomyces sp. S4.7 Isolate Rhizosphere
292 2918501144 Streptomyces sp. PvR006 Isolate Rhizosphere
293 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
294 2935390628 Streptomyces sp. PvR034 Isolate Rhizosphere
295 2946045630 Streptomyces sp. W4I9-2 Isolate Rhizosphere
296 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
297 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
298 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
299 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
300 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
301 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
302 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
303 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
304 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
305 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
306 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
307 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
308 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
309 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
310 2966598605 Kitasatospora papulosa SLBN-177 Isolate Rhizosphere
311 2990044586 Streptomyces sedi JCM 16909 Isolate Unclassified
312 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
313 2990088156 Streptomyces albidus CAP 215 Isolate Unclassified
314 2995463766 Streptacidiphilus fuscans NEAU-YB345 Isolate Unclassified
315 2997451912 Streptomyces piniterrae jys28 Isolate Rhizosphere
316 2997600082 Streptomyces coffeae CA1R205 Isolate Unclassified
317 3006321560 Actinacidiphila epipremni PRB2-1 Isolate Unclassified
318 3006393351 Streptomyces sp. SID4985 Isolate Unclassified
319 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
320 8008485437 Streptomyces mimosae 3MP-10 Isolate Unclassified
321 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
322 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
323 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
324 8025413630 Streptomyces sp. CAI-17 Isolate Rhizosphere
325 8025478263 Streptomyces telluris AA8 Isolate Rhizosphere
326 8025524527 Streptomyces sp. 3MP-14 Isolate Unclassified
327 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified
328 8033684223 Streptomyces phytophilus PIP175 Isolate Unclassified
329 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
330 8048127548 Streptomyces samsunensis DSM 42010 Isolate Rhizosphere
331 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
332 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
333 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere
334 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
335 8054160619 Streptomyces rhizoryzae RS10V-4 Isolate Rhizosphere
336 8056447290 Streptomyces huiliensis SCA2-4 Isolate Rhizosphere
337 8056667051 Streptomyces sichuanensis SCA3-4 Isolate Rhizosphere
338 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 83.84
Metatranscriptomes 0
Isolates 16.16

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.44
Nodule 0.48
Rhizoplane 1.92
Rhizosphere 78.72
Stem 0
Stem Tuber 0
Unclassified 0.48

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10052045 3300001989 Bacteria 1318
2 JGI24738J21930_10019040 3300002075 Bacteria 1433
3 rootL2_10063370 3300003322 Bacteria 2029
4 rootL2_10151139 3300003322 Bacteria 1579
5 rootH1_10000847 3300003316 Bacteria 5739
6 rootH1_10000847 3300003323 Bacteria 5674
7 rootH1_10033419 3300003323 Bacteria 4379
8 Ga0070683_100138996 3300005329 Bacteria 2301
9 Ga0070683_100324327 3300005329 Bacteria 1466
10 Ga0070680_100079518 3300005336 Bacteria 2702
11 Ga0070680_100444989 3300005336 Bacteria 1106
12 Ga0070682_100206340 3300005337 Bacteria 1390
13 Ga0070682_100297929 3300005337 Bacteria 1182
14 Ga0070660_100062831 3300005339 Bacteria 2886
15 Ga0070709_10011026 3300005434 Bacteria 5022
16 Ga0070709_10144250 3300005434 Bacteria 1639
17 Ga0070714_100003957 3300005435 Bacteria 11136
18 Ga0070714_100034022 3300005435 Bacteria 4266
19 Ga0070714_100178964 3300005435 Bacteria 1928
20 Ga0070681_10043432 3300005458 Bacteria 4503
21 Ga0070681_10281512 3300005458 Bacteria 1573
22 Ga0070698_100081678 3300005471 Bacteria 3226
23 Ga0068853_100029147 3300005539 Bacteria 4651
24 Ga0068856_100448997 3300005614 Bacteria 1310
25 Ga0075365_10198384 3300006038 Bacteria 1406
26 Ga0075368_10007733 3300006042 Bacteria 3804
27 Ga0075363_100011735 3300006048 Bacteria 4204
28 Ga0075367_10128531 3300006178 Bacteria 1565
29 Ga0075370_10152824 3300006353 Bacteria 1353
30 Ga0105245_10113266 3300009098 Bacteria 2525
31 Ga0105243_10090347 3300009148 Bacteria 2520
32 Ga0105243_10233984 3300009148 Bacteria 1631
33 Ga0105248_10312120 3300009177 Bacteria 1771
34 Ga0105238_10175754 3300009551 Bacteria 2118
35 Ga0105239_10589854 3300010375 Bacteria 1267
36 Ga0105239_10650321 3300010375 Bacteria 1204
37 Ga0105246_10005388 3300011119 Bacteria 7788
38 Ga0157369_10053224 3300013105 Bacteria 4376
39 Ga0157372_10178111 3300013307 Bacteria 2461
40 Ga0157375_10270323 3300013308 Bacteria 1862
41 Ga0182008_10001457 3300014497 Bacteria 15816
42 Ga0182008_10165286 3300014497 Unclassified 1115
43 Ga0182007_10003883 3300015262 Bacteria 6932
44 Ga0183367_1005 3300015688 Bacteria 652063
45 Ga0213875_10011069 3300021388 Bacteria 4501
46 Ga0209758_1004925 3300025297 Bacteria 10733
47 Ga0207426_1001851 3300025302 Bacteria 15532
48 Ga0207426_1019949 3300025302 Bacteria 2337
49 Ga0207647_10046970 3300025904 Bacteria 2687
50 Ga0207694_10247295 3300025924 Bacteria 1458
51 Ga0207687_10228189 3300025927 Bacteria 1470
52 Ga0207664_10046845 3300025929 Bacteria 3395
53 Ga0207661_10706585 3300025944 Bacteria 927
54 Ga0207679_10534972 3300025945 Bacteria 1050
55 Ga0207639_10062611 3300026041 Bacteria 2878
56 Ga0207678_10508260 3300026067 Bacteria 1051
57 Ga0207702_10540174 3300026078 Bacteria 1139
58 Ga0209371_1017108 3300027312 Bacteria 1889
59 Ga0209813_10014313 3300027866 Bacteria 2134
60 Ga0268266_10207943 3300028379 Bacteria 1794
61 Ga0307515_10003702 3300028794 Bacteria 32085
62 Ga0307515_10046083 3300028794 Bacteria 6677
63 Ga0307515_10227374 3300028794 Bacteria 1667
64 Ga0268256_1011694 3300030500 Bacteria 2759
65 Ga0307511_10034993 3300030521 Bacteria 4395
66 Ga0307511_10088233 3300030521 Bacteria 2123
67 Ga0307512_10001726 3300030522 Bacteria 29809
68 Ga0307513_10020586 3300031456 Bacteria 7820
69 Ga0307513_10065301 3300031456 Bacteria 3829
70 Ga0307513_10091881 3300031456 Bacteria 3091
71 Ga0307509_10003362 3300031507 Bacteria 24382
72 Ga0307509_10141936 3300031507 Bacteria 2335
73 Ga0307509_10227349 3300031507 Bacteria 1672
74 Ga0307509_10269102 3300031507 Bacteria 1473
75 Ga0307508_10009614 3300031616 Bacteria 8885
76 Ga0307508_10048029 3300031616 Bacteria 3803
77 Ga0307514_10007082 3300031649 Bacteria 9683
78 Ga0307514_10038419 3300031649 Bacteria 3785
79 Ga0307514_10181135 3300031649 Bacteria 1358
80 Ga0307516_10008705 3300031730 Bacteria 11412
81 Ga0307516_10021397 3300031730 Bacteria 6655
82 Ga0307516_10086581 3300031730 Bacteria 2969
83 Ga0307518_10042674 3300031838 Bacteria 3301
84 Ga0307518_10116636 3300031838 Bacteria 1896
85 Ga0307416_100585997 3300032002 Bacteria 1193
86 Ga0307507_10047557 3300033179 Bacteria 4187
87 Ga0307507_10189785 3300033179 Bacteria 1447
88 Ga0307507_10322866 3300033179 Bacteria 928
89 Ga0307510_10081647 3300033180 Bacteria 3132
90 Ga0373937_0096706 3300036401 Bacteria 2739
91 Ga0395900_0439139 3300037418 Bacteria 1263
92 Ga0395900_0666940 3300037418 Bacteria 976
93 Ga0395898_0006338 3300037466 Bacteria 12645
94 Ga0395898_0014755 3300037466 Bacteria 8021
95 Ga0395898_0077754 3300037466 Bacteria 3203
96 Ga0395898_0835060 3300037466 Bacteria 861
97 Ga0436364_1096419 3300037853 Bacteria 10400
98 Ga0439436_0000221 3300041404 Bacteria 13685
99 Ga0439436_0007067 3300041404 Bacteria 3454
100 Ga0439439_0008384 3300041406 Bacteria 2442
101 Ga0451833_0291856 3300041491 Bacteria 1052
102 Ga0451833_1105795 3300041491 Bacteria 870
103 Ga0451837_1439167 3300041494 Bacteria 1224
104 Ga0451847_0340765 3300041503 Bacteria 1031
105 Ga0451853_1286081 3300041512 Bacteria 1515
106 Ga0451853_2221147 3300041512 Bacteria 2570
107 Ga0451853_2306308 3300041512 Bacteria 2441
108 Ga0439433_0000914 3300041999 Bacteria 5888
109 Ga0439433_0009462 3300041999 Bacteria 2123
110 Ga0439448_0000355 3300042005 Bacteria 10294
111 Ga0439449_0020654 3300042007 Bacteria 2467
112 Ga0439449_0032472 3300042007 Bacteria 1946
113 Ga0439449_0049683 3300042007 Bacteria 1551
114 Ga0439455_0000620 3300042012 Bacteria 5171
115 Ga0439457_001048 3300042014 Bacteria 8357
116 Ga0439457_001710 3300042014 Bacteria 6506
117 Ga0439462_0007094 3300042015 Bacteria 2801
118 Ga0439462_0024263 3300042015 Bacteria 1592
119 Ga0450896_000554 3300042133 Bacteria 3976
120 Ga0450898_003442 3300042134 Bacteria 2276
121 Ga0450899_000806 3300042135 Bacteria 3576
122 Ga0450903_000567 3300042138 Bacteria 7597
123 Ga0450906_002191 3300042145 Bacteria 4267
124 Ga0439458_0002209 3300042157 Bacteria 4800
125 Ga0439458_0020874 3300042157 Bacteria 1514
126 Ga0466969_0034013 3300044656 Bacteria 2584
127 Ga0466972_0038162 3300044658 Bacteria 2347
128 Ga0466972_0056479 3300044658 Bacteria 1887
129 Ga0466965_0001233 3300044683 Bacteria 10123
130 Ga0466965_0081946 3300044683 Bacteria 1632
131 Ga0466965_0121918 3300044683 Bacteria 1347
132 Ga0466965_0131446 3300044683 Bacteria 1298
133 Ga0466966_0002684 3300044684 Bacteria 11653
134 Ga0466966_0010102 3300044684 Bacteria 6261
135 Ga0466966_0010657 3300044684 Bacteria 6110
136 Ga0466961_0000772 3300044693 Bacteria 20081
137 Ga0466961_0007129 3300044693 Bacteria 7112
138 Ga0466963_0000792 3300044694 Bacteria 15743
139 Ga0466963_0001543 3300044694 Bacteria 12482
140 Ga0466963_0171860 3300044694 Bacteria 1511
141 Ga0466963_0306111 3300044694 Bacteria 1118
142 Ga0466964_0001683 3300044706 Bacteria 7639
143 Ga0466964_0283360 3300044706 Bacteria 829
144 Ga0466971_0000130 3300044719 Bacteria 27549
145 Ga0466971_0005168 3300044719 Bacteria 5648
146 Ga0466971_0033271 3300044719 Bacteria 2310
147 Ga0466971_0036982 3300044719 Bacteria 2189
148 Ga0466971_0037075 3300044719 Bacteria 2186
149 Ga0466970_0000179 3300044765 Bacteria 30305
150 Ga0466970_0003079 3300044765 Bacteria 8094
151 Ga0466970_0065482 3300044765 Bacteria 1950
152 Ga0466957_0024884 3300044842 Bacteria 3546
153 Ga0466957_0088240 3300044842 Bacteria 1940
154 Ga0466960_0059867 3300044901 Bacteria 1864
155 Ga0466959_0000799 3300045049 Bacteria 18547
156 Ga0466959_0001093 3300045049 Bacteria 16250
157 Ga0466959_0078494 3300045049 Bacteria 2381
158 Ga0466959_0250321 3300045049 Bacteria 1222
159 Ga0466958_0000745 3300045836 Bacteria 14269
160 Ga0466958_0231970 3300045836 Bacteria 1179
161 Ga0466967_0003603 3300045976 Bacteria 10166
162 Ga0466967_0005871 3300045976 Bacteria 8594
163 Ga0466967_0049907 3300045976 Bacteria 3662
164 Ga0466967_0757536 3300045976 Bacteria 963
165 Ga0495617_016258 3300046452 Bacteria 2515
166 Ga0495627_024667 3300046453 Bacteria 1958
167 Ga0495627_097703 3300046453 Bacteria 840
168 Ga0495592_0003452 3300046454 Bacteria 11336
169 Ga0495592_0064166 3300046454 Bacteria 2692
170 Ga0495592_0081547 3300046454 Bacteria 2338
171 Ga0495592_0082017 3300046454 Bacteria 2331
172 Ga0495592_0143028 3300046454 Bacteria 1661
173 Ga0495603_0001554 3300046455 Bacteria 13423
174 Ga0495603_0001594 3300046455 Bacteria 13301
175 Ga0495603_0036674 3300046455 Bacteria 2943
176 Ga0495603_0054394 3300046455 Bacteria 2373
177 Ga0495603_0141658 3300046455 Bacteria 1398
178 Ga0495590_0022555 3300046457 Bacteria 2227
179 Ga0495629_0004390 3300046459 Bacteria 10566
180 Ga0495629_0006864 3300046459 Bacteria 8404
181 Ga0495629_0017146 3300046459 Bacteria 5195
182 Ga0495629_0023884 3300046459 Bacteria 4354
183 Ga0495629_0042306 3300046459 Bacteria 3202
184 Ga0495629_0086372 3300046459 Bacteria 2188
185 Ga0495629_0362066 3300046459 Bacteria 988
186 Ga0495638_0089923 3300046460 Bacteria 1851
187 Ga0495638_0107816 3300046460 Bacteria 1658
188 Ga0495638_0114996 3300046460 Bacteria 1595
189 Ga0495638_0252746 3300046460 Bacteria 971
190 Ga0495651_0001322 3300046462 Bacteria 19203
191 Ga0495651_0018806 3300046462 Bacteria 5352
192 Ga0495651_0031448 3300046462 Bacteria 4138
193 Ga0495651_0176800 3300046462 Bacteria 1514
194 Ga0495651_0381947 3300046462 Bacteria 923
195 Ga0495653_0011169 3300046463 Bacteria 7342
196 Ga0495580_0028392 3300046472 Bacteria 4066
197 Ga0495580_0145679 3300046472 Bacteria 1641
198 Ga0495582_0064940 3300046473 Bacteria 2016
199 Ga0495605_0004397 3300046474 Bacteria 8293
200 Ga0495639_0021502 3300046475 Bacteria 2825
201 Ga0495662_0000163 3300046476 Bacteria 26131
202 Ga0495662_0015211 3300046476 Bacteria 3738
203 Ga0495662_0016987 3300046476 Bacteria 3521
204 Ga0495662_0077870 3300046476 Bacteria 1610
205 Ga0495664_0000580 3300046477 Bacteria 18416
206 Ga0495664_0132524 3300046477 Bacteria 1509
207 Ga0495585_0034360 3300046492 Bacteria 2866
208 Ga0495585_0079777 3300046492 Bacteria 1775
209 Ga0495585_0166380 3300046492 Bacteria 1141
210 Ga0495594_0005253 3300046499 Bacteria 6657
211 Ga0495594_0022395 3300046499 Bacteria 3379
212 Ga0495594_0108772 3300046499 Bacteria 1562
213 Ga0495607_0149805 3300046501 Bacteria 1195
214 Ga0495607_0192727 3300046501 Bacteria 1014
215 Ga0495583_0209935 3300046506 Bacteria 789
216 Ga0495606_0068595 3300046507 Bacteria 2243
217 Ga0495608_0005587 3300046511 Bacteria 8978
218 Ga0495608_0250941 3300046511 Bacteria 1103
219 Ga0495616_0013815 3300046513 Bacteria 4541
220 Ga0495618_0136771 3300046514 Bacteria 1567
221 Ga0495618_0364988 3300046514 Bacteria 888
222 Ga0495620_0002513 3300046515 Bacteria 10631
223 Ga0495620_0006528 3300046515 Bacteria 6400
224 Ga0495628_0009159 3300046516 Bacteria 8462
225 Ga0495628_0038884 3300046516 Bacteria 3806
226 Ga0495628_0056560 3300046516 Bacteria 3087
227 Ga0495628_0093276 3300046516 Bacteria 2328
228 Ga0495628_0164204 3300046516 Bacteria 1686
229 Ga0495630_0004652 3300046517 Bacteria 9629
230 Ga0495630_0083911 3300046517 Bacteria 2405
231 Ga0495631_0002930 3300046518 Bacteria 9449
232 Ga0495632_0118553 3300046519 Bacteria 1238
233 Ga0495643_0004824 3300046522 Bacteria 9292
234 Ga0495643_0007174 3300046522 Bacteria 7229
235 Ga0495644_0124858 3300046523 Bacteria 980
236 Ga0495648_0053296 3300046524 Bacteria 2451
237 Ga0495666_0002575 3300046526 Bacteria 9017
238 Ga0495642_0073638 3300046528 Bacteria 1431
239 Ga0495652_0028747 3300046529 Bacteria 4888
240 Ga0495652_0082989 3300046529 Bacteria 2639
241 Ga0495652_0090481 3300046529 Bacteria 2503
242 Ga0495652_0482494 3300046529 Bacteria 862
243 Ga0495654_0050867 3300046530 Bacteria 2023
244 Ga0495665_0093977 3300046531 Bacteria 1575
245 Ga0495640_0086081 3300046533 Bacteria 2081
246 Ga0495586_0017149 3300046535 Bacteria 3850
247 Ga0495586_0047005 3300046535 Bacteria 2328
248 Ga0495586_0326437 3300046535 Bacteria 880
249 Ga0495587_0021456 3300046536 Bacteria 3983
250 Ga0495587_0103792 3300046536 Bacteria 1636
251 Ga0495587_0128899 3300046536 Bacteria 1446
252 Ga0495645_0009468 3300046543 Bacteria 6805
253 Ga0495645_0017654 3300046543 Bacteria 5114
254 Ga0495645_0029346 3300046543 Bacteria 4000
255 Ga0495645_0159089 3300046543 Bacteria 1563
256 Ga0495622_0002963 3300046557 Bacteria 8080
257 Ga0495622_0071334 3300046557 Bacteria 1603
258 Ga0495633_0034315 3300046558 Bacteria 2441
259 Ga0495633_0047357 3300046558 Bacteria 2031
260 Ga0495667_0017717 3300046559 Bacteria 4810
261 Ga0495667_0064192 3300046559 Bacteria 2402
262 Ga0495667_0190539 3300046559 Bacteria 1314
263 Ga0495634_0009698 3300046642 Bacteria 7086
264 Ga0495634_0035227 3300046642 Bacteria 3429
265 Ga0495634_0122764 3300046642 Bacteria 1662
266 Ga0495634_0123507 3300046642 Bacteria 1656
267 Ga0495625_0001776 3300046660 Bacteria 24861
268 Ga0495625_0040470 3300046660 Bacteria 3398
269 Ga0495635_0005500 3300046663 Bacteria 8810
270 Ga0495635_0033434 3300046663 Bacteria 3567
271 Ga0495635_0085009 3300046663 Bacteria 2164
272 Ga0495635_0170612 3300046663 Bacteria 1479
273 Ga0495661_0012100 3300046665 Bacteria 5834
274 Ga0495588_0004439 3300046674 Bacteria 6200
275 Ga0495588_0005806 3300046674 Bacteria 5521
276 Ga0495588_0080615 3300046674 Bacteria 1699
277 Ga0495588_0091827 3300046674 Bacteria 1591
278 Ga0495588_0305395 3300046674 Bacteria 837
279 Ga0495588_0331007 3300046674 Bacteria 801
280 Ga0495657_0002543 3300046675 Bacteria 15305
281 Ga0495657_0013147 3300046675 Bacteria 6118
282 Ga0495657_0027103 3300046675 Bacteria 4049
283 Ga0495657_0053397 3300046675 Bacteria 2704
284 Ga0495599_0014224 3300046678 Bacteria 4926
285 Ga0495599_0095462 3300046678 Bacteria 1854
286 Ga0495623_0043281 3300046679 Bacteria 2866
287 Ga0495623_0083240 3300046679 Bacteria 1976
288 Ga0495623_0226937 3300046679 Bacteria 1061
289 Ga0495646_0002025 3300046680 Bacteria 12277
290 Ga0495646_0002859 3300046680 Bacteria 10688
291 Ga0495658_0068980 3300046683 Bacteria 2048
292 Ga0495658_0157043 3300046683 Bacteria 1400
293 Ga0495613_0006519 3300046689 Bacteria 8723
294 Ga0495613_0011017 3300046689 Bacteria 6714
295 Ga0495613_0013269 3300046689 Bacteria 6122
296 Ga0495613_0041918 3300046689 Bacteria 3388
297 Ga0495613_0125896 3300046689 Bacteria 1837
298 Ga0495613_0158157 3300046689 Bacteria 1613
299 Ga0495613_0167731 3300046689 Bacteria 1559
300 Ga0495613_0313996 3300046689 Bacteria 1083
301 Ga0495624_0065600 3300046690 Bacteria 2267
302 Ga0495624_0112022 3300046690 Bacteria 1677
303 Ga0495624_0144808 3300046690 Bacteria 1454
304 Ga0495670_0015157 3300046691 Bacteria 3792
305 Ga0495670_0244814 3300046691 Bacteria 955
306 Ga0495670_0273638 3300046691 Bacteria 902
307 Ga0495671_0006228 3300046692 Bacteria 6916
308 Ga0495589_0048949 3300046794 Bacteria 2091
309 Ga0495600_0001446 3300046809 Bacteria 13159
310 Ga0495600_0062683 3300046809 Bacteria 2429
311 Ga0495600_0118745 3300046809 Bacteria 1720
312 Ga0495600_0224532 3300046809 Unclassified 1201
313 Ga0495600_0384920 3300046809 Bacteria 874
314 Ga0495600_0421330 3300046809 Bacteria 828
315 Ga0495660_0105525 3300046810 Bacteria 1444
316 Ga0495581_0008749 3300047315 Bacteria 5862
317 Ga0495581_0016074 3300047315 Bacteria 4350
318 Ga0495581_0026918 3300047315 Bacteria 3334
319 Ga0495581_0243224 3300047315 Bacteria 1052
320 Ga0495581_0399127 3300047315 Bacteria 802
321 Ga0495604_0000878 3300047317 Bacteria 25046
322 Ga0495604_0001885 3300047317 Bacteria 17044
323 Ga0495604_0013742 3300047317 Bacteria 6455
324 Ga0495604_0020487 3300047317 Bacteria 5281
325 Ga0495604_0036034 3300047317 Bacteria 3902
326 Ga0495604_0053796 3300047317 Bacteria 3109
327 Ga0495604_0185223 3300047317 Bacteria 1454
328 Ga0495636_0023369 3300047318 Bacteria 2502
329 Ga0495636_0068545 3300047318 Bacteria 1510
330 Ga0495674_0062519 3300047319 Bacteria 3241
331 Ga0495674_0072569 3300047319 Bacteria 2968
332 Ga0495674_0073515 3300047319 Bacteria 2946
333 Ga0495674_0288588 3300047319 Bacteria 1342
334 Ga0495672_0135207 3300047320 Bacteria 1293
335 Ga0495676_0000150 3300047321 Bacteria 53407
336 Ga0495676_0001728 3300047321 Bacteria 19083
337 Ga0495676_0006750 3300047321 Bacteria 10555
338 Ga0495676_0050834 3300047321 Bacteria 3321
339 Ga0495676_0117759 3300047321 Bacteria 1937
340 Ga0495676_0475857 3300047321 Bacteria 822
341 Ga0495680_0007381 3300047322 Bacteria 10085
342 Ga0495680_0048842 3300047322 Bacteria 3320
343 Ga0495680_0119424 3300047322 Bacteria 1948
344 Ga0495683_0023833 3300047323 Bacteria 3144
345 Ga0495683_0044727 3300047323 Bacteria 2226
346 Ga0495687_003240 3300047443 Bacteria 12019
347 Ga0495687_019814 3300047443 Bacteria 3291
348 Ga0495687_035965 3300047443 Bacteria 2220
349 Ga0495687_043494 3300047443 Bacteria 1956
350 Ga0495687_063197 3300047443 Bacteria 1516
351 Ga0495675_0014700 3300047444 Bacteria 4947
352 Ga0495675_0085247 3300047444 Bacteria 1986
353 Ga0495675_0201915 3300047444 Bacteria 1210
354 Ga0495677_0087854 3300047445 Bacteria 1170
355 Ga0495685_001042 3300047447 Bacteria 8449
356 Ga0495685_003352 3300047447 Bacteria 5104
357 Ga0495685_055263 3300047447 Bacteria 1343
358 Ga0495685_069421 3300047447 Bacteria 1182
359 Ga0495685_106829 3300047447 Bacteria 922
360 Ga0495681_0003971 3300047470 Bacteria 10188
361 Ga0495681_0193070 3300047470 Bacteria 830
362 Ga0495684_0047781 3300047471 Bacteria 3272
363 Ga0495684_0081595 3300047471 Bacteria 2454
364 Ga0495684_0510862 3300047471 Bacteria 824
365 Ga0495686_0013903 3300047472 Bacteria 5570
366 Ga0495686_0029526 3300047472 Bacteria 3566
367 Ga0495686_0078979 3300047472 Bacteria 2013
368 Ga0495686_0148919 3300047472 Bacteria 1375
369 Ga0495593_0001376 3300047673 Bacteria 14229
370 Ga0495593_0069221 3300047673 Bacteria 1835
371 Ga0495602_0050059 3300048088 Bacteria 3736
372 Ga0495602_0070950 3300048088 Bacteria 2977
373 Ga0495602_0190634 3300048088 Bacteria 1572
374 Ga0495614_0006485 3300048089 Bacteria 5250
375 Ga0495614_0015000 3300048089 Bacteria 3382
376 Ga0495614_0034392 3300048089 Bacteria 2179
377 Ga0495614_0052301 3300048089 Bacteria 1750
378 Ga0495614_0065908 3300048089 Bacteria 1558
379 Ga0496104_0095674 3300048907 Bacteria 2841
380 Ga0496104_0575610 3300048907 Bacteria 1037
381 Ga0496105_0027259 3300048908 Bacteria 4664
382 Ga0496105_0041324 3300048908 Bacteria 3800
383 Ga0496106_0537252 3300048909 Bacteria 938
384 Ga0496108_0143137 3300048911 Unclassified 2060
385 Ga0496108_0242430 3300048911 Bacteria 1568
386 Ga0496109_0017746 3300048912 Bacteria 6243
387 Ga0496109_0052346 3300048912 Bacteria 3721
388 Ga0496109_0756835 3300048912 Bacteria 909
389 Ga0496110_0341057 3300048913 Bacteria 1365
390 Ga0496126_0521628 3300048929 Bacteria 947
391 Ga0495682_0034726 3300049460 Bacteria 1859
392 Ga0501031_0017672 3300049568 Bacteria 4637
393 Ga0501031_0082348 3300049568 Bacteria 2098
394 Ga0501031_0152677 3300049568 Bacteria 1509
395 Ga0501031_0172703 3300049568 Bacteria 1412
396 Ga0501032_0007684 3300049569 Bacteria 7858
397 Ga0501032_0020491 3300049569 Bacteria 4604
398 Ga0501032_0048620 3300049569 Bacteria 2863
399 Ga0501032_0156218 3300049569 Bacteria 1498
400 Ga0501033_0008527 3300049570 Bacteria 7930
401 Ga0501033_0024039 3300049570 Bacteria 4597
402 Ga0501033_0045101 3300049570 Bacteria 3281
403 Ga0501033_0045675 3300049570 Bacteria 3258
404 Ga0501033_0473563 3300049570 Bacteria 868
405 Ga0501034_0091691 3300049571 Bacteria 3036
406 Ga0501034_0103591 3300049571 Bacteria 2839
407 Ga0501034_0135723 3300049571 Bacteria 2441
408 Ga0501034_0231311 3300049571 Bacteria 1797
409 Ga0501034_0272879 3300049571 Bacteria 1632
410 Ga0501034_0740572 3300049571 Bacteria 879
411 Ga0501036_0014306 3300049572 Bacteria 6604
412 Ga0501036_0031589 3300049572 Bacteria 4474
413 Ga0501036_0072582 3300049572 Bacteria 2909
414 Ga0501036_0135059 3300049572 Bacteria 2082
415 Ga0501036_0436417 3300049572 Bacteria 1091
416 Ga0501037_0003961 3300049573 Bacteria 10742
417 Ga0501037_0112845 3300049573 Bacteria 1957
418 Ga0501038_0005032 3300049574 Bacteria 12278
419 Ga0501038_0017356 3300049574 Bacteria 6506
420 Ga0501038_0075674 3300049574 Bacteria 2845
421 Ga0501038_0189998 3300049574 Bacteria 1653
422 Ga0501038_0196926 3300049574 Bacteria 1619
423 Ga0501038_0197669 3300049574 Bacteria 1615
424 Ga0501038_0556858 3300049574 Bacteria 871
425 Ga0501039_0105430 3300049575 Bacteria 2201
426 Ga0501039_0217990 3300049575 Bacteria 1500
427 Ga0501039_0327579 3300049575 Bacteria 1204
428 Ga0501040_0004621 3300049576 Bacteria 8930
429 Ga0501041_0023658 3300049577 Bacteria 3683
430 Ga0501042_0004260 3300049578 Bacteria 9107
431 Ga0501042_0134222 3300049578 Bacteria 1785
432 Ga0501042_0578554 3300049578 Bacteria 816
433 Ga0501043_0011681 3300049579 Bacteria 6875
434 Ga0501043_0016837 3300049579 Bacteria 5729
435 Ga0501043_0024725 3300049579 Bacteria 4710
436 Ga0501043_0034264 3300049579 Bacteria 3993
437 Ga0501043_0093863 3300049579 Bacteria 2359
438 Ga0501043_0127917 3300049579 Bacteria 1991
439 Ga0501046_0019114 3300049580 Bacteria 5683
440 Ga0501046_0031747 3300049580 Bacteria 4279
441 Ga0501046_0146743 3300049580 Bacteria 1781
442 Ga0501046_0269363 3300049580 Bacteria 1249
443 Ga0501046_0352411 3300049580 Bacteria 1068
444 Ga0501046_0477450 3300049580 Bacteria 895
445 Ga0501047_0018031 3300049581 Bacteria 6765
446 Ga0501047_0042175 3300049581 Bacteria 4410
447 Ga0501047_0052615 3300049581 Bacteria 3936
448 Ga0501047_0053638 3300049581 Bacteria 3899
449 Ga0501047_0081658 3300049581 Bacteria 3107
450 Ga0501047_0113937 3300049581 Bacteria 2586
451 Ga0501047_0284830 3300049581 Bacteria 1496
452 Ga0501047_0297614 3300049581 Bacteria 1456
453 Ga0501047_0497724 3300049581 Bacteria 1045
454 Ga0501048_0049858 3300049582 Bacteria 2982
455 Ga0501048_0066447 3300049582 Bacteria 2549
456 Ga0501048_0424466 3300049582 Bacteria 951
457 Ga0501067_0010244 3300049583 Bacteria 5186
458 Ga0501070_0003691 3300049586 Bacteria 13235
459 Ga0501070_0105935 3300049586 Bacteria 2324
460 Ga0501070_0115973 3300049586 Bacteria 2212
461 Ga0501071_0000622 3300049587 Bacteria 18372
462 Ga0501072_0041419 3300049588 Bacteria 3617
463 Ga0501074_0012960 3300049590 Bacteria 6061
464 Ga0501076_0020673 3300049592 Bacteria 5041
465 Ga0501077_0098911 3300049593 Bacteria 1849
466 Ga0501079_0009562 3300049741 Bacteria 7350
467 Ga0501083_0016264 3300049744 Bacteria 5209
468 Ga0501035_0023442 3300049822 Bacteria 5661
469 Ga0501035_0035912 3300049822 Bacteria 4495
470 Ga0501035_0065084 3300049822 Bacteria 3238
471 Ga0501035_0077840 3300049822 Bacteria 2930
472 Ga0501035_0092122 3300049822 Bacteria 2667
473 Ga0501035_0093652 3300049822 Bacteria 2643
474 Ga0501035_0209415 3300049822 Bacteria 1668
475 Ga0501035_0291350 3300049822 Bacteria 1377
476 Ga0501035_0409224 3300049822 Bacteria 1127
477 Ga0501044_0007882 3300049823 Bacteria 11706
478 Ga0501044_0052626 3300049823 Bacteria 4194
479 Ga0501044_0055257 3300049823 Bacteria 4078
480 Ga0501044_0146099 3300049823 Bacteria 2350
481 Ga0501044_0176038 3300049823 Bacteria 2108
482 Ga0501044_0203496 3300049823 Bacteria 1937
483 Ga0501044_0232577 3300049823 Bacteria 1790
484 Ga0501044_0321536 3300049823 Bacteria 1471
485 Ga0501044_0330018 3300049823 Bacteria 1448
486 Ga0501044_0392120 3300049823 Bacteria 1302
487 Ga0501045_0011164 3300049824 Bacteria 6296
488 Ga0501045_0187230 3300049824 Bacteria 1542
489 nmdc:mga03n38_360027_c1 3300050490 Bacteria 793
490 nmdc:mga06z11_11384_c1 3300050494 Bacteria 3834
491 nmdc:mga04h51_3444_c1 3300050495 Bacteria 3845
492 nmdc:mga07m45_65445_c1 3300050496 Bacteria 2064
493 nmdc:mga07m45_91247_c1 3300050496 Bacteria 1745
494 Ga0495601_0009062 3300053077 Bacteria 5877
495 Ga0495601_0162323 3300053077 Bacteria 1460
496 Ga0495655_0020871 3300053083 Bacteria 1475
497 Ga0495619_0046314 3300053085 Bacteria 2859
498 Ga0495619_0068533 3300053085 Bacteria 2370
499 Ga0500578_0194312 3300053086 Bacteria 1244
500 Ga0500644_0060027 3300053088 Bacteria 1336
501 Ga0500646_0133653 3300053090 Bacteria 808
502 Ga0500640_003401 3300053095 Bacteria 5552
503 Ga0500654_032805 3300053099 Bacteria 3092
504 Ga0500560_070053 3300053107 Bacteria 1154
505 Ga0500621_142872 3300053126 Bacteria 906
506 Ga0500628_002845 3300053129 Bacteria 2841
507 Ga0500652_003223 3300053131 Bacteria 4932
508 Ga0500658_0011460 3300053134 Bacteria 3266
509 Ga0500573_0035327 3300053140 Bacteria 2884
510 Ga0500573_0111293 3300053140 Bacteria 1532
511 Ga0500600_0010197 3300053149 Bacteria 5683
512 Ga0500616_0087842 3300053153 Bacteria 1546
513 Ga0500624_001779 3300053157 Bacteria 3148
514 Ga0500634_0075262 3300053161 Bacteria 1756
515 Ga0500634_0130454 3300053161 Bacteria 1207
516 Ga0500636_0123376 3300053177 Bacteria 1451
517 Ga0500656_000128 3300053732 Bacteria 4479
518 Ga0500587_001346 3300053739 Bacteria 3456
519 Ga0501084_0041619 3300054114 Bacteria 3843
520 Ga0501084_0161108 3300054114 Bacteria 1893
521 Ga0501082_0353320 3300060353 Bacteria 1281
522 Ga0466962_0001155 3300061719 Bacteria 12183
523 Ga0466962_0001291 3300061719 Bacteria 11564
524 Ga0466962_0025282 3300061719 Bacteria 2851
525 Ga0530510_0075461 3300061734 Bacteria 2449
526 3006428799 3006425503 Bacteria 6491253
527 2547408239 2547132111 Bacteria 8013147
528 2554257202 2554235005 Bacteria 6457341
529 2585299261 2582581312 Bacteria 7308206
530 2585308913 2582581313 Bacteria 10042643
531 2585313605 2582581314 Bacteria 11452267
532 2616694944 2616644814 Bacteria 11555299
533 2616904584 2616644941 Bacteria 8510691
534 2643765059 2643221548 Bacteria 8053412
535 2643899147 2643221578 Bacteria 9213798
536 2643942402 2643221587 Bacteria 7586415
537 2644014764 2643221601 Bacteria 7493239
538 2644176199 2643221631 Bacteria 8168043
539 2644262416 2643221647 Bacteria 10741251
540 2644390026 2643221670 Bacteria 6497041
541 2644403330 2643221673 Bacteria 9196637
542 2644429483 2643221677 Bacteria 7584031
543 2644437252 2643221678 Bacteria 9540101
544 2644461102 2643221682 Bacteria 6743283
545 2644628990 2643221714 Bacteria 9015452
546 2768643482 2767802112 Bacteria 6465194
547 2784588705 2784132148 Bacteria 8627943
548 2785343169 2784746763 Bacteria 9783172
549 2785369634 2784746768 Bacteria 10036182
550 2786670720 2786546132 Bacteria 10419719
551 2793978396 2791355406 Bacteria 11364898
552 2804846778 2802429296 Bacteria 7227771
553 2808842153 2808606359 Bacteria 9866990
554 2808920688 2808606375 Bacteria 9466072
555 2809232315 2808606448 Bacteria 8656184
556 2811849157 2808606982 Bacteria 7791042
557 2812357973 2811994879 Bacteria 9313447
558 2812480423 2811994917 Bacteria 7761064
559 2819695519 2818991463 Bacteria 7948711
560 2819742018 2818991472 Bacteria 10089953
561 2837269234 2837268691 Bacteria 7850704
562 2852636542 2852635781 Bacteria 8251373
563 2862179364 2862178590 Bacteria 8583590
564 2862285770 2862281513 Bacteria 9621493
565 2862290558 2862290372 Bacteria 7471434
566 2862384345 2862382967 Bacteria 10317375
567 2862511702 2862507626 Bacteria 9425308
568 2862579137 2862574272 Bacteria 10567477
569 2862710238 2862705112 Bacteria 6563286
570 2863404470 2863404153 Bacteria 9672205
571 2867348922 2867346516 Bacteria 7608576
572 2867434961 2867428634 Bacteria 9590268
573 2867478825 2867475112 Bacteria 6909112
574 2873155619 2873151551 Bacteria 8625867
575 2875395574 2875391855 Bacteria 7600475
576 2877680992 2877676314 Bacteria 9512378
577 2912719837 2912715099 Bacteria 9460473
578 2912724234 2912723979 Bacteria 8557534
579 2912760893 2912757875 Bacteria 7940295
580 2918505459 2918501144 Bacteria 8668083
581 2919469420 2919468124 Bacteria 9133025
582 2935393305 2935390628 Bacteria 7043367
583 2946049887 2946045630 Bacteria 8527308
584 2946076008 2946072368 Bacteria 8999607
585 2947229077 2947224130 Bacteria 9938529
586 2954007264 2954002825 Bacteria 9173742
587 2954386102 2954380949 Bacteria 10050426
588 2954677045 2954673503 Bacteria 9685905
589 2954687111 2954682443 Bacteria 9862841
590 2954696742 2954691527 Bacteria 10720516
591 2954705396 2954701450 Bacteria 10834262
592 2954716123 2954711539 Bacteria 10867210
593 2954726066 2954721474 Bacteria 10456478
594 2954735744 2954731030 Bacteria 10243860
595 2954744992 2954740390 Bacteria 10229294
596 2954754599 2954749733 Bacteria 10366972
597 2954763964 2954759201 Bacteria 9358192
598 2966601758 2966598605 Bacteria 7676064
599 2990045335 2990044586 Bacteria 6603797
600 2990063202 2990059506 Bacteria 9321252
601 2990094046 2990088156 Bacteria 6657676
602 2995465946 2995463766 Bacteria 8577691
603 2997457737 2997451912 Bacteria 8492419
604 2997600309 2997600082 Bacteria 9896405
605 3006325204 3006321560 Bacteria 8247479
606 3006396351 3006393351 Bacteria 6615579
607 3006500863 3006493962 Bacteria 8825450
608 8008490310 8008485437 Bacteria 7198341
609 8008567127 8008558824 Bacteria 10610750
610 8008578789 8008574985 Bacteria 7815457
611 8023627106 8023623736 Bacteria 8593882
612 8025413717 8025413630 Bacteria 7014048
613 8025482106 8025478263 Bacteria 8209203
614 8025529612 8025524527 Bacteria 7197316
615 8025537908 8025530807 Bacteria 8495698
616 8033687837 8033684223 Bacteria 6906479
617 8047897977 8047893842 Bacteria 11723082
618 8048137333 8048127548 Bacteria 11053136
619 8048360917 8048356638 Bacteria 11044339
620 8048374940 8048369669 Bacteria 11666822
621 8048383266 8048379754 Bacteria 11877923
622 8048413918 8048406513 Bacteria 8936924
623 8054161764 8054160619 Bacteria 7783213
624 8056449076 8056447290 Bacteria 7680491
625 8056671234 8056667051 Bacteria 6953971
626 8056833507 8056829672 Bacteria 9045328
627 JGI24739J22299_10052045
628 JGI24738J21930_10019040
629 rootL2_10063370
630 rootL2_10151139
631 rootH1_10000847
632 rootH1_10033419
633 Ga0070683_100138996
634 Ga0070683_100324327
635 Ga0070680_100079518
636 Ga0070680_100444989
637 Ga0070682_100206340
638 Ga0070682_100297929
639 Ga0070660_100062831
640 Ga0070709_10011026
641 Ga0070709_10144250
642 Ga0070714_100003957
643 Ga0070714_100034022
644 Ga0070714_100178964
645 Ga0070681_10043432
646 Ga0070681_10281512
647 Ga0070698_100081678
648 Ga0068853_100029147
649 Ga0068856_100448997
650 Ga0075365_10198384
651 Ga0075368_10007733
652 Ga0075363_100011735
653 Ga0075367_10128531
654 Ga0075370_10152824
655 Ga0105245_10113266
656 Ga0105243_10090347
657 Ga0105243_10233984
658 Ga0105248_10312120
659 Ga0105238_10175754
660 Ga0105239_10589854
661 Ga0105239_10650321
662 Ga0105246_10005388
663 Ga0157369_10053224
664 Ga0157372_10178111
665 Ga0157375_10270323
666 Ga0182008_10001457
667 Ga0182008_10165286
668 Ga0182007_10003883
669 Ga0183367_1005
670 Ga0213875_10011069
671 Ga0209758_1004925
672 Ga0207426_1001851
673 Ga0207426_1019949
674 Ga0207647_10046970
675 Ga0207694_10247295
676 Ga0207687_10228189
677 Ga0207664_10046845
678 Ga0207661_10706585
679 Ga0207679_10534972
680 Ga0207639_10062611
681 Ga0207678_10508260
682 Ga0207702_10540174
683 Ga0209371_1017108
684 Ga0209813_10014313
685 Ga0268266_10207943
686 Ga0307515_10003702
687 Ga0307515_10046083
688 Ga0307515_10227374
689 Ga0268256_1011694
690 Ga0307511_10034993
691 Ga0307511_10088233
692 Ga0307512_10001726
693 Ga0307513_10020586
694 Ga0307513_10065301
695 Ga0307513_10091881
696 Ga0307509_10003362
697 Ga0307509_10141936
698 Ga0307509_10227349
699 Ga0307509_10269102
700 Ga0307508_10009614
701 Ga0307508_10048029
702 Ga0307514_10007082
703 Ga0307514_10038419
704 Ga0307514_10181135
705 Ga0307516_10008705
706 Ga0307516_10021397
707 Ga0307516_10086581
708 Ga0307518_10042674
709 Ga0307518_10116636
710 Ga0307416_100585997
711 Ga0307507_10047557
712 Ga0307507_10189785
713 Ga0307507_10322866
714 Ga0307510_10081647
715 Ga0373937_0096706
716 Ga0395900_0439139
717 Ga0395900_0666940
718 Ga0395898_0006338
719 Ga0395898_0014755
720 Ga0395898_0077754
721 Ga0395898_0835060
722 Ga0436364_1096419
723 Ga0439436_0000221
724 Ga0439436_0007067
725 Ga0439439_0008384
726 Ga0451833_0291856
727 Ga0451833_1105795
728 Ga0451837_1439167
729 Ga0451847_0340765
730 Ga0451853_1286081
731 Ga0451853_2221147
732 Ga0451853_2306308
733 Ga0439433_0000914
734 Ga0439433_0009462
735 Ga0439448_0000355
736 Ga0439449_0020654
737 Ga0439449_0032472
738 Ga0439449_0049683
739 Ga0439455_0000620
740 Ga0439457_001048
741 Ga0439457_001710
742 Ga0439462_0007094
743 Ga0439462_0024263
744 Ga0450896_000554
745 Ga0450898_003442
746 Ga0450899_000806
747 Ga0450903_000567
748 Ga0450906_002191
749 Ga0439458_0002209
750 Ga0439458_0020874
751 Ga0466969_0034013
752 Ga0466972_0038162
753 Ga0466972_0056479
754 Ga0466965_0001233
755 Ga0466965_0081946
756 Ga0466965_0121918
757 Ga0466965_0131446
758 Ga0466966_0002684
759 Ga0466966_0010102
760 Ga0466966_0010657
761 Ga0466961_0000772
762 Ga0466961_0007129
763 Ga0466963_0000792
764 Ga0466963_0001543
765 Ga0466963_0171860
766 Ga0466963_0306111
767 Ga0466964_0001683
768 Ga0466964_0283360
769 Ga0466971_0000130
770 Ga0466971_0005168
771 Ga0466971_0033271
772 Ga0466971_0036982
773 Ga0466971_0037075
774 Ga0466970_0000179
775 Ga0466970_0003079
776 Ga0466970_0065482
777 Ga0466957_0024884
778 Ga0466957_0088240
779 Ga0466960_0059867
780 Ga0466959_0000799
781 Ga0466959_0001093
782 Ga0466959_0078494
783 Ga0466959_0250321
784 Ga0466958_0000745
785 Ga0466958_0231970
786 Ga0466967_0003603
787 Ga0466967_0005871
788 Ga0466967_0049907
789 Ga0466967_0757536
790 Ga0495617_016258
791 Ga0495627_024667
792 Ga0495627_097703
793 Ga0495592_0003452
794 Ga0495592_0064166
795 Ga0495592_0081547
796 Ga0495592_0082017
797 Ga0495592_0143028
798 Ga0495603_0001554
799 Ga0495603_0001594
800 Ga0495603_0036674
801 Ga0495603_0054394
802 Ga0495603_0141658
803 Ga0495590_0022555
804 Ga0495629_0004390
805 Ga0495629_0006864
806 Ga0495629_0017146
807 Ga0495629_0023884
808 Ga0495629_0042306
809 Ga0495629_0086372
810 Ga0495629_0362066
811 Ga0495638_0089923
812 Ga0495638_0107816
813 Ga0495638_0114996
814 Ga0495638_0252746
815 Ga0495651_0001322
816 Ga0495651_0018806
817 Ga0495651_0031448
818 Ga0495651_0176800
819 Ga0495651_0381947
820 Ga0495653_0011169
821 Ga0495580_0028392
822 Ga0495580_0145679
823 Ga0495582_0064940
824 Ga0495605_0004397
825 Ga0495639_0021502
826 Ga0495662_0000163
827 Ga0495662_0015211
828 Ga0495662_0016987
829 Ga0495662_0077870
830 Ga0495664_0000580
831 Ga0495664_0132524
832 Ga0495585_0034360
833 Ga0495585_0079777
834 Ga0495585_0166380
835 Ga0495594_0005253
836 Ga0495594_0022395
837 Ga0495594_0108772
838 Ga0495607_0149805
839 Ga0495607_0192727
840 Ga0495583_0209935
841 Ga0495606_0068595
842 Ga0495608_0005587
843 Ga0495608_0250941
844 Ga0495616_0013815
845 Ga0495618_0136771
846 Ga0495618_0364988
847 Ga0495620_0002513
848 Ga0495620_0006528
849 Ga0495628_0009159
850 Ga0495628_0038884
851 Ga0495628_0056560
852 Ga0495628_0093276
853 Ga0495628_0164204
854 Ga0495630_0004652
855 Ga0495630_0083911
856 Ga0495631_0002930
857 Ga0495632_0118553
858 Ga0495643_0004824
859 Ga0495643_0007174
860 Ga0495644_0124858
861 Ga0495648_0053296
862 Ga0495666_0002575
863 Ga0495642_0073638
864 Ga0495652_0028747
865 Ga0495652_0082989
866 Ga0495652_0090481
867 Ga0495652_0482494
868 Ga0495654_0050867
869 Ga0495665_0093977
870 Ga0495640_0086081
871 Ga0495586_0017149
872 Ga0495586_0047005
873 Ga0495586_0326437
874 Ga0495587_0021456
875 Ga0495587_0103792
876 Ga0495587_0128899
877 Ga0495645_0009468
878 Ga0495645_0017654
879 Ga0495645_0029346
880 Ga0495645_0159089
881 Ga0495622_0002963
882 Ga0495622_0071334
883 Ga0495633_0034315
884 Ga0495633_0047357
885 Ga0495667_0017717
886 Ga0495667_0064192
887 Ga0495667_0190539
888 Ga0495634_0009698
889 Ga0495634_0035227
890 Ga0495634_0122764
891 Ga0495634_0123507
892 Ga0495625_0001776
893 Ga0495625_0040470
894 Ga0495635_0005500
895 Ga0495635_0033434
896 Ga0495635_0085009
897 Ga0495635_0170612
898 Ga0495661_0012100
899 Ga0495588_0004439
900 Ga0495588_0005806
901 Ga0495588_0080615
902 Ga0495588_0091827
903 Ga0495588_0305395
904 Ga0495588_0331007
905 Ga0495657_0002543
906 Ga0495657_0013147
907 Ga0495657_0027103
908 Ga0495657_0053397
909 Ga0495599_0014224
910 Ga0495599_0095462
911 Ga0495623_0043281
912 Ga0495623_0083240
913 Ga0495623_0226937
914 Ga0495646_0002025
915 Ga0495646_0002859
916 Ga0495658_0068980
917 Ga0495658_0157043
918 Ga0495613_0006519
919 Ga0495613_0011017
920 Ga0495613_0013269
921 Ga0495613_0041918
922 Ga0495613_0125896
923 Ga0495613_0158157
924 Ga0495613_0167731
925 Ga0495613_0313996
926 Ga0495624_0065600
927 Ga0495624_0112022
928 Ga0495624_0144808
929 Ga0495670_0015157
930 Ga0495670_0244814
931 Ga0495670_0273638
932 Ga0495671_0006228
933 Ga0495589_0048949
934 Ga0495600_0001446
935 Ga0495600_0062683
936 Ga0495600_0118745
937 Ga0495600_0224532
938 Ga0495600_0384920
939 Ga0495600_0421330
940 Ga0495660_0105525
941 Ga0495581_0008749
942 Ga0495581_0016074
943 Ga0495581_0026918
944 Ga0495581_0243224
945 Ga0495581_0399127
946 Ga0495604_0000878
947 Ga0495604_0001885
948 Ga0495604_0013742
949 Ga0495604_0020487
950 Ga0495604_0036034
951 Ga0495604_0053796
952 Ga0495604_0185223
953 Ga0495636_0023369
954 Ga0495636_0068545
955 Ga0495674_0062519
956 Ga0495674_0072569
957 Ga0495674_0073515
958 Ga0495674_0288588
959 Ga0495672_0135207
960 Ga0495676_0000150
961 Ga0495676_0001728
962 Ga0495676_0006750
963 Ga0495676_0050834
964 Ga0495676_0117759
965 Ga0495676_0475857
966 Ga0495680_0007381
967 Ga0495680_0048842
968 Ga0495680_0119424
969 Ga0495683_0023833
970 Ga0495683_0044727
971 Ga0495687_003240
972 Ga0495687_019814
973 Ga0495687_035965
974 Ga0495687_043494
975 Ga0495687_063197
976 Ga0495675_0014700
977 Ga0495675_0085247
978 Ga0495675_0201915
979 Ga0495677_0087854
980 Ga0495685_001042
981 Ga0495685_003352
982 Ga0495685_055263
983 Ga0495685_069421
984 Ga0495685_106829
985 Ga0495681_0003971
986 Ga0495681_0193070
987 Ga0495684_0047781
988 Ga0495684_0081595
989 Ga0495684_0510862
990 Ga0495686_0013903
991 Ga0495686_0029526
992 Ga0495686_0078979
993 Ga0495686_0148919
994 Ga0495593_0001376
995 Ga0495593_0069221
996 Ga0495602_0050059
997 Ga0495602_0070950
998 Ga0495602_0190634
999 Ga0495614_0006485
1000 Ga0495614_0015000
1001 Ga0495614_0034392
1002 Ga0495614_0052301
1003 Ga0495614_0065908
1004 Ga0496104_0095674
1005 Ga0496104_0575610
1006 Ga0496105_0027259
1007 Ga0496105_0041324
1008 Ga0496106_0537252
1009 Ga0496108_0143137
1010 Ga0496108_0242430
1011 Ga0496109_0017746
1012 Ga0496109_0052346
1013 Ga0496109_0756835
1014 Ga0496110_0341057
1015 Ga0496126_0521628
1016 Ga0495682_0034726
1017 Ga0501031_0017672
1018 Ga0501031_0082348
1019 Ga0501031_0152677
1020 Ga0501031_0172703
1021 Ga0501032_0007684
1022 Ga0501032_0020491
1023 Ga0501032_0048620
1024 Ga0501032_0156218
1025 Ga0501033_0008527
1026 Ga0501033_0024039
1027 Ga0501033_0045101
1028 Ga0501033_0045675
1029 Ga0501033_0473563
1030 Ga0501034_0091691
1031 Ga0501034_0103591
1032 Ga0501034_0135723
1033 Ga0501034_0231311
1034 Ga0501034_0272879
1035 Ga0501034_0740572
1036 Ga0501036_0014306
1037 Ga0501036_0031589
1038 Ga0501036_0072582
1039 Ga0501036_0135059
1040 Ga0501036_0436417
1041 Ga0501037_0003961
1042 Ga0501037_0112845
1043 Ga0501038_0005032
1044 Ga0501038_0017356
1045 Ga0501038_0075674
1046 Ga0501038_0189998
1047 Ga0501038_0196926
1048 Ga0501038_0197669
1049 Ga0501038_0556858
1050 Ga0501039_0105430
1051 Ga0501039_0217990
1052 Ga0501039_0327579
1053 Ga0501040_0004621
1054 Ga0501041_0023658
1055 Ga0501042_0004260
1056 Ga0501042_0134222
1057 Ga0501042_0578554
1058 Ga0501043_0011681
1059 Ga0501043_0016837
1060 Ga0501043_0024725
1061 Ga0501043_0034264
1062 Ga0501043_0093863
1063 Ga0501043_0127917
1064 Ga0501046_0019114
1065 Ga0501046_0031747
1066 Ga0501046_0146743
1067 Ga0501046_0269363
1068 Ga0501046_0352411
1069 Ga0501046_0477450
1070 Ga0501047_0018031
1071 Ga0501047_0042175
1072 Ga0501047_0052615
1073 Ga0501047_0053638
1074 Ga0501047_0081658
1075 Ga0501047_0113937
1076 Ga0501047_0284830
1077 Ga0501047_0297614
1078 Ga0501047_0497724
1079 Ga0501048_0049858
1080 Ga0501048_0066447
1081 Ga0501048_0424466
1082 Ga0501067_0010244
1083 Ga0501070_0003691
1084 Ga0501070_0105935
1085 Ga0501070_0115973
1086 Ga0501071_0000622
1087 Ga0501072_0041419
1088 Ga0501074_0012960
1089 Ga0501076_0020673
1090 Ga0501077_0098911
1091 Ga0501079_0009562
1092 Ga0501083_0016264
1093 Ga0501035_0023442
1094 Ga0501035_0035912
1095 Ga0501035_0065084
1096 Ga0501035_0077840
1097 Ga0501035_0092122
1098 Ga0501035_0093652
1099 Ga0501035_0209415
1100 Ga0501035_0291350
1101 Ga0501035_0409224
1102 Ga0501044_0007882
1103 Ga0501044_0052626
1104 Ga0501044_0055257
1105 Ga0501044_0146099
1106 Ga0501044_0176038
1107 Ga0501044_0203496
1108 Ga0501044_0232577
1109 Ga0501044_0321536
1110 Ga0501044_0330018
1111 Ga0501044_0392120
1112 Ga0501045_0011164
1113 Ga0501045_0187230
1114 nmdc:mga03n38_360027_c1
1115 nmdc:mga06z11_11384_c1
1116 nmdc:mga04h51_3444_c1
1117 nmdc:mga07m45_65445_c1
1118 nmdc:mga07m45_91247_c1
1119 Ga0495601_0009062
1120 Ga0495601_0162323
1121 Ga0495655_0020871
1122 Ga0495619_0046314
1123 Ga0495619_0068533
1124 Ga0500578_0194312
1125 Ga0500644_0060027
1126 Ga0500646_0133653
1127 Ga0500640_003401
1128 Ga0500654_032805
1129 Ga0500560_070053
1130 Ga0500621_142872
1131 Ga0500628_002845
1132 Ga0500652_003223
1133 Ga0500658_0011460
1134 Ga0500573_0035327
1135 Ga0500573_0111293
1136 Ga0500600_0010197
1137 Ga0500616_0087842
1138 Ga0500624_001779
1139 Ga0500634_0075262
1140 Ga0500634_0130454
1141 Ga0500636_0123376
1142 Ga0500656_000128
1143 Ga0500587_001346
1144 Ga0501084_0041619
1145 Ga0501084_0161108
1146 Ga0501082_0353320
1147 Ga0466962_0001155
1148 Ga0466962_0001291
1149 Ga0466962_0025282
1150 Ga0530510_0075461
1151 3006428799
1152 2547408239
1153 2554257202
1154 2585299261
1155 2585308913
1156 2585313605
1157 2616694944
1158 2616904584
1159 2643765059
1160 2643899147
1161 2643942402
1162 2644014764
1163 2644176199
1164 2644262416
1165 2644390026
1166 2644403330
1167 2644429483
1168 2644437252
1169 2644461102
1170 2644628990
1171 2768643482
1172 2784588705
1173 2785343169
1174 2785369634
1175 2786670720
1176 2793978396
1177 2804846778
1178 2808842153
1179 2808920688
1180 2809232315
1181 2811849157
1182 2812357973
1183 2812480423
1184 2819695519
1185 2819742018
1186 2837269234
1187 2852636542
1188 2862179364
1189 2862285770
1190 2862290558
1191 2862384345
1192 2862511702
1193 2862579137
1194 2862710238
1195 2863404470
1196 2867348922
1197 2867434961
1198 2867478825
1199 2873155619
1200 2875395574
1201 2877680992
1202 2912719837
1203 2912724234
1204 2912760893
1205 2918505459
1206 2919469420
1207 2935393305
1208 2946049887
1209 2946076008
1210 2947229077
1211 2954007264
1212 2954386102
1213 2954677045
1214 2954687111
1215 2954696742
1216 2954705396
1217 2954716123
1218 2954726066
1219 2954735744
1220 2954744992
1221 2954754599
1222 2954763964
1223 2966601758
1224 2990045335
1225 2990063202
1226 2990094046
1227 2995465946
1228 2997457737
1229 2997600309
1230 3006325204
1231 3006396351
1232 3006500863
1233 8008490310
1234 8008567127
1235 8008578789
1236 8023627106
1237 8025413717
1238 8025482106
1239 8025529612
1240 8025537908
1241 8033687837
1242 8047897977
1243 8048137333
1244 8048360917
1245 8048374940
1246 8048383266
1247 8048413918
1248 8054161764
1249 8056449076
1250 8056671234
1251 8056833507

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00483

NTP_transferase

Nucleotidyl transferase

2

232

0.91

PF12804

NTP_transf_3

MobA-like NTP transferase domain

3

234

0.76

Structural Annotation

Top 5 Hits

ID Description Score Start End
7d73-assembly1.cif.gz_F cryo-em structure of gmppa/gmppb complex bound to gtp (state i) 0.85 12 234
1tzf-assembly1.cif.gz_A x-ray crystal structure of alpha-d-glucose-1-phosphate cytidylyltransferase from salmonella typhi 0.8424 10 240
4y7t-assembly1.cif.gz_A structural analysis of muru 0.8243 12 243
1wvc-assembly1.cif.gz_A alpha-d-glucose-1-phosphate cytidylyltransferase complexed with ctp 0.8173 12 243
4y7t-assembly1.cif.gz_A structural analysis of muru 0.8172 12 243
ID Description Score Start End Superfamily
1tzfA00 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8424 10 240 3.90.550.10
af_A4I3X5_10_117_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8201 12 90 3.90.550.10
af_L7N6A5_2_240_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8154 12 240 3.90.550.10
af_Q9M2S0_1_236_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8115 12 236 3.90.550.10
4y7vA00 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8076 12 239 3.90.550.10
ID Description Score Start End GO Terms
AF-A0A6B3IH42-F1-model_v4 NTP transferase domain-containing protein 0.9781 10 85 GO:0005525
GO:0009058
GO:0016740
AF-A0A6G2PEX7-F1-model_v4 deleted 0.978 9 219
AF-A0A4R3I2P8-F1-model_v4 deleted 0.9736 2 242
AF-A0A7H8NIX6-F1-model_v4 Nucleotidyltransferase family protein 0.9731 16 240 GO:0005525
GO:0009058
GO:0016740
AF-A0A0L8NNG2-F1-model_v4 deleted 0.9728 85 240

Map