F470340

General Info

Members Datasets Scaffolds Average Seq Length
625 270 1250 323

Family's Representative Sequence

Representative Sequence 3300005444|Ga0070694_100062103|Ga0070694_1000621032
Length 370
Sequence MKRITLPEEGIETLFGNYDENLKHLEALFNVRIRTQGHDLLIEGDSSNVDKVDRVVGQLSSLMREGMKLSNADVKTAADLIAQDASVDLRDHFLKGSLTPAGKRRVAPKTVNQRKYLDAIEQHDIVFGVGPAGTGKTYLAMAQAVAFLVAKKVSRIILARPAVEAGEKLGFLPGDLQEKVNPYLRPLYDALYDMLDAERVARYIERGTIEIAPIAFMRGRTLNDSFVILDEAQNTTSEQMKMFLTRLGFGAKAVITGDITQIDLPAGRTSGLVEAMKVVGAIEGISFVYFDDRDVVRHKLVQQIVKAYEAFSNGASPSRPSTTPRPLESLGVAPSQVEGREPKGRSEDARGTASSGRADGVQVEPVEPRA

Samples

Sample ID Description Type Environment
1 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
2 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
23 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
30 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
31 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
32 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
37 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
38 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
39 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
42 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
43 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
44 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
45 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
46 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
47 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
48 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
49 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
50 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
51 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
52 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
53 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
54 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
55 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
56 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
58 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
59 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
60 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
61 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
62 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
63 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
64 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
65 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
66 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
68 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
69 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
71 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
72 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
74 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
75 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
76 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
77 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
78 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
79 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
80 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
81 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
82 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
83 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
84 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
85 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
86 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
87 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
135 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
139 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
140 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
141 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
142 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
143 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
144 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
145 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
146 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
147 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
148 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
149 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
150 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
151 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
152 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
153 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
154 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
155 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
156 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
157 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
158 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
159 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
160 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
161 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
162 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
163 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
164 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
165 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
166 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
167 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
168 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
169 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
170 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
171 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
172 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
173 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
174 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
175 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
176 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
177 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
178 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
179 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
180 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
181 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
182 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
183 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
184 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
185 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
186 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
187 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
188 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
189 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
190 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
191 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
192 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
193 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
194 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
195 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
196 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
197 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
198 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
199 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
200 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
201 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
202 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
203 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
204 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
205 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
206 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
207 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
208 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
209 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
210 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
211 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
212 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
213 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
214 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
215 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
216 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
217 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
218 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
219 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
220 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
221 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
222 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
223 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
224 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
225 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
226 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
227 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
228 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
229 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
230 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
231 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
232 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
233 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
234 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
235 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
236 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
237 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
238 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
239 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
240 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
241 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
242 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
243 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
244 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
245 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
246 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
247 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
248 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
249 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
250 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
251 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
252 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
253 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
254 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
255 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
256 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
257 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
258 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
259 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
260 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
261 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
262 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
263 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
264 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
265 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
266 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
267 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
268 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
269 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
270 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.48
Nodule 0
Rhizoplane 5.28
Rhizosphere 94.24
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070694_100062103 3300005444 Bacteria 2552
2 Ga0065714_10114082 3300005288 Bacteria 1433
3 Ga0065704_10114616 3300005289 Bacteria 1887
4 Ga0065712_10000343 3300005290 Bacteria 17818
5 Ga0065712_10014241 3300005290 Bacteria 2927
6 Ga0065712_10148089 3300005290 Bacteria 1385
7 Ga0065715_10000269 3300005293 Bacteria 20304
8 Ga0065715_10091468 3300005293 Bacteria 5766
9 Ga0065715_10102961 3300005293 Bacteria 3053
10 Ga0065715_10129720 3300005293 Bacteria 2040
11 Ga0065715_10199238 3300005293 Bacteria 1371
12 Ga0065707_10084326 3300005295 Bacteria 7346
13 Ga0070658_10270665 3300005327 Bacteria 1445
14 Ga0070676_10003342 3300005328 Bacteria 8346
15 Ga0070683_100033165 3300005329 Bacteria 4707
16 Ga0068869_100136237 3300005334 Bacteria 1892
17 Ga0070666_10089926 3300005335 Bacteria 2108
18 Ga0070666_10108634 3300005335 Bacteria 1917
19 Ga0070666_10182176 3300005335 Bacteria 1474
20 Ga0070680_100210150 3300005336 Bacteria 1642
21 Ga0070660_100001391 3300005339 Bacteria 16464
22 Ga0070691_10015472 3300005341 Bacteria 3505
23 Ga0070669_100002231 3300005353 Bacteria 14027
24 Ga0070669_100019779 3300005353 Bacteria 4812
25 Ga0070669_100089245 3300005353 Bacteria 2309
26 Ga0070669_100110708 3300005353 Bacteria 2084
27 Ga0070675_100000409 3300005354 Bacteria 29206
28 Ga0070675_100095851 3300005354 Bacteria 2492
29 Ga0070675_100118780 3300005354 Bacteria 2245
30 Ga0070675_100195227 3300005354 Bacteria 1755
31 Ga0070675_100563618 3300005354 Bacteria 1031
32 Ga0070671_100005955 3300005355 Bacteria 9714
33 Ga0070674_100001653 3300005356 Bacteria 12028
34 Ga0070674_100066320 3300005356 Bacteria 2536
35 Ga0070673_100287084 3300005364 Bacteria 1445
36 Ga0070673_100415713 3300005364 Bacteria 1205
37 Ga0070688_100005352 3300005365 Bacteria 6750
38 Ga0070688_100196804 3300005365 Bacteria 1408
39 Ga0070659_100071584 3300005366 Bacteria 2757
40 Ga0070714_100026585 3300005435 Bacteria 4784
41 Ga0070711_100250407 3300005439 Bacteria 1389
42 Ga0070700_100194131 3300005441 Bacteria 1422
43 Ga0070694_100011045 3300005444 Bacteria 5588
44 Ga0070678_100034448 3300005456 Bacteria 3527
45 Ga0070678_100046435 3300005456 Bacteria 3114
46 Ga0070662_100200224 3300005457 Bacteria 1584
47 Ga0070681_10014599 3300005458 Bacteria 7817
48 Ga0070681_10058365 3300005458 Bacteria 3839
49 Ga0068867_100142482 3300005459 Bacteria 1875
50 Ga0070706_100095469 3300005467 Bacteria 2760
51 Ga0070706_100153483 3300005467 Bacteria 2150
52 Ga0070707_100147807 3300005468 Bacteria 2287
53 Ga0070707_100234322 3300005468 Bacteria 1787
54 Ga0070698_100000242 3300005471 Bacteria 54440
55 Ga0070698_100043713 3300005471 Bacteria 4592
56 Ga0070698_100451707 3300005471 Bacteria 1221
57 Ga0070699_100000778 3300005518 Bacteria 29468
58 Ga0070699_100007944 3300005518 Bacteria 9212
59 Ga0070699_100051949 3300005518 Bacteria 3549
60 Ga0070679_100008891 3300005530 Bacteria 9477
61 Ga0068853_100188676 3300005539 Bacteria 1872
62 Ga0070672_100063496 3300005543 Bacteria 2916
63 Ga0070672_100116539 3300005543 Bacteria 2182
64 Ga0070686_100328849 3300005544 Bacteria 1142
65 Ga0070695_100007869 3300005545 Bacteria 6314
66 Ga0070695_100064422 3300005545 Bacteria 2384
67 Ga0070696_100002023 3300005546 Bacteria 13307
68 Ga0070696_100005044 3300005546 Bacteria 8820
69 Ga0070696_100268081 3300005546 Bacteria 1297
70 Ga0070665_100013471 3300005548 Bacteria 8225
71 Ga0070665_100068290 3300005548 Bacteria 3564
72 Ga0070665_100252726 3300005548 Bacteria 1763
73 Ga0070665_100305844 3300005548 Bacteria 1593
74 Ga0070664_100063944 3300005564 Bacteria 3138
75 Ga0068854_100002297 3300005578 Bacteria 11771
76 Ga0068854_100018330 3300005578 Bacteria 4699
77 Ga0070702_100000841 3300005615 Bacteria 11829
78 Ga0068859_100018140 3300005617 Bacteria 7072
79 Ga0068859_100158538 3300005617 Bacteria 2342
80 Ga0068859_100334461 3300005617 Bacteria 1609
81 Ga0068864_100093317 3300005618 Bacteria 2659
82 Ga0068864_100198580 3300005618 Bacteria 1842
83 Ga0068864_100244848 3300005618 Bacteria 1662
84 Ga0068866_10019831 3300005718 Bacteria 3069
85 Ga0068866_10059727 3300005718 Bacteria 1974
86 Ga0068861_100008055 3300005719 Bacteria 7248
87 Ga0068861_100056837 3300005719 Bacteria 2987
88 Ga0068861_100091863 3300005719 Bacteria 2397
89 Ga0068861_100254353 3300005719 Bacteria 1500
90 Ga0068870_10053512 3300005840 Bacteria 2144
91 Ga0068863_100078901 3300005841 Bacteria 3118
92 Ga0068858_100017485 3300005842 Bacteria 6726
93 Ga0068858_100218247 3300005842 Bacteria 1806
94 Ga0068858_100302520 3300005842 Bacteria 1526
95 Ga0068860_100015479 3300005843 Bacteria 7447
96 Ga0068862_100015234 3300005844 Bacteria 6384
97 Ga0068862_100016044 3300005844 Bacteria 6230
98 Ga0068862_100152513 3300005844 Bacteria 2057
99 Ga0068862_100338122 3300005844 Bacteria 1394
100 Ga0081455_10095174 3300005937 Bacteria 2404
101 Ga0081540_1116953 3300005983 Bacteria 1114
102 Ga0081539_10018397 3300005985 Bacteria 4850
103 Ga0075366_10080957 3300006195 Bacteria 1939
104 Ga0097621_100001649 3300006237 Bacteria 15278
105 Ga0097621_100027249 3300006237 Bacteria 4492
106 Ga0097621_100031149 3300006237 Bacteria 4230
107 Ga0097621_100033502 3300006237 Bacteria 4092
108 Ga0097621_100043873 3300006237 Bacteria 3606
109 Ga0097621_100064975 3300006237 Bacteria 3002
110 Ga0097621_100336999 3300006237 Bacteria 1339
111 Ga0068871_100000409 3300006358 Bacteria 29690
112 Ga0068871_100026234 3300006358 Bacteria 4545
113 Ga0068871_100033791 3300006358 Bacteria 4052
114 Ga0068871_100034049 3300006358 Bacteria 4039
115 Ga0075428_100000108 3300006844 Bacteria 70319
116 Ga0075428_100028284 3300006844 Bacteria 6200
117 Ga0075428_100037397 3300006844 Bacteria 5344
118 Ga0075428_100087697 3300006844 Bacteria 3394
119 Ga0075428_100340885 3300006844 Bacteria 1609
120 Ga0075430_100047574 3300006846 Bacteria 3622
121 Ga0075431_100011979 3300006847 Bacteria 8750
122 Ga0075431_100049355 3300006847 Bacteria 4339
123 Ga0075431_100260238 3300006847 Bacteria 1761
124 Ga0075431_100281757 3300006847 Bacteria 1683
125 Ga0075431_100362799 3300006847 Bacteria 1455
126 Ga0075433_10047327 3300006852 Bacteria 3741
127 Ga0075433_10068216 3300006852 Bacteria 3122
128 Ga0075433_10105775 3300006852 Bacteria 2494
129 Ga0075433_10111761 3300006852 Bacteria 2424
130 Ga0075434_100013793 3300006871 Bacteria 7705
131 Ga0075434_100106439 3300006871 Bacteria 2814
132 Ga0075434_100189900 3300006871 Bacteria 2074
133 Ga0075434_100191115 3300006871 Bacteria 2068
134 Ga0075434_100217697 3300006871 Bacteria 1929
135 Ga0075429_100014774 3300006880 Bacteria 6767
136 Ga0068865_100012815 3300006881 Bacteria 5285
137 Ga0068865_100033937 3300006881 Bacteria 3420
138 Ga0068865_100109384 3300006881 Bacteria 2036
139 Ga0075436_100000801 3300006914 Bacteria 20860
140 Ga0075436_100024573 3300006914 Bacteria 4142
141 Ga0075436_100027012 3300006914 Bacteria 3952
142 Ga0075436_100091406 3300006914 Bacteria 2116
143 Ga0097620_100018140 3300006931 Bacteria 7072
144 Ga0097620_100158541 3300006931 Bacteria 2342
145 Ga0097620_100334482 3300006931 Bacteria 1609
146 Ga0075435_100000009 3300007076 Bacteria 114381
147 Ga0075435_100000849 3300007076 Bacteria 19122
148 Ga0075435_100002789 3300007076 Bacteria 11671
149 Ga0075435_100004370 3300007076 Bacteria 9711
150 Ga0075435_100012667 3300007076 Bacteria 6249
151 Ga0075435_100060770 3300007076 Bacteria 3064
152 Ga0075435_100072807 3300007076 Bacteria 2808
153 Ga0075435_100130196 3300007076 Bacteria 2105
154 Ga0105240_10023988 3300009093 Bacteria 8058
155 Ga0111539_10000001 3300009094 Bacteria 1035431
156 Ga0111539_10002783 3300009094 Bacteria 23220
157 Ga0111539_10005778 3300009094 Bacteria 15991
158 Ga0111539_10006101 3300009094 Bacteria 15555
159 Ga0111539_10039623 3300009094 Bacteria 5676
160 Ga0111539_10169607 3300009094 Bacteria 2550
161 Ga0111539_10265493 3300009094 Bacteria 1998
162 Ga0105245_10021503 3300009098 Bacteria 5660
163 Ga0105245_10152745 3300009098 Bacteria 2184
164 Ga0105247_10087786 3300009101 Bacteria 1970
165 Ga0114129_10001825 3300009147 Bacteria 28997
166 Ga0114129_10002818 3300009147 Bacteria 24260
167 Ga0114129_10003225 3300009147 Bacteria 22877
168 Ga0114129_10008909 3300009147 Bacteria 14308
169 Ga0114129_10015684 3300009147 Bacteria 10774
170 Ga0114129_10018349 3300009147 Bacteria 9965
171 Ga0114129_10095315 3300009147 Bacteria 4122
172 Ga0114129_10177686 3300009147 Bacteria 2899
173 Ga0114129_10177989 3300009147 Bacteria 2896
174 Ga0114129_10289011 3300009147 Bacteria 2188
175 Ga0105243_10052685 3300009148 Bacteria 3224
176 Ga0105243_10280758 3300009148 Bacteria 1500
177 Ga0105243_10287824 3300009148 Bacteria 1483
178 Ga0105242_10004183 3300009176 Bacteria 11249
179 Ga0105242_10252444 3300009176 Bacteria 1590
180 Ga0105242_10343648 3300009176 Bacteria 1376
181 Ga0105242_10438509 3300009176 Bacteria 1228
182 Ga0105248_10047346 3300009177 Bacteria 4821
183 Ga0105248_10061061 3300009177 Bacteria 4231
184 Ga0105248_10091358 3300009177 Bacteria 3429
185 Ga0105248_10103317 3300009177 Bacteria 3212
186 Ga0105248_10164623 3300009177 Bacteria 2500
187 Ga0105248_10331747 3300009177 Bacteria 1713
188 Ga0105248_10360566 3300009177 Bacteria 1636
189 Ga0105248_10433254 3300009177 Bacteria 1481
190 Ga0105248_10469850 3300009177 Bacteria 1418
191 Ga0105249_10001034 3300009553 Bacteria 24616
192 Ga0105249_10133544 3300009553 Bacteria 2372
193 Ga0105249_10156896 3300009553 Bacteria 2195
194 Ga0105249_10403455 3300009553 Bacteria 1398
195 Ga0105246_10044044 3300011119 Bacteria 3031
196 Ga0105246_10376324 3300011119 Bacteria 1172
197 Ga0157374_10017001 3300013296 Bacteria 6404
198 Ga0163162_10032273 3300013306 Bacteria 5200
199 Ga0163162_10116439 3300013306 Bacteria 2773
200 Ga0163162_10367310 3300013306 Bacteria 1572
201 Ga0157372_10372243 3300013307 Bacteria 1664
202 Ga0157375_10049944 3300013308 Bacteria 4101
203 Ga0157375_10288059 3300013308 Bacteria 1805
204 Ga0157375_10362021 3300013308 Bacteria 1617
205 Ga0163163_10004026 3300014325 Bacteria 12532
206 Ga0163163_10112167 3300014325 Bacteria 2756
207 Ga0157380_10009700 3300014326 Bacteria 6907
208 Ga0157380_10050743 3300014326 Bacteria 3278
209 Ga0157380_10318082 3300014326 Bacteria 1442
210 Ga0157380_10401576 3300014326 Bacteria 1300
211 Ga0157380_10510265 3300014326 Bacteria 1170
212 Ga0157379_10059976 3300014968 Bacteria 3402
213 Ga0157379_10090546 3300014968 Bacteria 2744
214 Ga0157376_10011629 3300014969 Bacteria 6497
215 Ga0157376_10302182 3300014969 Bacteria 1515
216 Ga0157376_10325889 3300014969 Bacteria 1462
217 Ga0157376_10374048 3300014969 Bacteria 1370
218 Ga0163161_10007977 3300017792 Bacteria 7326
219 Ga0207682_10008407 3300025893 Bacteria 4084
220 Ga0207710_10065126 3300025900 Bacteria 1661
221 Ga0207680_10043126 3300025903 Bacteria 2644
222 Ga0207680_10073924 3300025903 Bacteria 2121
223 Ga0207680_10108659 3300025903 Bacteria 1795
224 Ga0207699_10153557 3300025906 Bacteria 1526
225 Ga0207645_10050060 3300025907 Bacteria 2668
226 Ga0207645_10058331 3300025907 Bacteria 2464
227 Ga0207705_10319231 3300025909 Bacteria 1193
228 Ga0207684_10125994 3300025910 Bacteria 2198
229 Ga0207707_10049347 3300025912 Bacteria 3667
230 Ga0207695_10035622 3300025913 Bacteria 5393
231 Ga0207695_10090085 3300025913 Bacteria 3083
232 Ga0207663_10180776 3300025916 Bacteria 1506
233 Ga0207660_10167402 3300025917 Bacteria 1699
234 Ga0207662_10167930 3300025918 Bacteria 1406
235 Ga0207657_10006192 3300025919 Bacteria 12433
236 Ga0207657_10021487 3300025919 Bacteria 6070
237 Ga0207657_10255286 3300025919 Bacteria 1396
238 Ga0207649_10072246 3300025920 Bacteria 2207
239 Ga0207649_10267189 3300025920 Bacteria 1238
240 Ga0207652_10122376 3300025921 Bacteria 2315
241 Ga0207652_10216603 3300025921 Bacteria 1725
242 Ga0207646_10047273 3300025922 Bacteria 3859
243 Ga0207646_10126596 3300025922 Bacteria 2297
244 Ga0207681_10007913 3300025923 Bacteria 6499
245 Ga0207681_10026759 3300025923 Bacteria 3724
246 Ga0207681_10058552 3300025923 Bacteria 2638
247 Ga0207681_10103508 3300025923 Bacteria 2058
248 Ga0207681_10172580 3300025923 Bacteria 1640
249 Ga0207650_10212354 3300025925 Bacteria 1554
250 Ga0207650_10249716 3300025925 Bacteria 1436
251 Ga0207650_10342085 3300025925 Bacteria 1229
252 Ga0207659_10028141 3300025926 Bacteria 3816
253 Ga0207659_10092242 3300025926 Bacteria 2264
254 Ga0207659_10496275 3300025926 Bacteria 1033
255 Ga0207687_10207555 3300025927 Bacteria 1535
256 Ga0207644_10225918 3300025931 Bacteria 1486
257 Ga0207690_10262719 3300025932 Bacteria 1338
258 Ga0207706_10076519 3300025933 Bacteria 2943
259 Ga0207686_10027463 3300025934 Bacteria 3334
260 Ga0207686_10034003 3300025934 Bacteria 3048
261 Ga0207686_10107343 3300025934 Bacteria 1876
262 Ga0207709_10074678 3300025935 Bacteria 2164
263 Ga0207669_10000305 3300025937 Bacteria 22533
264 Ga0207669_10005211 3300025937 Bacteria 5809
265 Ga0207669_10029234 3300025937 Bacteria 3045
266 Ga0207669_10032418 3300025937 Bacteria 2934
267 Ga0207669_10032588 3300025937 Bacteria 2929
268 Ga0207704_10013184 3300025938 Bacteria 4129
269 Ga0207704_10034234 3300025938 Bacteria 2897
270 Ga0207704_10049104 3300025938 Bacteria 2536
271 Ga0207691_10064437 3300025940 Bacteria 3320
272 Ga0207711_10008589 3300025941 Bacteria 8539
273 Ga0207711_10082349 3300025941 Bacteria 2813
274 Ga0207711_10131719 3300025941 Bacteria 2243
275 Ga0207711_10145760 3300025941 Bacteria 2133
276 Ga0207711_10153892 3300025941 Bacteria 2077
277 Ga0207711_10342632 3300025941 Bacteria 1383
278 Ga0207711_10532195 3300025941 Bacteria 1096
279 Ga0207689_10117004 3300025942 Bacteria 2191
280 Ga0207661_10033256 3300025944 Bacteria 4001
281 Ga0207679_10056608 3300025945 Bacteria 2896
282 Ga0207679_10075787 3300025945 Bacteria 2554
283 Ga0207679_10452418 3300025945 Bacteria 1139
284 Ga0207667_10096292 3300025949 Bacteria 3054
285 Ga0207651_10118427 3300025960 Bacteria 2003
286 Ga0207651_10333256 3300025960 Bacteria 1272
287 Ga0207712_10002893 3300025961 Bacteria 10974
288 Ga0207712_10168672 3300025961 Bacteria 1709
289 Ga0207668_10372347 3300025972 Bacteria 1200
290 Ga0207640_10018780 3300025981 Bacteria 4069
291 Ga0207677_10014266 3300026023 Bacteria 4634
292 Ga0207703_10065616 3300026035 Bacteria 2984
293 Ga0207703_10134074 3300026035 Bacteria 2142
294 Ga0207703_10150503 3300026035 Bacteria 2029
295 Ga0207639_10151142 3300026041 Bacteria 1945
296 Ga0207708_10262435 3300026075 Bacteria 1394
297 Ga0207708_10325506 3300026075 Bacteria 1255
298 Ga0207641_10007543 3300026088 Bacteria 9048
299 Ga0207648_10004126 3300026089 Bacteria 15026
300 Ga0207648_10094453 3300026089 Bacteria 2615
301 Ga0207648_10205624 3300026089 Bacteria 1747
302 Ga0207648_10217178 3300026089 Bacteria 1699
303 Ga0207648_10250806 3300026089 Bacteria 1578
304 Ga0207676_10364657 3300026095 Bacteria 1340
305 Ga0207675_100003439 3300026118 Bacteria 15480
306 Ga0207675_100051381 3300026118 Bacteria 3846
307 Ga0207675_100069785 3300026118 Bacteria 3284
308 Ga0207675_100109370 3300026118 Bacteria 2608
309 Ga0207675_100112704 3300026118 Bacteria 2567
310 Ga0207675_100221260 3300026118 Bacteria 1824
311 Ga0207675_100319011 3300026118 Bacteria 1517
312 Ga0207675_100483862 3300026118 Bacteria 1230
313 Ga0207683_10023780 3300026121 Bacteria 5271
314 Ga0207683_10028653 3300026121 Bacteria 4816
315 Ga0207683_10120568 3300026121 Bacteria 2354
316 Ga0207698_10405266 3300026142 Bacteria 1304
317 Ga0207428_10000002 3300027907 Bacteria 854851
318 Ga0207428_10005172 3300027907 Bacteria 12213
319 Ga0207428_10008456 3300027907 Bacteria 9293
320 Ga0207428_10060838 3300027907 Bacteria 2992
321 Ga0207428_10083553 3300027907 Bacteria 2490
322 Ga0268266_10042800 3300028379 Bacteria 3869
323 Ga0268266_10159858 3300028379 Bacteria 2037
324 Ga0268266_10559422 3300028379 Bacteria 1096
325 Ga0268265_10015207 3300028380 Bacteria 5261
326 Ga0268265_10017891 3300028380 Bacteria 4901
327 Ga0268265_10238029 3300028380 Bacteria 1604
328 Ga0268265_10273284 3300028380 Bacteria 1508
329 Ga0268265_10397308 3300028380 Bacteria 1273
330 Ga0268264_10011434 3300028381 Bacteria 7331
331 Ga0307408_100020577 3300031548 Bacteria 4456
332 Ga0307408_100025812 3300031548 Bacteria 4027
333 Ga0307408_100031481 3300031548 Bacteria 3694
334 Ga0307405_10007416 3300031731 Bacteria 5483
335 Ga0307413_10014665 3300031824 Bacteria 3990
336 Ga0307413_10131702 3300031824 Bacteria 1713
337 Ga0307413_10280097 3300031824 Bacteria 1254
338 Ga0307410_10004394 3300031852 Bacteria 7282
339 Ga0307410_10017547 3300031852 Bacteria 4302
340 Ga0307410_10033944 3300031852 Bacteria 3299
341 Ga0307410_10061905 3300031852 Bacteria 2562
342 Ga0307410_10151866 3300031852 Bacteria 1725
343 Ga0307406_10028135 3300031901 Bacteria 3394
344 Ga0307406_10046782 3300031901 Bacteria 2724
345 Ga0307407_10023545 3300031903 Bacteria 3215
346 Ga0307407_10024858 3300031903 Bacteria 3148
347 Ga0307412_10012993 3300031911 Bacteria 4868
348 Ga0307412_10032348 3300031911 Bacteria 3313
349 Ga0307412_10199320 3300031911 Bacteria 1519
350 Ga0307409_100007417 3300031995 Bacteria 6557
351 Ga0307409_100015445 3300031995 Bacteria 5013
352 Ga0307409_100024112 3300031995 Bacteria 4235
353 Ga0307416_100035512 3300032002 Bacteria 3808
354 Ga0307416_100082628 3300032002 Bacteria 2722
355 Ga0307416_100095836 3300032002 Bacteria 2564
356 Ga0307416_100099504 3300032002 Bacteria 2525
357 Ga0307416_100286316 3300032002 Bacteria 1628
358 Ga0307414_10013274 3300032004 Bacteria 4901
359 Ga0307414_10119012 3300032004 Bacteria 2027
360 Ga0307411_10004122 3300032005 Bacteria 6897
361 Ga0307411_10081225 3300032005 Bacteria 2232
362 Ga0307411_10154621 3300032005 Bacteria 1709
363 Ga0307415_100004221 3300032126 Bacteria 7424
364 Ga0373930_0003227 3300034816 Bacteria 2576
365 Ga0373948_0001914 3300034817 Bacteria 2987
366 Ga0373950_0002238 3300034818 Bacteria 2643
367 Ga0373958_0002618 3300034819 Bacteria 2539
368 Ga0373938_0000850 3300034957 Bacteria 4930
369 Ga0373928_0001702 3300035084 Bacteria 4265
370 Ga0373929_0001252 3300035085 Bacteria 4910
371 Ga0373940_0003861 3300035088 Bacteria 3110
372 Ga0373949_0004047 3300035090 Bacteria 3396
373 Ga0373951_0000861 3300035091 Bacteria 8209
374 Ga0373952_0000441 3300035092 Bacteria 7209
375 Ga0373923_0032795 3300035111 Bacteria 2100
376 Ga0373932_0001914 3300035112 Bacteria 5553
377 Ga0373939_0000245 3300035114 Bacteria 14645
378 Ga0373941_0000417 3300035115 Bacteria 8452
379 Ga0373956_0011575 3300035119 Bacteria 3638
380 Ga0373943_0001891 3300035170 Bacteria 9469
381 Ga0373943_0109996 3300035170 Bacteria 1452
382 Ga0373946_0037735 3300035171 Bacteria 1965
383 Ga0373955_0095298 3300035172 Bacteria 1702
384 Ga0373942_0004901 3300035207 Bacteria 3102
385 Ga0373961_0010923 3300035241 Bacteria 2246
386 Ga0373924_0060444 3300035410 Bacteria 1584
387 Ga0373924_0083868 3300035410 Bacteria 1358
388 Ga0373931_0016778 3300035691 Bacteria 3610
389 Ga0373947_0157058 3300035725 Bacteria 1468
390 Ga0373937_0151144 3300036401 Bacteria 2175
391 Ga0373925_0057639 3300037068 Bacteria 2911
392 Ga0373925_0095030 3300037068 Bacteria 2283
393 Ga0316581_0037849 3300037588 Bacteria 1466
394 Ga0450920_022810 3300042122 Bacteria 1213
395 Ga0439446_0013873 3300042156 Bacteria 2218
396 Ga0439434_0027930 3300042435 Bacteria 1708
397 Ga0450918_016949 3300042531 Bacteria 1268
398 Ga0451577_0059930 3300042876 Bacteria 3393
399 Ga0495603_0054290 3300046455 Bacteria 2375
400 Ga0495603_0067256 3300046455 Bacteria 2110
401 Ga0495629_0004294 3300046459 Bacteria 10683
402 Ga0495629_0086961 3300046459 Bacteria 2181
403 Ga0495629_0159753 3300046459 Bacteria 1566
404 Ga0495638_0010376 3300046460 Bacteria 6475
405 Ga0495653_0061676 3300046463 Bacteria 2836
406 Ga0495582_0054756 3300046473 Bacteria 2199
407 Ga0495639_0021307 3300046475 Bacteria 2836
408 Ga0495639_0063249 3300046475 Bacteria 1699
409 Ga0495664_0080384 3300046477 Bacteria 1954
410 Ga0495594_0015094 3300046499 Bacteria 4055
411 Ga0495608_0125647 3300046511 Bacteria 1643
412 Ga0495630_0001261 3300046517 Bacteria 17462
413 Ga0495652_0260406 3300046529 Bacteria 1281
414 Ga0495586_0078028 3300046535 Bacteria 1817
415 Ga0495587_0098153 3300046536 Bacteria 1689
416 Ga0495645_0126532 3300046543 Bacteria 1795
417 Ga0495667_0157375 3300046559 Bacteria 1462
418 Ga0495634_0047346 3300046642 Bacteria 2898
419 Ga0495635_0098329 3300046663 Bacteria 2000
420 Ga0495635_0109169 3300046663 Bacteria 1890
421 Ga0495659_0073698 3300046664 Bacteria 1284
422 Ga0495599_0215790 3300046678 Bacteria 1175
423 Ga0495658_0088613 3300046683 Bacteria 1829
424 Ga0495658_0095515 3300046683 Bacteria 1767
425 Ga0495613_0002633 3300046689 Bacteria 13495
426 Ga0495613_0074910 3300046689 Bacteria 2464
427 Ga0495636_0109390 3300047318 Bacteria 1215
428 Ga0495674_0032656 3300047319 Bacteria 4719
429 Ga0495676_0088242 3300047321 Bacteria 2327
430 Ga0495680_0168644 3300047322 Bacteria 1586
431 Ga0495680_0243260 3300047322 Bacteria 1277
432 Ga0495684_0000550 3300047471 Bacteria 30400
433 Ga0495684_0208834 3300047471 Bacteria 1437
434 Ga0496100_0027682 3300048903 Bacteria 3488
435 Ga0496101_0001572 3300048904 Bacteria 13684
436 Ga0496101_0069030 3300048904 Bacteria 2585
437 Ga0496104_0004524 3300048907 Bacteria 12117
438 Ga0496104_0128261 3300048907 Bacteria 2436
439 Ga0496104_0380816 3300048907 Bacteria 1323
440 Ga0496104_0414445 3300048907 Bacteria 1259
441 Ga0496105_0067725 3300048908 Bacteria 2948
442 Ga0496105_0071239 3300048908 Bacteria 2873
443 Ga0496105_0237524 3300048908 Bacteria 1480
444 Ga0496106_0096896 3300048909 Bacteria 2283
445 Ga0496106_0120811 3300048909 Bacteria 2048
446 Ga0496107_0024952 3300048910 Bacteria 4231
447 Ga0496108_0009473 3300048911 Bacteria 7886
448 Ga0496108_0013709 3300048911 Bacteria 6615
449 Ga0496108_0069206 3300048911 Bacteria 2978
450 Ga0496109_0088183 3300048912 Bacteria 2867
451 Ga0496109_0097983 3300048912 Bacteria 2718
452 Ga0496109_0167307 3300048912 Bacteria 2062
453 Ga0496110_0052389 3300048913 Bacteria 3586
454 Ga0496110_0101759 3300048913 Bacteria 2576
455 Ga0496111_0118661 3300048914 Bacteria 1953
456 Ga0496111_0311154 3300048914 Bacteria 1167
457 Ga0496112_0000420 3300048915 Bacteria 27956
458 Ga0496112_0001633 3300048915 Bacteria 17370
459 Ga0496112_0014861 3300048915 Bacteria 7242
460 Ga0496112_0080510 3300048915 Bacteria 3221
461 Ga0496112_0096301 3300048915 Bacteria 2930
462 Ga0496113_0003692 3300048916 Bacteria 9223
463 Ga0496114_0000310 3300048917 Bacteria 35609
464 Ga0496114_0001016 3300048917 Bacteria 21060
465 Ga0496114_0085262 3300048917 Bacteria 2675
466 Ga0496114_0098972 3300048917 Bacteria 2487
467 Ga0501299_002844 3300049522 Bacteria 2446
468 Ga0501031_0005625 3300049568 Bacteria 8165
469 Ga0501031_0055828 3300049568 Bacteria 2573
470 Ga0501031_0104095 3300049568 Bacteria 1852
471 Ga0501032_0006096 3300049569 Bacteria 8881
472 Ga0501032_0006429 3300049569 Bacteria 8647
473 Ga0501032_0036930 3300049569 Bacteria 3333
474 Ga0501033_0002589 3300049570 Bacteria 15245
475 Ga0501033_0003111 3300049570 Bacteria 13774
476 Ga0501033_0009796 3300049570 Bacteria 7357
477 Ga0501034_0043081 3300049571 Bacteria 4568
478 Ga0501036_0019728 3300049572 Bacteria 5660
479 Ga0501036_0057012 3300049572 Bacteria 3309
480 Ga0501036_0059276 3300049572 Bacteria 3244
481 Ga0501037_0002630 3300049573 Bacteria 12956
482 Ga0501037_0061536 3300049573 Bacteria 2737
483 Ga0501037_0074714 3300049573 Bacteria 2462
484 Ga0501038_0003572 3300049574 Bacteria 14468
485 Ga0501038_0007055 3300049574 Bacteria 10373
486 Ga0501039_0016043 3300049575 Bacteria 5738
487 Ga0501040_0001813 3300049576 Bacteria 13726
488 Ga0501040_0037921 3300049576 Bacteria 3276
489 Ga0501040_0216977 3300049576 Bacteria 1361
490 Ga0501041_0002041 3300049577 Bacteria 11362
491 Ga0501041_0076200 3300049577 Bacteria 2063
492 Ga0501041_0081634 3300049577 Bacteria 1991
493 Ga0501042_0007851 3300049578 Bacteria 7015
494 Ga0501042_0012885 3300049578 Bacteria 5678
495 Ga0501042_0074994 3300049578 Bacteria 2420
496 Ga0501043_0059717 3300049579 Bacteria 2993
497 Ga0501043_0070090 3300049579 Bacteria 2754
498 Ga0501043_0083001 3300049579 Bacteria 2519
499 Ga0501046_0002936 3300049580 Bacteria 15766
500 Ga0501046_0012214 3300049580 Bacteria 7318
501 Ga0501046_0015384 3300049580 Bacteria 6431
502 Ga0501046_0029917 3300049580 Bacteria 4424
503 Ga0501047_0009879 3300049581 Bacteria 9020
504 Ga0501047_0012447 3300049581 Bacteria 8054
505 Ga0501047_0050450 3300049581 Bacteria 4018
506 Ga0501047_0110067 3300049581 Bacteria 2637
507 Ga0501048_0006094 3300049582 Bacteria 9185
508 Ga0501048_0013038 3300049582 Bacteria 6174
509 Ga0501048_0026975 3300049582 Bacteria 4179
510 Ga0501048_0027342 3300049582 Bacteria 4147
511 Ga0501048_0068817 3300049582 Bacteria 2500
512 Ga0501067_0002490 3300049583 Bacteria 10175
513 Ga0501067_0033364 3300049583 Bacteria 2856
514 Ga0501068_0007267 3300049584 Bacteria 6135
515 Ga0501068_0073834 3300049584 Bacteria 2084
516 Ga0501068_0130451 3300049584 Bacteria 1571
517 Ga0501070_0012708 3300049586 Bacteria 7101
518 Ga0501070_0038040 3300049586 Bacteria 4015
519 Ga0501071_0004994 3300049587 Bacteria 8478
520 Ga0501071_0346862 3300049587 Bacteria 1129
521 Ga0501072_0011542 3300049588 Bacteria 6752
522 Ga0501072_0012388 3300049588 Bacteria 6516
523 Ga0501072_0090523 3300049588 Bacteria 2429
524 Ga0501073_0002562 3300049589 Bacteria 13584
525 Ga0501073_0025302 3300049589 Bacteria 4258
526 Ga0501074_0005912 3300049590 Bacteria 8821
527 Ga0501074_0011030 3300049590 Bacteria 6559
528 Ga0501075_0004045 3300049591 Bacteria 9894
529 Ga0501075_0039505 3300049591 Bacteria 3532
530 Ga0501075_0078559 3300049591 Bacteria 2498
531 Ga0501076_0013993 3300049592 Bacteria 6029
532 Ga0501076_0017353 3300049592 Bacteria 5470
533 Ga0501076_0041770 3300049592 Bacteria 3609
534 Ga0501076_0049106 3300049592 Bacteria 3336
535 Ga0501076_0081048 3300049592 Bacteria 2605
536 Ga0501076_0114191 3300049592 Bacteria 2185
537 Ga0501079_0006613 3300049741 Bacteria 8725
538 Ga0501079_0009847 3300049741 Bacteria 7251
539 Ga0501079_0013881 3300049741 Bacteria 6145
540 Ga0501079_0054164 3300049741 Bacteria 3094
541 Ga0501080_0009580 3300049742 Bacteria 8843
542 Ga0501080_0010787 3300049742 Bacteria 8361
543 Ga0501080_0111872 3300049742 Bacteria 2531
544 Ga0501081_0002428 3300049743 Bacteria 11762
545 Ga0501081_0030712 3300049743 Bacteria 3639
546 Ga0501083_0005836 3300049744 Bacteria 8718
547 Ga0501035_0011728 3300049822 Bacteria 8119
548 Ga0501035_0033179 3300049822 Bacteria 4695
549 Ga0501035_0046173 3300049822 Bacteria 3917
550 Ga0501044_0031603 3300049823 Bacteria 5571
551 Ga0501045_0001051 3300049824 Bacteria 18183
552 nmdc:mga00v17_40300_c1 3300050491 Bacteria 2801
553 nmdc:mga05p37_115170_c1 3300050507 Bacteria 3305
554 nmdc:mga05p37_161033_c1 3300050507 Bacteria 2741
555 nmdc:mga05p37_21642_c1 3300050507 Bacteria 7790
556 nmdc:mga05p37_41507_c1 3300050507 Bacteria 5648
557 nmdc:mga05p37_41843_c1 3300050507 Bacteria 5627
558 nmdc:mga05p37_51424_c1 3300050507 Bacteria 5067
559 nmdc:mga05p37_59416_c1 3300050507 Bacteria 4708
560 nmdc:mga05p37_61701_c1 3300050507 Bacteria 4615
561 nmdc:mga05p37_84214_c1 3300050507 Bacteria 3917
562 nmdc:mga05p37_9528_c1 3300050507 Bacteria 11497
563 nmdc:mga0qj67_2331_c1 3300050509 Bacteria 13498
564 nmdc:mga0qj67_64610_c1 3300050509 Bacteria 2911
565 nmdc:mga06r32_241695_c1 3300050510 Bacteria 1793
566 nmdc:mga06r32_25093_c1 3300050510 Bacteria 5540
567 nmdc:mga06r32_44481_c1 3300050510 Bacteria 4228
568 nmdc:mga06r32_7501_c1 3300050510 Bacteria 9811
569 nmdc:mga06r32_87390_c1 3300050510 Bacteria 3042
570 nmdc:mga08y16_156397_c1 3300050511 Bacteria 2369
571 nmdc:mga08y16_179791_c1 3300050511 Bacteria 2196
572 nmdc:mga08y16_30958_c1 3300050511 Bacteria 5627
573 nmdc:mga08y16_335669_c1 3300050511 Bacteria 1554
574 nmdc:mga08y16_3_c1 3300050511 Bacteria 936907
575 nmdc:mga08y16_5107_c1 3300050511 Bacteria 13711
576 nmdc:mga08y16_524_c1 3300050511 Bacteria 35438
577 nmdc:mga0n895_3475_c1 3300050512 Bacteria 12714
578 nmdc:mga0n895_36679_c1 3300050512 Bacteria 4736
579 nmdc:mga0n895_56048_c1 3300050512 Bacteria 3881
580 nmdc:mga0n895_644453_c1 3300050512 Bacteria 1059
581 nmdc:mga0n895_6498_c1 3300050512 Bacteria 9938
582 nmdc:mga0n895_67_c1 3300050512 Bacteria 61603
583 nmdc:mga0n895_9091_c1 3300050512 Bacteria 8668
584 nmdc:mga0n895_91346_c1 3300050512 Bacteria 3047
585 nmdc:mga0rr50_25_c1 3300050513 Bacteria 114931
586 nmdc:mga0rr50_3136_c1 3300050513 Bacteria 9440
587 nmdc:mga0rr50_46289_c1 3300050513 Bacteria 3203
588 nmdc:mga0rr50_73446_c1 3300050513 Bacteria 2615
589 nmdc:mga0rr50_96749_c1 3300050513 Bacteria 2310
590 nmdc:mga08x19_105262_c1 3300050514 Bacteria 1876
591 nmdc:mga08x19_110624_c1 3300050514 Bacteria 1832
592 nmdc:mga08x19_111318_c1 3300050514 Bacteria 1827
593 nmdc:mga08x19_213_c1 3300050514 Bacteria 44077
594 nmdc:mga08x19_3059_c1 3300050514 Bacteria 10053
595 nmdc:mga08x19_5150_c1 3300050514 Bacteria 7731
596 nmdc:mga0a205_116755_c1 3300050515 Bacteria 2567
597 nmdc:mga0a205_23898_c1 3300050515 Bacteria 5801
598 nmdc:mga0a205_256041_c1 3300050515 Bacteria 1629
599 nmdc:mga0a205_276734_c1 3300050515 Bacteria 1554
600 nmdc:mga0a205_67689_c1 3300050515 Bacteria 3450
601 nmdc:mga0a205_8756_c1 3300050515 Bacteria 9217
602 Ga0495601_0043705 3300053077 Bacteria 2814
603 Ga0495601_0183450 3300053077 Bacteria 1368
604 Ga0495619_0010658 3300053085 Bacteria 5786
605 Ga0495619_0026085 3300053085 Bacteria 3758
606 Ga0500592_005332 3300053116 Bacteria 2046
607 Ga0501084_0001248 3300054114 Bacteria 20008
608 Ga0501084_0009843 3300054114 Bacteria 7900
609 Ga0501084_0023883 3300054114 Bacteria 5100
610 Ga0501084_0025595 3300054114 Bacteria 4922
611 Ga0501084_0204638 3300054114 Bacteria 1666
612 Ga0590071_000060 3300059421 Bacteria 29173
613 Ga0590071_001017 3300059421 Bacteria 7633
614 Ga0590075_000043 3300059424 Bacteria 33018
615 Ga0590075_000598 3300059424 Bacteria 9691
616 Ga0590075_000898 3300059424 Bacteria 7757
617 Ga0590077_000073 3300059426 Bacteria 25304
618 Ga0590077_000569 3300059426 Bacteria 10181
619 Ga0590077_002267 3300059426 Bacteria 4152
620 Ga0590077_027636 3300059426 Bacteria 1230
621 Ga0501082_0000929 3300060353 Bacteria 25893
622 Ga0501082_0006033 3300060353 Bacteria 10510
623 Ga0501082_0073721 3300060353 Bacteria 2939
624 Ga0530510_0007416 3300061734 Bacteria 7634
625 Ga0530510_0104729 3300061734 Bacteria 2070
626 Ga0070694_100062103
627 Ga0065714_10114082
628 Ga0065704_10114616
629 Ga0065712_10000343
630 Ga0065712_10014241
631 Ga0065712_10148089
632 Ga0065715_10000269
633 Ga0065715_10091468
634 Ga0065715_10102961
635 Ga0065715_10129720
636 Ga0065715_10199238
637 Ga0065707_10084326
638 Ga0070658_10270665
639 Ga0070676_10003342
640 Ga0070683_100033165
641 Ga0068869_100136237
642 Ga0070666_10089926
643 Ga0070666_10108634
644 Ga0070666_10182176
645 Ga0070680_100210150
646 Ga0070660_100001391
647 Ga0070691_10015472
648 Ga0070669_100002231
649 Ga0070669_100019779
650 Ga0070669_100089245
651 Ga0070669_100110708
652 Ga0070675_100000409
653 Ga0070675_100095851
654 Ga0070675_100118780
655 Ga0070675_100195227
656 Ga0070675_100563618
657 Ga0070671_100005955
658 Ga0070674_100001653
659 Ga0070674_100066320
660 Ga0070673_100287084
661 Ga0070673_100415713
662 Ga0070688_100005352
663 Ga0070688_100196804
664 Ga0070659_100071584
665 Ga0070714_100026585
666 Ga0070711_100250407
667 Ga0070700_100194131
668 Ga0070694_100011045
669 Ga0070678_100034448
670 Ga0070678_100046435
671 Ga0070662_100200224
672 Ga0070681_10014599
673 Ga0070681_10058365
674 Ga0068867_100142482
675 Ga0070706_100095469
676 Ga0070706_100153483
677 Ga0070707_100147807
678 Ga0070707_100234322
679 Ga0070698_100000242
680 Ga0070698_100043713
681 Ga0070698_100451707
682 Ga0070699_100000778
683 Ga0070699_100007944
684 Ga0070699_100051949
685 Ga0070679_100008891
686 Ga0068853_100188676
687 Ga0070672_100063496
688 Ga0070672_100116539
689 Ga0070686_100328849
690 Ga0070695_100007869
691 Ga0070695_100064422
692 Ga0070696_100002023
693 Ga0070696_100005044
694 Ga0070696_100268081
695 Ga0070665_100013471
696 Ga0070665_100068290
697 Ga0070665_100252726
698 Ga0070665_100305844
699 Ga0070664_100063944
700 Ga0068854_100002297
701 Ga0068854_100018330
702 Ga0070702_100000841
703 Ga0068859_100018140
704 Ga0068859_100158538
705 Ga0068859_100334461
706 Ga0068864_100093317
707 Ga0068864_100198580
708 Ga0068864_100244848
709 Ga0068866_10019831
710 Ga0068866_10059727
711 Ga0068861_100008055
712 Ga0068861_100056837
713 Ga0068861_100091863
714 Ga0068861_100254353
715 Ga0068870_10053512
716 Ga0068863_100078901
717 Ga0068858_100017485
718 Ga0068858_100218247
719 Ga0068858_100302520
720 Ga0068860_100015479
721 Ga0068862_100015234
722 Ga0068862_100016044
723 Ga0068862_100152513
724 Ga0068862_100338122
725 Ga0081455_10095174
726 Ga0081540_1116953
727 Ga0081539_10018397
728 Ga0075366_10080957
729 Ga0097621_100001649
730 Ga0097621_100027249
731 Ga0097621_100031149
732 Ga0097621_100033502
733 Ga0097621_100043873
734 Ga0097621_100064975
735 Ga0097621_100336999
736 Ga0068871_100000409
737 Ga0068871_100026234
738 Ga0068871_100033791
739 Ga0068871_100034049
740 Ga0075428_100000108
741 Ga0075428_100028284
742 Ga0075428_100037397
743 Ga0075428_100087697
744 Ga0075428_100340885
745 Ga0075430_100047574
746 Ga0075431_100011979
747 Ga0075431_100049355
748 Ga0075431_100260238
749 Ga0075431_100281757
750 Ga0075431_100362799
751 Ga0075433_10047327
752 Ga0075433_10068216
753 Ga0075433_10105775
754 Ga0075433_10111761
755 Ga0075434_100013793
756 Ga0075434_100106439
757 Ga0075434_100189900
758 Ga0075434_100191115
759 Ga0075434_100217697
760 Ga0075429_100014774
761 Ga0068865_100012815
762 Ga0068865_100033937
763 Ga0068865_100109384
764 Ga0075436_100000801
765 Ga0075436_100024573
766 Ga0075436_100027012
767 Ga0075436_100091406
768 Ga0097620_100018140
769 Ga0097620_100158541
770 Ga0097620_100334482
771 Ga0075435_100000009
772 Ga0075435_100000849
773 Ga0075435_100002789
774 Ga0075435_100004370
775 Ga0075435_100012667
776 Ga0075435_100060770
777 Ga0075435_100072807
778 Ga0075435_100130196
779 Ga0105240_10023988
780 Ga0111539_10000001
781 Ga0111539_10002783
782 Ga0111539_10005778
783 Ga0111539_10006101
784 Ga0111539_10039623
785 Ga0111539_10169607
786 Ga0111539_10265493
787 Ga0105245_10021503
788 Ga0105245_10152745
789 Ga0105247_10087786
790 Ga0114129_10001825
791 Ga0114129_10002818
792 Ga0114129_10003225
793 Ga0114129_10008909
794 Ga0114129_10015684
795 Ga0114129_10018349
796 Ga0114129_10095315
797 Ga0114129_10177686
798 Ga0114129_10177989
799 Ga0114129_10289011
800 Ga0105243_10052685
801 Ga0105243_10280758
802 Ga0105243_10287824
803 Ga0105242_10004183
804 Ga0105242_10252444
805 Ga0105242_10343648
806 Ga0105242_10438509
807 Ga0105248_10047346
808 Ga0105248_10061061
809 Ga0105248_10091358
810 Ga0105248_10103317
811 Ga0105248_10164623
812 Ga0105248_10331747
813 Ga0105248_10360566
814 Ga0105248_10433254
815 Ga0105248_10469850
816 Ga0105249_10001034
817 Ga0105249_10133544
818 Ga0105249_10156896
819 Ga0105249_10403455
820 Ga0105246_10044044
821 Ga0105246_10376324
822 Ga0157374_10017001
823 Ga0163162_10032273
824 Ga0163162_10116439
825 Ga0163162_10367310
826 Ga0157372_10372243
827 Ga0157375_10049944
828 Ga0157375_10288059
829 Ga0157375_10362021
830 Ga0163163_10004026
831 Ga0163163_10112167
832 Ga0157380_10009700
833 Ga0157380_10050743
834 Ga0157380_10318082
835 Ga0157380_10401576
836 Ga0157380_10510265
837 Ga0157379_10059976
838 Ga0157379_10090546
839 Ga0157376_10011629
840 Ga0157376_10302182
841 Ga0157376_10325889
842 Ga0157376_10374048
843 Ga0163161_10007977
844 Ga0207682_10008407
845 Ga0207710_10065126
846 Ga0207680_10043126
847 Ga0207680_10073924
848 Ga0207680_10108659
849 Ga0207699_10153557
850 Ga0207645_10050060
851 Ga0207645_10058331
852 Ga0207705_10319231
853 Ga0207684_10125994
854 Ga0207707_10049347
855 Ga0207695_10035622
856 Ga0207695_10090085
857 Ga0207663_10180776
858 Ga0207660_10167402
859 Ga0207662_10167930
860 Ga0207657_10006192
861 Ga0207657_10021487
862 Ga0207657_10255286
863 Ga0207649_10072246
864 Ga0207649_10267189
865 Ga0207652_10122376
866 Ga0207652_10216603
867 Ga0207646_10047273
868 Ga0207646_10126596
869 Ga0207681_10007913
870 Ga0207681_10026759
871 Ga0207681_10058552
872 Ga0207681_10103508
873 Ga0207681_10172580
874 Ga0207650_10212354
875 Ga0207650_10249716
876 Ga0207650_10342085
877 Ga0207659_10028141
878 Ga0207659_10092242
879 Ga0207659_10496275
880 Ga0207687_10207555
881 Ga0207644_10225918
882 Ga0207690_10262719
883 Ga0207706_10076519
884 Ga0207686_10027463
885 Ga0207686_10034003
886 Ga0207686_10107343
887 Ga0207709_10074678
888 Ga0207669_10000305
889 Ga0207669_10005211
890 Ga0207669_10029234
891 Ga0207669_10032418
892 Ga0207669_10032588
893 Ga0207704_10013184
894 Ga0207704_10034234
895 Ga0207704_10049104
896 Ga0207691_10064437
897 Ga0207711_10008589
898 Ga0207711_10082349
899 Ga0207711_10131719
900 Ga0207711_10145760
901 Ga0207711_10153892
902 Ga0207711_10342632
903 Ga0207711_10532195
904 Ga0207689_10117004
905 Ga0207661_10033256
906 Ga0207679_10056608
907 Ga0207679_10075787
908 Ga0207679_10452418
909 Ga0207667_10096292
910 Ga0207651_10118427
911 Ga0207651_10333256
912 Ga0207712_10002893
913 Ga0207712_10168672
914 Ga0207668_10372347
915 Ga0207640_10018780
916 Ga0207677_10014266
917 Ga0207703_10065616
918 Ga0207703_10134074
919 Ga0207703_10150503
920 Ga0207639_10151142
921 Ga0207708_10262435
922 Ga0207708_10325506
923 Ga0207641_10007543
924 Ga0207648_10004126
925 Ga0207648_10094453
926 Ga0207648_10205624
927 Ga0207648_10217178
928 Ga0207648_10250806
929 Ga0207676_10364657
930 Ga0207675_100003439
931 Ga0207675_100051381
932 Ga0207675_100069785
933 Ga0207675_100109370
934 Ga0207675_100112704
935 Ga0207675_100221260
936 Ga0207675_100319011
937 Ga0207675_100483862
938 Ga0207683_10023780
939 Ga0207683_10028653
940 Ga0207683_10120568
941 Ga0207698_10405266
942 Ga0207428_10000002
943 Ga0207428_10005172
944 Ga0207428_10008456
945 Ga0207428_10060838
946 Ga0207428_10083553
947 Ga0268266_10042800
948 Ga0268266_10159858
949 Ga0268266_10559422
950 Ga0268265_10015207
951 Ga0268265_10017891
952 Ga0268265_10238029
953 Ga0268265_10273284
954 Ga0268265_10397308
955 Ga0268264_10011434
956 Ga0307408_100020577
957 Ga0307408_100025812
958 Ga0307408_100031481
959 Ga0307405_10007416
960 Ga0307413_10014665
961 Ga0307413_10131702
962 Ga0307413_10280097
963 Ga0307410_10004394
964 Ga0307410_10017547
965 Ga0307410_10033944
966 Ga0307410_10061905
967 Ga0307410_10151866
968 Ga0307406_10028135
969 Ga0307406_10046782
970 Ga0307407_10023545
971 Ga0307407_10024858
972 Ga0307412_10012993
973 Ga0307412_10032348
974 Ga0307412_10199320
975 Ga0307409_100007417
976 Ga0307409_100015445
977 Ga0307409_100024112
978 Ga0307416_100035512
979 Ga0307416_100082628
980 Ga0307416_100095836
981 Ga0307416_100099504
982 Ga0307416_100286316
983 Ga0307414_10013274
984 Ga0307414_10119012
985 Ga0307411_10004122
986 Ga0307411_10081225
987 Ga0307411_10154621
988 Ga0307415_100004221
989 Ga0373930_0003227
990 Ga0373948_0001914
991 Ga0373950_0002238
992 Ga0373958_0002618
993 Ga0373938_0000850
994 Ga0373928_0001702
995 Ga0373929_0001252
996 Ga0373940_0003861
997 Ga0373949_0004047
998 Ga0373951_0000861
999 Ga0373952_0000441
1000 Ga0373923_0032795
1001 Ga0373932_0001914
1002 Ga0373939_0000245
1003 Ga0373941_0000417
1004 Ga0373956_0011575
1005 Ga0373943_0001891
1006 Ga0373943_0109996
1007 Ga0373946_0037735
1008 Ga0373955_0095298
1009 Ga0373942_0004901
1010 Ga0373961_0010923
1011 Ga0373924_0060444
1012 Ga0373924_0083868
1013 Ga0373931_0016778
1014 Ga0373947_0157058
1015 Ga0373937_0151144
1016 Ga0373925_0057639
1017 Ga0373925_0095030
1018 Ga0316581_0037849
1019 Ga0450920_022810
1020 Ga0439446_0013873
1021 Ga0439434_0027930
1022 Ga0450918_016949
1023 Ga0451577_0059930
1024 Ga0495603_0054290
1025 Ga0495603_0067256
1026 Ga0495629_0004294
1027 Ga0495629_0086961
1028 Ga0495629_0159753
1029 Ga0495638_0010376
1030 Ga0495653_0061676
1031 Ga0495582_0054756
1032 Ga0495639_0021307
1033 Ga0495639_0063249
1034 Ga0495664_0080384
1035 Ga0495594_0015094
1036 Ga0495608_0125647
1037 Ga0495630_0001261
1038 Ga0495652_0260406
1039 Ga0495586_0078028
1040 Ga0495587_0098153
1041 Ga0495645_0126532
1042 Ga0495667_0157375
1043 Ga0495634_0047346
1044 Ga0495635_0098329
1045 Ga0495635_0109169
1046 Ga0495659_0073698
1047 Ga0495599_0215790
1048 Ga0495658_0088613
1049 Ga0495658_0095515
1050 Ga0495613_0002633
1051 Ga0495613_0074910
1052 Ga0495636_0109390
1053 Ga0495674_0032656
1054 Ga0495676_0088242
1055 Ga0495680_0168644
1056 Ga0495680_0243260
1057 Ga0495684_0000550
1058 Ga0495684_0208834
1059 Ga0496100_0027682
1060 Ga0496101_0001572
1061 Ga0496101_0069030
1062 Ga0496104_0004524
1063 Ga0496104_0128261
1064 Ga0496104_0380816
1065 Ga0496104_0414445
1066 Ga0496105_0067725
1067 Ga0496105_0071239
1068 Ga0496105_0237524
1069 Ga0496106_0096896
1070 Ga0496106_0120811
1071 Ga0496107_0024952
1072 Ga0496108_0009473
1073 Ga0496108_0013709
1074 Ga0496108_0069206
1075 Ga0496109_0088183
1076 Ga0496109_0097983
1077 Ga0496109_0167307
1078 Ga0496110_0052389
1079 Ga0496110_0101759
1080 Ga0496111_0118661
1081 Ga0496111_0311154
1082 Ga0496112_0000420
1083 Ga0496112_0001633
1084 Ga0496112_0014861
1085 Ga0496112_0080510
1086 Ga0496112_0096301
1087 Ga0496113_0003692
1088 Ga0496114_0000310
1089 Ga0496114_0001016
1090 Ga0496114_0085262
1091 Ga0496114_0098972
1092 Ga0501299_002844
1093 Ga0501031_0005625
1094 Ga0501031_0055828
1095 Ga0501031_0104095
1096 Ga0501032_0006096
1097 Ga0501032_0006429
1098 Ga0501032_0036930
1099 Ga0501033_0002589
1100 Ga0501033_0003111
1101 Ga0501033_0009796
1102 Ga0501034_0043081
1103 Ga0501036_0019728
1104 Ga0501036_0057012
1105 Ga0501036_0059276
1106 Ga0501037_0002630
1107 Ga0501037_0061536
1108 Ga0501037_0074714
1109 Ga0501038_0003572
1110 Ga0501038_0007055
1111 Ga0501039_0016043
1112 Ga0501040_0001813
1113 Ga0501040_0037921
1114 Ga0501040_0216977
1115 Ga0501041_0002041
1116 Ga0501041_0076200
1117 Ga0501041_0081634
1118 Ga0501042_0007851
1119 Ga0501042_0012885
1120 Ga0501042_0074994
1121 Ga0501043_0059717
1122 Ga0501043_0070090
1123 Ga0501043_0083001
1124 Ga0501046_0002936
1125 Ga0501046_0012214
1126 Ga0501046_0015384
1127 Ga0501046_0029917
1128 Ga0501047_0009879
1129 Ga0501047_0012447
1130 Ga0501047_0050450
1131 Ga0501047_0110067
1132 Ga0501048_0006094
1133 Ga0501048_0013038
1134 Ga0501048_0026975
1135 Ga0501048_0027342
1136 Ga0501048_0068817
1137 Ga0501067_0002490
1138 Ga0501067_0033364
1139 Ga0501068_0007267
1140 Ga0501068_0073834
1141 Ga0501068_0130451
1142 Ga0501070_0012708
1143 Ga0501070_0038040
1144 Ga0501071_0004994
1145 Ga0501071_0346862
1146 Ga0501072_0011542
1147 Ga0501072_0012388
1148 Ga0501072_0090523
1149 Ga0501073_0002562
1150 Ga0501073_0025302
1151 Ga0501074_0005912
1152 Ga0501074_0011030
1153 Ga0501075_0004045
1154 Ga0501075_0039505
1155 Ga0501075_0078559
1156 Ga0501076_0013993
1157 Ga0501076_0017353
1158 Ga0501076_0041770
1159 Ga0501076_0049106
1160 Ga0501076_0081048
1161 Ga0501076_0114191
1162 Ga0501079_0006613
1163 Ga0501079_0009847
1164 Ga0501079_0013881
1165 Ga0501079_0054164
1166 Ga0501080_0009580
1167 Ga0501080_0010787
1168 Ga0501080_0111872
1169 Ga0501081_0002428
1170 Ga0501081_0030712
1171 Ga0501083_0005836
1172 Ga0501035_0011728
1173 Ga0501035_0033179
1174 Ga0501035_0046173
1175 Ga0501044_0031603
1176 Ga0501045_0001051
1177 nmdc:mga00v17_40300_c1
1178 nmdc:mga05p37_115170_c1
1179 nmdc:mga05p37_161033_c1
1180 nmdc:mga05p37_21642_c1
1181 nmdc:mga05p37_41507_c1
1182 nmdc:mga05p37_41843_c1
1183 nmdc:mga05p37_51424_c1
1184 nmdc:mga05p37_59416_c1
1185 nmdc:mga05p37_61701_c1
1186 nmdc:mga05p37_84214_c1
1187 nmdc:mga05p37_9528_c1
1188 nmdc:mga0qj67_2331_c1
1189 nmdc:mga0qj67_64610_c1
1190 nmdc:mga06r32_241695_c1
1191 nmdc:mga06r32_25093_c1
1192 nmdc:mga06r32_44481_c1
1193 nmdc:mga06r32_7501_c1
1194 nmdc:mga06r32_87390_c1
1195 nmdc:mga08y16_156397_c1
1196 nmdc:mga08y16_179791_c1
1197 nmdc:mga08y16_30958_c1
1198 nmdc:mga08y16_335669_c1
1199 nmdc:mga08y16_3_c1
1200 nmdc:mga08y16_5107_c1
1201 nmdc:mga08y16_524_c1
1202 nmdc:mga0n895_3475_c1
1203 nmdc:mga0n895_36679_c1
1204 nmdc:mga0n895_56048_c1
1205 nmdc:mga0n895_644453_c1
1206 nmdc:mga0n895_6498_c1
1207 nmdc:mga0n895_67_c1
1208 nmdc:mga0n895_9091_c1
1209 nmdc:mga0n895_91346_c1
1210 nmdc:mga0rr50_25_c1
1211 nmdc:mga0rr50_3136_c1
1212 nmdc:mga0rr50_46289_c1
1213 nmdc:mga0rr50_73446_c1
1214 nmdc:mga0rr50_96749_c1
1215 nmdc:mga08x19_105262_c1
1216 nmdc:mga08x19_110624_c1
1217 nmdc:mga08x19_111318_c1
1218 nmdc:mga08x19_213_c1
1219 nmdc:mga08x19_3059_c1
1220 nmdc:mga08x19_5150_c1
1221 nmdc:mga0a205_116755_c1
1222 nmdc:mga0a205_23898_c1
1223 nmdc:mga0a205_256041_c1
1224 nmdc:mga0a205_276734_c1
1225 nmdc:mga0a205_67689_c1
1226 nmdc:mga0a205_8756_c1
1227 Ga0495601_0043705
1228 Ga0495601_0183450
1229 Ga0495619_0010658
1230 Ga0495619_0026085
1231 Ga0500592_005332
1232 Ga0501084_0001248
1233 Ga0501084_0009843
1234 Ga0501084_0023883
1235 Ga0501084_0025595
1236 Ga0501084_0204638
1237 Ga0590071_000060
1238 Ga0590071_001017
1239 Ga0590075_000043
1240 Ga0590075_000598
1241 Ga0590075_000898
1242 Ga0590077_000073
1243 Ga0590077_000569
1244 Ga0590077_002267
1245 Ga0590077_027636
1246 Ga0501082_0000929
1247 Ga0501082_0006033
1248 Ga0501082_0073721
1249 Ga0530510_0007416
1250 Ga0530510_0104729

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02562

PhoH

PhoH-like protein

105

309

0.99

PF13245

AAA_19

AAA domain

113

267

0.84

PF13604

AAA_30

AAA domain

109

317

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
3b85-assembly1.cif.gz_B crystal structure of predicted phosphate starvation-induced atpase phoh2 from corynebacterium glutamicum 0.9433 106 308
3b85-assembly1.cif.gz_A crystal structure of predicted phosphate starvation-induced atpase phoh2 from corynebacterium glutamicum 0.931 106 308
3b85-assembly1.cif.gz_B crystal structure of predicted phosphate starvation-induced atpase phoh2 from corynebacterium glutamicum 0.9286 106 308
3b85-assembly1.cif.gz_A crystal structure of predicted phosphate starvation-induced atpase phoh2 from corynebacterium glutamicum 0.9164 106 308
6y2d-assembly1.cif.gz_A crystal structure of the second kh domain of fubp1 0.8217 2 59
ID Description Score Start End Superfamily
af_Q2FY01_105_312_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9598 104 308 3.40.50.300
af_Q2FY01_105_312_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9418 104 308 3.40.50.300
3b85B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9383 106 308 3.40.50.300
af_P0A9K1_146_354_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.929 104 308 3.40.50.300
3b85B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9232 106 308 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A3S5JYU4-F1-model_v4 PhoH-like protein 0.9886 186 313 GO:0005524
GO:0005829
AF-A0A7W1SZF0-F1-model_v4 PhoH-like protein 0.9885 195 313 GO:0005524
GO:0005829
AF-A0A7W1G000-F1-model_v4 PhoH-like protein 0.9882 218 310 GO:0005524
GO:0005829
AF-A0A6I1VZW7-F1-model_v4 PhoH-like protein 0.9839 182 302 GO:0005524
GO:0005829
AF-A0A356U6Y2-F1-model_v4 PhoH-like protein 0.9813 209 313 GO:0005524
GO:0005829

Map