F469961

General Info

Members Datasets Scaffolds Average Seq Length
620 440 374 265

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2615840624|2616296600
Length 310
Sequence WTDEWGCGHDGKHHINNWQVYGCDRDGLRTSDSGVLARVANGKRTMLRTFEKAALEAGKAIITVLREGFPVAMKADASPVTVADEQAERIILAHLARDYPEIPVVAEESVAAGQVPDISGRSFFLVDPLDGTREFVDGRQEFTVNIAYIEDGAPVAGIVYAPALGLAFSGERGHAERLVVTEDFTVGARTAITVREQPDDRLALASLRHNSPETRTFLTDHAISKCTNIGSSLKFCLLAEGKADVYPRFTRTMEWDTAAGDAVLRAAGGSTVTLDGAPLTYGKTGTAADFDFANPNFISWGGRKRALEPA

Samples

Sample ID Description Type Environment
1 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
2 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
3 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
4 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
5 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
6 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
7 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
8 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
9 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
10 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
11 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
12 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
13 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
14 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
15 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
16 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
17 2513237351 Mesorhizobium alhagi CCNWXJ12-2 Isolate Nodule
18 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
19 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
20 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
21 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
22 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
23 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
24 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
25 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
26 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
27 2519899620 Rhizobium sp. Pop5 Isolate Nodule
28 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
29 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
30 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
31 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
32 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
33 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
34 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
35 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
36 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
37 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
38 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
39 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
40 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
41 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
42 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
43 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
44 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
45 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
46 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
47 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
48 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
49 2643221599 Rhizobium sp. Root708 Isolate Unclassified
50 2643221607 Rhizobium sp. Root73 Isolate Unclassified
51 2643221610 Ensifer sp. Root74 Isolate Unclassified
52 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
53 2643221668 Ensifer sp. Root423 Isolate Unclassified
54 2643221675 Ensifer sp. Root1298 Isolate Unclassified
55 2643221680 Ensifer sp. Root1312 Isolate Unclassified
56 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
57 2643221719 Rhizobium sp. Root274 Isolate Unclassified
58 2643221723 Ensifer sp. Root278 Isolate Unclassified
59 2643221726 Ensifer sp. Root954 Isolate Unclassified
60 2718217882 Rhizobium sp. N741 Isolate Nodule
61 2718217927 Rhizobium sp. N324 Isolate Nodule
62 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
63 2718218009 Rhizobium sp. N561 Isolate Nodule
64 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
65 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
66 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
67 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
68 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
69 2718218363 Rhizobium sp. N113 Isolate Nodule
70 2718218365 Rhizobium sp. N731 Isolate Nodule
71 2718218366 Rhizobium sp. N621 Isolate Nodule
72 2718218423 Rhizobium sp. N941 Isolate Nodule
73 2721755514 Rhizobium sp. N6212 Isolate Nodule
74 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
75 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
76 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
77 2721755809 Rhizobium sp. N541 Isolate Nodule
78 2721755810 Rhizobium sp. N871 Isolate Nodule
79 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
80 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
81 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
82 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
83 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
84 2728369365 Rhizobium sp. N1341 Isolate Nodule
85 2728369397 Rhizobium sp. N1314 Isolate Nodule
86 2738541293 Rhizobium sp. GV031 Isolate Unclassified
87 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
88 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
89 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
90 2791355253 Rhizobium rhizosphaerae RD15 Isolate Rhizosphere
91 2791355256 Rhizobium sp. M10 Isolate Nodule
92 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
93 2791355260 Rhizobium sp. L9 Isolate Nodule
94 2791355261 Rhizobium sp. J15 Isolate Nodule
95 2791355262 Rhizobium sp. M1 Isolate Nodule
96 2791355263 Rhizobium chutanense C5 Isolate Nodule
97 2791355264 Rhizobium sp. S9 Isolate Nodule
98 2791355265 Rhizobium sp. H4 Isolate Nodule
99 2791355266 Rhizobium sp. L43 Isolate Nodule
100 2791355267 Rhizobium sp. L18 Isolate Nodule
101 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
102 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
103 2802429633 Rhizobium anhuiense J3 Isolate Nodule
104 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
105 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
106 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
107 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
108 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
109 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
110 2838048938 Rhizobium pisi 27/80 Isolate Nodule
111 2838061910 Rhizobium phaseoli L15 Isolate Nodule
112 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
113 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
114 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
115 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
116 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
117 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
118 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
119 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
120 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
121 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
122 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
123 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
124 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
125 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
126 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
127 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
128 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
129 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
130 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
131 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
132 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
133 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
134 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
135 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
136 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
137 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
138 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
139 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
140 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
141 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
142 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
143 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
144 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
145 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
146 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
147 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
148 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
149 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
150 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
151 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
152 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
153 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
154 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
155 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
156 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
157 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
158 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
159 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
160 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
161 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
162 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
163 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
164 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
165 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
166 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
167 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
168 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
169 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
170 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
171 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
172 2888350351 Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 Isolate Nodule
173 2889010040 Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 Isolate Nodule
174 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
175 2906354277 Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 Isolate Nodule
176 2917554339 Chthonobacter rhizosphaerae yh7-1 Isolate Rhizosphere
177 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
178 2919450847 Ancylobacter sp. 3268 Isolate Rhizosphere
179 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
180 2922130491 Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 Isolate Nodule
181 2922185730 Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 Isolate Nodule
182 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
183 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
184 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
185 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
186 2933599457 Rhizobium phaseoli M3 Isolate Nodule
187 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
188 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
189 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
190 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
191 2936381700 Rhizobium chutanense C16 Isolate Unclassified
192 2937843397 Mesorhizobium xinjiangense lm94 Isolate Rhizosphere
193 2939669807 Kaistia defluvii 3207 Isolate Rhizosphere
194 2958100919 Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 Isolate Nodule
195 2958144490 Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 Isolate Nodule
196 2958172287 Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 Isolate Nodule
197 2965119406 Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 Isolate Nodule
198 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
199 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
200 2977971508 Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 Isolate Nodule
201 2979710463 Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 Isolate Nodule
202 2979742915 Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 Isolate Nodule
203 2987652177 Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 Isolate Nodule
204 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
205 2996887358 Rhizobium sp. R711 Isolate Nodule
206 2996893221 Rhizobium sp. R635 Isolate Nodule
207 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
208 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
209 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
210 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
211 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
212 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
213 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
214 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
215 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
216 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
217 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
218 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
219 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
220 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
221 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
222 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
223 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
224 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
225 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
226 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
227 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
228 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
229 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
230 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
231 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
232 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
233 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
234 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
235 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
236 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
237 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
238 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
239 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
240 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
241 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
242 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
243 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
244 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
245 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
246 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
247 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
248 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
249 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
250 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
251 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
252 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
253 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
254 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
255 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
256 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
257 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
258 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
259 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
260 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
261 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
262 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
263 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
264 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
265 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
266 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
267 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
268 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
269 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
270 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
271 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
272 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
273 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
274 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
275 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
276 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
277 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
278 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
279 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
280 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
281 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
282 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
283 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
284 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
285 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
286 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
287 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
288 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
289 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
290 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
291 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
292 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
293 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
294 3300041506 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaT Metatranscriptome Unclassified
295 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
296 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
297 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
298 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
299 3300041916 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaT_extra_run Metatranscriptome Unclassified
300 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
301 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
302 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
303 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
304 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
305 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
306 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
307 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
308 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
309 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
310 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
311 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
312 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
313 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
314 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
315 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
316 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
317 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
318 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
319 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
320 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
321 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
322 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
323 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
324 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
325 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
326 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
327 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
328 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
329 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
330 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
331 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
332 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
333 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
334 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
335 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
336 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
337 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
338 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
339 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
340 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
341 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
342 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
343 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
344 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
345 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
346 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
347 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
348 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
349 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
350 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
351 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
352 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
353 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
354 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
355 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
356 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
357 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
358 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
359 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
360 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
361 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
362 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
363 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
364 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
365 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
366 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
367 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
368 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
369 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
370 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
371 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
372 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
373 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
374 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
375 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
376 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
377 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
378 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
379 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
380 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
381 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
382 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
383 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
384 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
385 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
386 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
387 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
388 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
389 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
390 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
391 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
392 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
393 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
394 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
395 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
396 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
397 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
398 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
399 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
400 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
401 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
402 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
403 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
404 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
405 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
406 8001845381 Ancylobacter sonchi VKM B-3145 Isolate Unclassified
407 8005258706 Rhizobium sp. R693 Isolate Nodule
408 8005275841 Rhizobium sp. N4311 Isolate Nodule
409 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
410 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
411 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
412 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
413 8005321885 Rhizobium sp. R72 Isolate Nodule
414 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
415 8005382845 Rhizobium sp. R634 Isolate Nodule
416 8005395548 Rhizobium sp. R339 Isolate Nodule
417 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
418 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
419 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
420 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
421 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
422 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
423 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
424 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
425 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
426 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
427 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
428 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
429 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
430 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
431 8018176218 Rhizobium sp. N122 Isolate Nodule
432 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
433 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
434 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
435 8024501048 Rhizobium sp. H4 Isolate Nodule
436 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
437 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
438 8056382006 Rhizobium croatiense 13T Isolate Nodule
439 8057575449 Rhizobium mayense CCGE526 Isolate Nodule
440 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 60
Metatranscriptomes 0.32
Isolates 39.68

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 26.29
Nodule 30.81
Rhizoplane 1.94
Rhizosphere 25.97
Stem 0
Stem Tuber 0
Unclassified 15

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24735J21928_10002268 3300002067 Bacteria 6716
2 JGI25158J39367_1000041 3300002739 Bacteria 29153
3 JGI25152J39213_1003427 3300002773 Bacteria 5422
4 JGI25152J39213_1007285 3300002773 Bacteria 2886
5 JGI25152J39213_1007516 3300002773 Bacteria 2815
6 JGI25152J39213_1007643 3300002773 Bacteria 2775
7 JGI25152J39213_1011539 3300002773 Bacteria 1949
8 JGI25150J39212_1000024 3300002774 Bacteria 129646
9 JGI25150J39212_1004074 3300002774 Bacteria 3306
10 JGI25159J45721_1000008 3300002987 Bacteria 172667
11 JGI25159J45721_1000139 3300002987 Bacteria 33575
12 JGI25159J45721_1000319 3300002987 Bacteria 22419
13 JGI25151J46595_10000027 3300003187 Bacteria 208739
14 JGI25151J46595_10002431 3300003187 Bacteria 11218
15 JGI25151J46595_10010311 3300003187 Bacteria 4353
16 JGI25151J46595_10012596 3300003187 Bacteria 3842
17 JGI25153J46596_10005033 3300003215 Bacteria 6991
18 JGI25153J46596_10017555 3300003215 Bacteria 2815
19 JGI25153J46596_10017873 3300003215 Bacteria 2775
20 JGI25153J46596_10025313 3300003215 Bacteria 2122
21 JGI25153J46596_10028321 3300003215 Bacteria 1945
22 JGI25160J50197_1000001 3300003354 Bacteria 782301
23 JGI25160J50197_1000033 3300003354 Bacteria 172667
24 JGI25160J50197_1005943 3300003354 Bacteria 5011
25 JGI25161J50226_1000001 3300003374 Bacteria 655036
26 JGI25161J50226_1001204 3300003374 Bacteria 8464
27 JGI25161J50226_1003171 3300003374 Bacteria 3883
28 JGI25161J50226_1009887 3300003374 Bacteria 1317
29 Ga0055526_1001128 3300003771 Bacteria 19403
30 Ga0055526_1003009 3300003771 Bacteria 11002
31 Ga0055526_1022668 3300003771 Bacteria 2127
32 Ga0055526_1023655 3300003771 Bacteria 2043
33 Ga0055526_1029958 3300003771 Bacteria 1599
34 Ga0055524_1001616 3300003775 Bacteria 12604
35 Ga0055524_1001855 3300003775 Bacteria 11572
36 Ga0055524_1013183 3300003775 Bacteria 3131
37 Ga0055524_1020060 3300003775 Bacteria 2264
38 Ga0055524_1022835 3300003775 Bacteria 2030
39 Ga0055536_1010703 3300003781 Bacteria 3603
40 Ga0055528_1010143 3300003790 Bacteria 3865
41 Ga0055528_1011290 3300003790 Bacteria 3561
42 Ga0055528_1018980 3300003790 Bacteria 2304
43 Ga0055528_1021342 3300003790 Bacteria 2059
44 Ga0055528_1022000 3300003790 Bacteria 2000
45 Ga0055540_1000483 3300003792 Bacteria 30602
46 Ga0055540_1042028 3300003792 Bacteria 981
47 Ga0055531_10015393 3300003794 Bacteria 3372
48 Ga0055543_1000007 3300004625 Bacteria 204042
49 Ga0055543_1000026 3300004625 Bacteria 136177
50 Ga0055543_1000108 3300004625 Bacteria 71519
51 Ga0055543_1000220 3300004625 Bacteria 45860
52 Ga0065165_1000008 3300005262 Bacteria 334429
53 Ga0065165_1000513 3300005262 Bacteria 59506
54 Ga0065165_1002927 3300005262 Bacteria 13036
55 Ga0065165_1007891 3300005262 Bacteria 5107
56 Ga0065165_1023055 3300005262 Bacteria 2119
57 Ga0070670_100000279 3300005331 Bacteria 44846
58 Ga0070668_100037831 3300005347 Bacteria 3687
59 Ga0070663_100039457 3300005455 Bacteria 3299
60 Ga0068867_100534286 3300005459 Bacteria 1013
61 Ga0068855_100000253 3300005563 Bacteria 67247
62 Ga0068854_100121360 3300005578 Bacteria 1984
63 Ga0081540_1119821 3300005983 Bacteria 1094
64 Ga0081539_10006258 3300005985 Bacteria 11525
65 Ga0075365_10003241 3300006038 Bacteria 8334
66 Ga0075365_10008264 3300006038 Bacteria 5893
67 Ga0075365_10053193 3300006038 Bacteria 2681
68 Ga0075363_100020332 3300006048 Bacteria 3328
69 Ga0075364_10000366 3300006051 Bacteria 22238
70 Ga0075364_10178381 3300006051 Bacteria 1437
71 Ga0075362_10001472 3300006177 Bacteria 7546
72 Ga0075367_10008236 3300006178 Bacteria 5390
73 Ga0075367_10011578 3300006178 Bacteria 4674
74 Ga0075369_10001165 3300006186 Bacteria 8881
75 Ga0075369_10002676 3300006186 Bacteria 6383
76 Ga0075366_10019516 3300006195 Bacteria 3924
77 Ga0068865_100262865 3300006881 Bacteria 1367
78 Ga0105251_10072591 3300009011 Bacteria 1600
79 Ga0105248_10100952 3300009177 Bacteria 3252
80 Ga0105249_10273575 3300009553 Bacteria 1683
81 Ga0123341_1000018 3300009765 Bacteria 81421
82 Ga0123342_1011698 3300009766 Bacteria 9486
83 Ga0123342_1013853 3300009766 Bacteria 7915
84 Ga0157371_10004554 3300013102 Bacteria 12063
85 Ga0171463_1007 3300013249 Bacteria 301198
86 Ga0157372_10326181 3300013307 Bacteria 1787
87 Ga0182005_1005850 3300015265 Bacteria 3810
88 Ga0183363_1058 3300015690 Bacteria 33958
89 Ga0213873_10002659 3300021358 Bacteria 3119
90 Ga0209436_100098 3300025208 Bacteria 42522
91 Ga0209436_101218 3300025208 Bacteria 9353
92 Ga0207425_1000043 3300025245 Bacteria 208791
93 Ga0207425_1002607 3300025245 Bacteria 6244
94 Ga0209129_1000072 3300025258 Bacteria 208805
95 Ga0209129_1001109 3300025258 Bacteria 15672
96 Ga0209129_1003210 3300025258 Bacteria 7303
97 Ga0209129_1005322 3300025258 Bacteria 4605
98 Ga0209129_1006389 3300025258 Bacteria 3823
99 Ga0209129_1011299 3300025258 Bacteria 2143
100 Ga0209233_1000068 3300025261 Bacteria 377969
101 Ga0209233_1027145 3300025261 Bacteria 1391
102 Ga0209673_1000125 3300025273 Bacteria 168465
103 Ga0209673_1000256 3300025273 Bacteria 100514
104 Ga0209673_1000478 3300025273 Bacteria 66832
105 Ga0209673_1001106 3300025273 Bacteria 30133
106 Ga0209673_1002266 3300025273 Bacteria 13845
107 Ga0209673_1003587 3300025273 Bacteria 9023
108 Ga0209673_1005321 3300025273 Bacteria 6517
109 Ga0209130_1000003 3300025284 Bacteria 677988
110 Ga0209130_1000017 3300025284 Bacteria 388431
111 Ga0209130_1000023 3300025284 Bacteria 359355
112 Ga0209675_1012500 3300025291 Bacteria 2730
113 Ga0209025_1000120 3300025294 Bacteria 208791
114 Ga0209025_1000153 3300025294 Bacteria 170548
115 Ga0209025_1000537 3300025294 Bacteria 71838
116 Ga0209025_1001251 3300025294 Bacteria 35202
117 Ga0209025_1022507 3300025294 Bacteria 3337
118 Ga0209025_1055376 3300025294 Bacteria 1534
119 Ga0209025_1060809 3300025294 Bacteria 1415
120 Ga0209564_1000259 3300025295 Bacteria 112570
121 Ga0209564_1000372 3300025295 Bacteria 83053
122 Ga0209564_1000393 3300025295 Bacteria 78338
123 Ga0209564_1000778 3300025295 Bacteria 44316
124 Ga0209564_1005763 3300025295 Bacteria 6915
125 Ga0209564_1017246 3300025295 Bacteria 2826
126 Ga0209758_1000111 3300025297 Bacteria 208790
127 Ga0209758_1000666 3300025297 Bacteria 51353
128 Ga0209758_1002133 3300025297 Bacteria 20880
129 Ga0209758_1002159 3300025297 Bacteria 20688
130 Ga0209758_1003413 3300025297 Bacteria 14490
131 Ga0209758_1005070 3300025297 Bacteria 10437
132 Ga0209050_1008653 3300025298 Bacteria 5382
133 Ga0209050_1029307 3300025298 Bacteria 1763
134 Ga0209050_1029749 3300025298 Bacteria 1738
135 Ga0209256_1000283 3300025299 Bacteria 89387
136 Ga0209256_1000401 3300025299 Bacteria 68618
137 Ga0209256_1001708 3300025299 Bacteria 21121
138 Ga0209256_1003479 3300025299 Bacteria 10993
139 Ga0209256_1003760 3300025299 Bacteria 10240
140 Ga0209256_1010252 3300025299 Bacteria 3955
141 Ga0207426_1000006 3300025302 Bacteria 1025969
142 Ga0207426_1000011 3300025302 Bacteria 791203
143 Ga0207426_1000087 3300025302 Bacteria 288870
144 Ga0207426_1000386 3300025302 Bacteria 75890
145 Ga0207426_1001078 3300025302 Bacteria 25542
146 Ga0209051_1000434 3300025303 Bacteria 56673
147 Ga0209051_1007955 3300025303 Bacteria 5704
148 Ga0209257_1008572 3300025304 Bacteria 5764
149 Ga0209257_1013250 3300025304 Bacteria 3695
150 Ga0209257_1043251 3300025304 Bacteria 1322
151 Ga0207650_10000644 3300025925 Bacteria 27740
152 Ga0207644_10029811 3300025931 Bacteria 3788
153 Ga0207704_10208124 3300025938 Bacteria 1437
154 Ga0207667_10000035 3300025949 Bacteria 301056
155 Ga0207640_10116342 3300025981 Bacteria 1906
156 Ga0207678_10050378 3300026067 Bacteria 3598
157 Ga0207678_10148872 3300026067 Bacteria 1998
158 Ga0207648_10258982 3300026089 Bacteria 1552
159 Ga0207683_10330785 3300026121 Bacteria 1397
160 Ga0307515_10402244 3300028794 Bacteria 994
161 Ga0307515_10408981 3300028794 Bacteria 980
162 Ga0307513_10530235 3300031456 Bacteria 892
163 Ga0307406_10006974 3300031901 Bacteria 6256
164 Ga0307412_10000246 3300031911 Bacteria 35145
165 Ga0373927_0001234 3300035695 Bacteria 19428
166 Ga0373925_0001672 3300037068 Bacteria 18664
167 Ga0436365_0992978 3300039437 Bacteria 3860
168 Ga0436362_0498094 3300039453 Bacteria 4599
169 Ga0439465_0007313 3300041413 Bacteria 3507
170 Ga0439465_0009845 3300041413 Bacteria 3011
171 Ga0451787_639956 3300041441 Bacteria 1811
172 Ga0451800_1239096 3300041459 Bacteria 1616
173 Ga0451833_0025739 3300041491 Bacteria 4880
174 Ga0451835_0543336 3300041492 Bacteria 3304
175 Ga0451837_0379565 3300041494 Bacteria 1453
176 Ga0451839_0685993 3300041496 Bacteria 1676
177 Ga0451847_0447459 3300041503 Bacteria 1675
178 Ga0451849_0156250 3300041505 Bacteria 1429
179 Ga0451849_1292087 3300041505 Bacteria 1185
180 Ga0451850_54302 3300041506 Bacteria 1004
181 Ga0451851_0048305 3300041507 Bacteria 1425
182 Ga0451843_1316499 3300041509 Bacteria 2280
183 Ga0451855_0065409 3300041511 Bacteria 2610
184 Ga0451853_2392453 3300041512 Bacteria 1759
185 Ga0452271_88678 3300041916 Bacteria 1383
186 Ga0439435_0028984 3300042436 Bacteria 1492
187 Ga0495627_040112 3300046453 Bacteria 1443
188 Ga0495638_0070515 3300046460 Bacteria 2139
189 Ga0495650_0125820 3300046471 Bacteria 939
190 Ga0495662_0015387 3300046476 Bacteria 3715
191 Ga0495585_0006165 3300046492 Bacteria 7475
192 Ga0495585_0175732 3300046492 Bacteria 1103
193 Ga0495607_0061006 3300046501 Bacteria 2144
194 Ga0495607_0138855 3300046501 Bacteria 1256
195 Ga0495583_0014258 3300046506 Bacteria 4394
196 Ga0495583_0087269 3300046506 Bacteria 1348
197 Ga0495606_0038087 3300046507 Bacteria 3256
198 Ga0495606_0218079 3300046507 Bacteria 1077
199 Ga0495610_0018469 3300046512 Bacteria 3936
200 Ga0495610_0132273 3300046512 Bacteria 1082
201 Ga0495616_0014261 3300046513 Bacteria 4457
202 Ga0495616_0098392 3300046513 Bacteria 1375
203 Ga0495620_0019418 3300046515 Bacteria 3343
204 Ga0495620_0101217 3300046515 Bacteria 1148
205 Ga0495631_0001152 3300046518 Bacteria 16377
206 Ga0495631_0069499 3300046518 Bacteria 1523
207 Ga0495632_0008411 3300046519 Bacteria 6333
208 Ga0495632_0023675 3300046519 Bacteria 3276
209 Ga0495632_0025852 3300046519 Bacteria 3099
210 Ga0495632_0087790 3300046519 Bacteria 1478
211 Ga0495643_0003080 3300046522 Bacteria 12518
212 Ga0495643_0008502 3300046522 Bacteria 6490
213 Ga0495643_0043023 3300046522 Bacteria 2459
214 Ga0495644_0136316 3300046523 Bacteria 936
215 Ga0495648_0203125 3300046524 Bacteria 990
216 Ga0495609_0125530 3300046538 Bacteria 1101
217 Ga0495597_0011162 3300046542 Bacteria 4361
218 Ga0495622_0033298 3300046557 Bacteria 2405
219 Ga0495633_0072440 3300046558 Bacteria 1606
220 Ga0495668_0032836 3300046616 Bacteria 2918
221 Ga0495668_0039402 3300046616 Bacteria 2638
222 Ga0495634_0143241 3300046642 Bacteria 1516
223 Ga0495611_0111268 3300046648 Bacteria 1275
224 Ga0495625_0001949 3300046660 Bacteria 23345
225 Ga0495625_0106523 3300046660 Bacteria 1919
226 Ga0495635_0176857 3300046663 Bacteria 1451
227 Ga0495661_0070593 3300046665 Bacteria 2044
228 Ga0495588_0004906 3300046674 Bacteria 5933
229 Ga0495658_0020983 3300046683 Bacteria 3438
230 Ga0495613_0211508 3300046689 Bacteria 1364
231 Ga0495670_0061341 3300046691 Bacteria 1890
232 Ga0495649_0024666 3300046694 Bacteria 3353
233 Ga0495649_0205281 3300046694 Bacteria 1022
234 Ga0495589_0173811 3300046794 Bacteria 1023
235 Ga0495600_0061722 3300046809 Bacteria 2448
236 Ga0495604_0036684 3300047317 Bacteria 3864
237 Ga0495636_0049066 3300047318 Bacteria 1765
238 Ga0495636_0224915 3300047318 Bacteria 862
239 Ga0495672_0020241 3300047320 Bacteria 4366
240 Ga0495679_037959 3300047446 Bacteria 1512
241 Ga0495673_0083668 3300047469 Bacteria 1317
242 Ga0495681_0057653 3300047470 Bacteria 1803
243 Ga0495686_0002117 3300047472 Bacteria 19444
244 Ga0495686_0014002 3300047472 Bacteria 5542
245 Ga0495602_0107160 3300048088 Bacteria 2279
246 Ga0495626_0104089 3300048091 Bacteria 1235
247 Ga0496101_0067132 3300048904 Bacteria 2618
248 Ga0496101_0224612 3300048904 Bacteria 1458
249 Ga0496101_0525592 3300048904 Bacteria 935
250 Ga0496102_0457197 3300048905 Bacteria 1197
251 Ga0496104_0035114 3300048907 Bacteria 4680
252 Ga0496105_0159566 3300048908 Bacteria 1851
253 Ga0496106_0002212 3300048909 Bacteria 14510
254 Ga0496110_0032990 3300048913 Bacteria 4476
255 Ga0496113_0084367 3300048916 Bacteria 2439
256 Ga0496116_0023803 3300048919 Bacteria 4550
257 Ga0496116_0026875 3300048919 Bacteria 4198
258 Ga0496116_0045149 3300048919 Bacteria 2985
259 Ga0496116_0052138 3300048919 Bacteria 2712
260 Ga0496116_0062611 3300048919 Bacteria 2402
261 Ga0496116_0230312 3300048919 Bacteria 940
262 Ga0496117_0016312 3300048920 Bacteria 6274
263 Ga0496117_0047103 3300048920 Bacteria 3095
264 Ga0496118_0019759 3300048921 Bacteria 6007
265 Ga0496118_0030526 3300048921 Bacteria 4496
266 Ga0496118_0038974 3300048921 Bacteria 3799
267 Ga0496118_0052098 3300048921 Bacteria 3125
268 Ga0496118_0119862 3300048921 Bacteria 1719
269 Ga0496119_0029989 3300048922 Bacteria 3674
270 Ga0496119_0098754 3300048922 Bacteria 1644
271 Ga0496121_0003646 3300048924 Bacteria 21662
272 Ga0496121_0027313 3300048924 Bacteria 5342
273 Ga0496121_0035456 3300048924 Bacteria 4472
274 Ga0496121_0064964 3300048924 Bacteria 2972
275 Ga0496121_0104057 3300048924 Bacteria 2182
276 Ga0496121_0175689 3300048924 Bacteria 1551
277 Ga0496122_0012372 3300048925 Bacteria 8510
278 Ga0496122_0031276 3300048925 Bacteria 4434
279 Ga0496122_0047789 3300048925 Bacteria 3299
280 Ga0496122_0063226 3300048925 Bacteria 2703
281 Ga0496122_0201653 3300048925 Bacteria 1162
282 Ga0496123_0012474 3300048926 Bacteria 7244
283 Ga0496123_0032519 3300048926 Bacteria 3774
284 Ga0496123_0038758 3300048926 Bacteria 3344
285 Ga0496123_0117788 3300048926 Bacteria 1501
286 Ga0496124_0000067 3300048927 Bacteria 222576
287 Ga0496124_0013664 3300048927 Bacteria 7911
288 Ga0496124_0018045 3300048927 Bacteria 6625
289 Ga0496124_0028370 3300048927 Bacteria 5008
290 Ga0496124_0048779 3300048927 Bacteria 3615
291 Ga0496124_0169550 3300048927 Bacteria 1692
292 Ga0496124_0196161 3300048927 Bacteria 1540
293 Ga0496125_0029263 3300048928 Bacteria 4954
294 Ga0496125_0076997 3300048928 Bacteria 2573
295 Ga0496126_0043581 3300048929 Bacteria 4138
296 Ga0496126_0048702 3300048929 Bacteria 3871
297 Ga0496126_0157226 3300048929 Bacteria 1945
298 Ga0495678_023395 3300049459 Bacteria 2685
299 Ga0495678_089808 3300049459 Bacteria 1084
300 Ga0501031_0000104 3300049568 Bacteria 45024
301 Ga0501032_0000008 3300049569 Bacteria 240313
302 Ga0501032_0000156 3300049569 Bacteria 55416
303 Ga0501033_0000012 3300049570 Bacteria 241599
304 Ga0501033_0004949 3300049570 Bacteria 10595
305 Ga0501034_0000035 3300049571 Bacteria 241623
306 Ga0501034_0000087 3300049571 Bacteria 166714
307 Ga0501034_0005300 3300049571 Bacteria 14140
308 Ga0501034_0067952 3300049571 Bacteria 3575
309 Ga0501034_0259549 3300049571 Bacteria 1680
310 Ga0501036_0000006 3300049572 Bacteria 241623
311 Ga0501037_0000014 3300049573 Bacteria 171015
312 Ga0501037_0000072 3300049573 Bacteria 94452
313 Ga0501037_0207238 3300049573 Bacteria 1384
314 Ga0501038_0000007 3300049574 Bacteria 210775
315 Ga0501038_0000023 3300049574 Bacteria 151469
316 Ga0501038_0053872 3300049574 Bacteria 3461
317 Ga0501039_0000012 3300049575 Bacteria 241623
318 Ga0501039_0000101 3300049575 Bacteria 59353
319 Ga0501039_0212196 3300049575 Bacteria 1522
320 Ga0501043_0000194 3300049579 Bacteria 55458
321 Ga0501043_0000448 3300049579 Bacteria 36938
322 Ga0501043_0141649 3300049579 Bacteria 1883
323 Ga0501043_0312479 3300049579 Bacteria 1199
324 Ga0501046_0275842 3300049580 Bacteria 1232
325 Ga0501047_0002026 3300049581 Bacteria 19394
326 Ga0501047_0046656 3300049581 Bacteria 4187
327 Ga0501070_0010344 3300049586 Bacteria 7886
328 Ga0501080_0254720 3300049742 Bacteria 1600
329 Ga0501083_0045818 3300049744 Bacteria 2957
330 Ga0501280_002407 3300049776 Bacteria 3127
331 Ga0501035_0000035 3300049822 Bacteria 166916
332 Ga0501035_0006893 3300049822 Bacteria 10611
333 Ga0501035_0245627 3300049822 Bacteria 1521
334 Ga0501044_0000015 3300049823 Bacteria 241623
335 Ga0501044_0068605 3300049823 Bacteria 3612
336 Ga0501044_0069820 3300049823 Bacteria 3576
337 Ga0501044_0141294 3300049823 Bacteria 2396
338 nmdc:mga03683_3292_c1 3300050489 Bacteria 5187
339 nmdc:mga00v17_288_c1 3300050491 Bacteria 29437
340 nmdc:mga0yw44_28491_c1 3300050492 Bacteria 3213
341 nmdc:mga0k408_4656_c1 3300050493 Bacteria 7269
342 nmdc:mga06z11_960_c1 3300050494 Bacteria 10496
343 nmdc:mga07m45_1571_c1 3300050496 Bacteria 10506
344 nmdc:mga07m45_52666_c1 3300050496 Bacteria 2298
345 nmdc:mga0sz30_6394_c1 3300050516 Bacteria 4370
346 Ga0500610_0012466 3300053079 Bacteria 3918
347 Ga0495655_0043308 3300053083 Bacteria 1160
348 Ga0495619_0064630 3300053085 Bacteria 2440
349 Ga0500578_0103139 3300053086 Bacteria 1804
350 Ga0500643_042200 3300053087 Bacteria 1336
351 Ga0500560_104470 3300053107 Bacteria 949
352 Ga0500569_001795 3300053109 Bacteria 4114
353 Ga0500569_008453 3300053109 Bacteria 2354
354 Ga0500572_029481 3300053111 Bacteria 1519
355 Ga0500594_0046045 3300053118 Bacteria 1212
356 Ga0500594_0106364 3300053118 Bacteria 868
357 Ga0500608_003452 3300053122 Bacteria 5931
358 Ga0500618_017824 3300053125 Bacteria 1763
359 Ga0500618_023489 3300053125 Bacteria 1492
360 Ga0500658_0000532 3300053134 Bacteria 16070
361 Ga0500658_0014913 3300053134 Bacteria 2880
362 Ga0500559_0034610 3300053136 Bacteria 2179
363 Ga0500568_0003471 3300053139 Bacteria 8766
364 Ga0500568_0006048 3300053139 Bacteria 6142
365 Ga0500568_0104475 3300053139 Bacteria 1062
366 Ga0500573_0013687 3300053140 Bacteria 4576
367 Ga0500590_000417 3300053148 Bacteria 14349
368 Ga0500604_0064476 3300053151 Bacteria 1157
369 Ga0500616_0001744 3300053153 Bacteria 19933
370 Ga0500616_0010161 3300053153 Bacteria 5651
371 Ga0500616_0045574 3300053153 Bacteria 2335
372 Ga0500620_049825 3300053155 Bacteria 1401
373 Ga0500622_0001616 3300053156 Bacteria 17687
374 Ga0500622_0009057 3300053156 Bacteria 5531

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048920 Ga0496117_0047103 Ga0496117_0047103_17_751 237
2 3300048926 Ga0496123_0117788 Ga0496123_0117788_743_1477 237
3 3300002987 JGI25159J45721_1000008 JGI25159J45721_100000851 241
4 3300003187 JGI25151J46595_10010311 JGI25151J46595_100103115 241
5 3300003354 JGI25160J50197_1000033 JGI25160J50197_1000033124 241
6 3300003374 JGI25161J50226_1003171 JGI25161J50226_10031714 241
7 3300003771 Ga0055526_1003009 Ga0055526_10030099 241
8 3300003781 Ga0055536_1010703 Ga0055536_10107032 241
9 3300003794 Ga0055531_10015393 Ga0055531_100153932 241
10 3300004625 Ga0055543_1000026 Ga0055543_100002616 241
11 3300005262 Ga0065165_1000513 Ga0065165_100051352 241
12 3300013249 Ga0171463_1007 Ga0171463_1007247 241
13 3300015690 Ga0183363_1058 Ga0183363_10588 241
14 3300025208 Ga0209436_101218 Ga0209436_1012186 241
15 3300025284 Ga0209130_1000017 Ga0209130_100001753 241
16 3300025294 Ga0209025_1000153 Ga0209025_1000153124 241
17 3300025295 Ga0209564_1000372 Ga0209564_100037214 241
18 3300025298 Ga0209050_1029307 Ga0209050_10293072 241
19 3300025302 Ga0207426_1000006 Ga0207426_100000652 241
20 3300025304 Ga0209257_1013250 Ga0209257_10132503 241
21 3300046523 Ga0495644_0136316 Ga0495644_0136316_164_910 241
22 3300046794 Ga0495589_0173811 Ga0495589_0173811_245_991 241
23 3300047318 Ga0495636_0224915 Ga0495636_0224915_95_844 241
24 3300049571 Ga0501034_0259549 Ga0501034_0259549_721_1509 241
25 3300049579 Ga0501043_0312479 Ga0501043_0312479_326_1114 241
26 3300049581 Ga0501047_0046656 Ga0501047_0046656_737_1525 241
27 3300006038 Ga0075365_10003241 Ga0075365_1000324110 243
28 3300006186 Ga0075369_10002676 Ga0075369_100026763 243
29 3300009766 Ga0123342_1011698 Ga0123342_10116983 243
30 3300048927 Ga0496124_0000067 Ga0496124_0000067_38385_39140 243
31 3300049569 Ga0501032_0000156 Ga0501032_0000156_44908_45714 245
32 3300049570 Ga0501033_0004949 Ga0501033_0004949_9687_10493 245
33 3300049571 Ga0501034_0000087 Ga0501034_0000087_9703_10509 245
34 3300049573 Ga0501037_0000014 Ga0501037_0000014_160526_161332 245
35 3300049574 Ga0501038_0000023 Ga0501038_0000023_140968_141774 245
36 3300049575 Ga0501039_0000101 Ga0501039_0000101_9687_10493 245
37 3300049579 Ga0501043_0000194 Ga0501043_0000194_9687_10493 245
38 3300049580 Ga0501046_0275842 Ga0501046_0275842_382_1188 245
39 3300049822 Ga0501035_0006893 Ga0501035_0006893_9703_10509 245
40 3300049823 Ga0501044_0069820 Ga0501044_0069820_2685_3491 245
41 3300005262 Ga0065165_1002927 Ga0065165_100292710 246
42 iso_pu_bacteria 2599185352 2600196927 246
43 iso_pu_bacteria 2643221668 2644377625 246
44 iso_pu_bacteria 2643221723 2644672718 246
45 iso_pu_bacteria 2920822456 2920825683 246
46 3300049568 Ga0501031_0000104 Ga0501031_0000104_26210_27052 247
47 3300049569 Ga0501032_0000008 Ga0501032_0000008_75173_76015 247
48 3300049570 Ga0501033_0000012 Ga0501033_0000012_165609_166451 247
49 3300049571 Ga0501034_0000035 Ga0501034_0000035_165609_166451 247
50 3300049572 Ga0501036_0000006 Ga0501036_0000006_165609_166451 247
51 3300049573 Ga0501037_0000072 Ga0501037_0000072_75173_76015 247
52 3300049574 Ga0501038_0000007 Ga0501038_0000007_75173_76015 247
53 3300049575 Ga0501039_0000012 Ga0501039_0000012_165609_166451 247
54 3300049579 Ga0501043_0000448 Ga0501043_0000448_14317_15159 247
55 3300049581 Ga0501047_0002026 Ga0501047_0002026_8954_9796 247
56 3300049586 Ga0501070_0010344 Ga0501070_0010344_3244_4086 247
57 3300049822 Ga0501035_0000035 Ga0501035_0000035_90902_91744 247
58 3300049823 Ga0501044_0000015 Ga0501044_0000015_75173_76015 247
59 3300053125 Ga0500618_023489 Ga0500618_023489_445_1263 247
60 iso_pu_bacteria 2643221607 2644048662 247
61 iso_pu_bacteria 2643221636 2644202018 247
62 iso_pu_bacteria 2643221686 2644481464 247
63 3300003775 Ga0055524_1001616 Ga0055524_100161613 249
64 3300025294 Ga0209025_1060809 Ga0209025_10608092 249
65 3300025299 Ga0209256_1000401 Ga0209256_100040163 249
66 iso_pu_bacteria 2585427634 2585999906 250
67 iso_pu_bacteria 2643221599 2644002966 250
68 3300028794 Ga0307515_10408981 Ga0307515_104089811 251
69 3300035695 Ga0373927_0001234 Ga0373927_0001234_810_1589 251
70 3300037068 Ga0373925_0001672 Ga0373925_0001672_9946_10725 251
71 iso_pu_bacteria 2524023209 2524459062 251
72 iso_pu_bacteria 2791355253 2793282523 251
73 iso_pu_bacteria 2842298080 2842298415 251
74 iso_pu_bacteria 2842357229 2842360427 251
75 3300013102 Ga0157371_10004554 Ga0157371_100045545 252
76 3300046453 Ga0495627_040112 Ga0495627_040112_606_1385 252
77 3300046512 Ga0495610_0018469 Ga0495610_0018469_2329_3108 252
78 3300046515 Ga0495620_0019418 Ga0495620_0019418_2133_2912 252
79 3300046519 Ga0495632_0023675 Ga0495632_0023675_2345_3124 252
80 3300046522 Ga0495643_0043023 Ga0495643_0043023_1662_2441 252
81 3300047469 Ga0495673_0083668 Ga0495673_0083668_41_820 252
82 3300048922 Ga0496119_0098754 Ga0496119_0098754_654_1433 252
83 3300049459 Ga0495678_089808 Ga0495678_089808_277_1056 252
84 iso_pu_bacteria 2510917022 2511137431 252
85 iso_pu_bacteria 2582581307 2585274017 252
86 iso_pu_bacteria 2585427531 2585560468 252
87 iso_pu_bacteria 2585427608 2585898661 252
88 iso_pu_bacteria 2585427609 2585903750 252
89 iso_pu_bacteria 2585428125 2587981131 252
90 iso_pu_bacteria 2842509118 2842510429 252
91 iso_pu_bacteria 2852387548 2852390846 252
92 iso_pu_bacteria 8024486573 8024488483 252
93 iso_pu_bacteria 8046767195 8046772597 252
94 iso_pu_bacteria 8057575449 8057576943 252
95 3300048919 Ga0496116_0230312 Ga0496116_0230312_147_929 253
96 3300053111 Ga0500572_029481 Ga0500572_029481_162_944 253
97 3300053125 Ga0500618_017824 Ga0500618_017824_376_1158 253
98 3300053140 Ga0500573_0013687 Ga0500573_0013687_1243_2028 253
99 iso_pu_bacteria 2510065019 2510134421 253
100 iso_pu_bacteria 2510461076 2510895845 253
101 iso_pu_bacteria 2510917028 2511182703 253
102 iso_pu_bacteria 2510917030 2511195260 253
103 iso_pu_bacteria 2513237084 2513567464 253
104 iso_pu_bacteria 2513237085 2513577801 253
105 iso_pu_bacteria 2513237093 2513632052 253
106 iso_pu_bacteria 2513237103 2513712478 253
107 iso_pu_bacteria 2513237138 2513867859 253
108 iso_pu_bacteria 2513237162 2514017848 253
109 iso_pu_bacteria 2515075009 2515113583 253
110 iso_pu_bacteria 2515154113 2515635297 253
111 iso_pu_bacteria 2515154114 2515646091 253
112 iso_pu_bacteria 2515154116 2515654885 253
113 iso_pu_bacteria 2515154134 2515739940 253
114 iso_pu_bacteria 2516653077 2517037198 253
115 iso_pu_bacteria 2516653085 2517077537 253
116 iso_pu_bacteria 2517093000 2517096308 253
117 iso_pu_bacteria 2519899620 2520382006 253
118 iso_pu_bacteria 2529292951 2530646336 253
119 iso_pu_bacteria 2534681796 2535517281 253
120 iso_pu_bacteria 2582581299 2585230730 253
121 iso_pu_bacteria 2582581304 2585259169 253
122 iso_pu_bacteria 2582581867 2585404559 253
123 iso_pu_bacteria 2585427526 2585524966 253
124 iso_pu_bacteria 2585427590 2585824903 253
125 iso_pu_bacteria 2718217882 2719182299 253
126 iso_pu_bacteria 2718217927 2719386890 253
127 iso_pu_bacteria 2718217997 2719666626 253
128 iso_pu_bacteria 2718218009 2719733015 253
129 iso_pu_bacteria 2718218199 2720493046 253
130 iso_pu_bacteria 2718218232 2720614525 253
131 iso_pu_bacteria 2718218233 2720621299 253
132 iso_pu_bacteria 2718218235 2720632625 253
133 iso_pu_bacteria 2718218269 2720776349 253
134 iso_pu_bacteria 2718218363 2721148412 253
135 iso_pu_bacteria 2718218365 2721159798 253
136 iso_pu_bacteria 2718218366 2721165226 253
137 iso_pu_bacteria 2718218423 2721400613 253
138 iso_pu_bacteria 2721755514 2722841396 253
139 iso_pu_bacteria 2721755556 2723027938 253
140 iso_pu_bacteria 2721755684 2723561568 253
141 iso_pu_bacteria 2721755685 2723568197 253
142 iso_pu_bacteria 2721755809 2724039426 253
143 iso_pu_bacteria 2721755810 2724045771 253
144 iso_pu_bacteria 2721755819 2724090956 253
145 iso_pu_bacteria 2721755822 2724105462 253
146 iso_pu_bacteria 2721755823 2724111287 253
147 iso_pu_bacteria 2724679232 2725949264 253
148 iso_pu_bacteria 2728369352 2730108874 253
149 iso_pu_bacteria 2728369365 2730165534 253
150 iso_pu_bacteria 2728369397 2730299430 253
151 iso_pu_bacteria 2765235942 2766066336 253
152 iso_pu_bacteria 2791355256 2793293963 253
153 iso_pu_bacteria 2791355260 2793323850 253
154 iso_pu_bacteria 2791355261 2793329755 253
155 iso_pu_bacteria 2791355262 2793335058 253
156 iso_pu_bacteria 2791355263 2793342354 253
157 iso_pu_bacteria 2791355264 2793349722 253
158 iso_pu_bacteria 2791355265 2793355373 253
159 iso_pu_bacteria 2791355266 2793363063 253
160 iso_pu_bacteria 2802429605 2805929589 253
161 iso_pu_bacteria 2802429605 2805931173 253
162 iso_pu_bacteria 2802429606 2805936894 253
163 iso_pu_bacteria 2838016132 2838019882 253
164 iso_pu_bacteria 2838022645 2838023387 253
165 iso_pu_bacteria 2838048938 2838052691 253
166 iso_pu_bacteria 2838061910 2838064948 253
167 iso_pu_bacteria 2838068647 2838069675 253
168 iso_pu_bacteria 2838668709 2838671823 253
169 iso_pu_bacteria 2838680041 2838682974 253
170 iso_pu_bacteria 2838686498 2838686584 253
171 iso_pu_bacteria 2838694306 2838698083 253
172 iso_pu_bacteria 2838701080 2838704502 253
173 iso_pu_bacteria 2838707686 2838711197 253
174 iso_pu_bacteria 2838729681 2838734826 253
175 iso_pu_bacteria 2838742623 2838747441 253
176 iso_pu_bacteria 2841851746 2841854413 253
177 iso_pu_bacteria 2841864319 2841867441 253
178 iso_pu_bacteria 2842077413 2842079373 253
179 iso_pu_bacteria 2842110456 2842115521 253
180 iso_pu_bacteria 2842118031 2842118117 253
181 iso_pu_bacteria 2842146304 2842149720 253
182 iso_pu_bacteria 2842156927 2842158568 253
183 iso_pu_bacteria 2842163707 2842168986 253
184 iso_pu_bacteria 2842180545 2842182182 253
185 iso_pu_bacteria 2842192696 2842195577 253
186 iso_pu_bacteria 2842198810 2842198901 253
187 iso_pu_bacteria 2842205361 2842210898 253
188 iso_pu_bacteria 2842217011 2842218414 253
189 iso_pu_bacteria 2842229732 2842229818 253
190 iso_pu_bacteria 2842237096 2842240030 253
191 iso_pu_bacteria 2842243621 2842243707 253
192 iso_pu_bacteria 2842250916 2842254113 253
193 iso_pu_bacteria 2842257432 2842258208 253
194 iso_pu_bacteria 2842264693 2842268961 253
195 iso_pu_bacteria 2842271015 2842271878 253
196 iso_pu_bacteria 2842278818 2842284351 253
197 iso_pu_bacteria 2842285085 2842285138 253
198 iso_pu_bacteria 2842291075 2842293035 253
199 iso_pu_bacteria 2842304105 2842305491 253
200 iso_pu_bacteria 2842311132 2842314214 253
201 iso_pu_bacteria 2842317721 2842320017 253
202 iso_pu_bacteria 2842341865 2842347588 253
203 iso_pu_bacteria 2842363717 2842368762 253
204 iso_pu_bacteria 2842370503 2842373603 253
205 iso_pu_bacteria 2842377471 2842379432 253
206 iso_pu_bacteria 2842384541 2842384627 253
207 iso_pu_bacteria 2842395702 2842400531 253
208 iso_pu_bacteria 2842402390 2842402496 253
209 iso_pu_bacteria 2842409023 2842410133 253
210 iso_pu_bacteria 2842415677 2842416781 253
211 iso_pu_bacteria 2842422224 2842423289 253
212 iso_pu_bacteria 2842428310 2842433117 253
213 iso_pu_bacteria 2842434925 2842439422 253
214 iso_pu_bacteria 2842441272 2842446051 253
215 iso_pu_bacteria 2842447887 2842449079 253
216 iso_pu_bacteria 2842462802 2842467344 253
217 iso_pu_bacteria 2842469257 2842474139 253
218 iso_pu_bacteria 2842489311 2842493441 253
219 iso_pu_bacteria 2842495871 2842497593 253
220 iso_pu_bacteria 2844454524 2844457882 253
221 iso_pu_bacteria 2857516855 2857516954 253
222 iso_pu_bacteria 2919100787 2919105646 253
223 iso_pu_bacteria 2923556063 2923562159 253
224 iso_pu_bacteria 2933570622 2933571298 253
225 iso_pu_bacteria 2933586486 2933591936 253
226 iso_pu_bacteria 2935894831 2935896534 253
227 iso_pu_bacteria 2935901341 2935901428 253
228 iso_pu_bacteria 2936381700 2936383467 253
229 iso_pu_bacteria 2996887358 2996892582 253
230 iso_pu_bacteria 2996893221 2996898106 253
231 iso_pu_bacteria 3005445848 3005448886 253
232 iso_pu_bacteria 3005452660 3005455105 253
233 iso_pu_bacteria 639633055 639649626 253
234 iso_pu_bacteria 8005258706 8005264791 253
235 iso_pu_bacteria 8005289223 8005289591 253
236 iso_pu_bacteria 8005301065 8005303613 253
237 iso_pu_bacteria 8005307578 8005314126 253
238 iso_pu_bacteria 8005321885 8005327109 253
239 iso_pu_bacteria 8005376324 8005382633 253
240 iso_pu_bacteria 8005382845 8005384595 253
241 iso_pu_bacteria 8005395548 8005395623 253
242 iso_pu_bacteria 8005430974 8005433861 253
243 iso_pu_bacteria 8005460587 8005464270 253
244 iso_pu_bacteria 8005497431 8005501375 253
245 iso_pu_bacteria 8005542996 8005546102 253
246 iso_pu_bacteria 8005556819 8005561684 253
247 iso_pu_bacteria 8005563573 8005568462 253
248 iso_pu_bacteria 8005570704 8005573001 253
249 iso_pu_bacteria 8005619151 8005622737 253
250 iso_pu_bacteria 8005668836 8005672794 253
251 iso_pu_bacteria 8005688590 8005691608 253
252 iso_pu_bacteria 8018163183 8018163296 253
253 iso_pu_bacteria 8023680758 8023682703 253
254 iso_pu_bacteria 8024479707 8024486060 253
255 iso_pu_bacteria 8024501048 8024501137 253
256 iso_pu_bacteria 8056382006 8056387391 253
257 iso_pu_bacteria 8057874678 8057881873 253
258 3300006051 Ga0075364_10000366 Ga0075364_1000036619 254
259 3300006051 Ga0075364_10178381 Ga0075364_101783812 254
260 3300048924 Ga0496121_0003646 Ga0496121_0003646_13916_14701 254
261 3300049571 Ga0501034_0005300 Ga0501034_0005300_797_1585 254
262 3300049776 Ga0501280_002407 Ga0501280_002407_1284_2069 254
263 3300050491 nmdc:mga00v17_288_c1 nmdc:mga00v17_288_c1_2843_3628 254
264 3300005331 Ga0070670_100000279 Ga0070670_10000027917 255
265 3300025925 Ga0207650_10000644 Ga0207650_1000064418 255
266 3300047472 Ga0495686_0002117 Ga0495686_0002117_6238_7029 255
267 3300048924 Ga0496121_0035456 Ga0496121_0035456_2401_3192 255
268 3300053107 Ga0500560_104470 Ga0500560_104470_41_832 255
269 iso_pu_bacteria 2791355091 2792619502 255
270 iso_pu_bacteria 2791355092 2792627273 255
271 3300002987 JGI25159J45721_1000139 JGI25159J45721_100013922 256
272 3300003354 JGI25160J50197_1000001 JGI25160J50197_1000001134 256
273 3300003374 JGI25161J50226_1000001 JGI25161J50226_1000001634 256
274 3300004625 Ga0055543_1000007 Ga0055543_100000761 256
275 3300005262 Ga0065165_1000008 Ga0065165_1000008329 256
276 3300005459 Ga0068867_100534286 Ga0068867_1005342861 256
277 3300025284 Ga0209130_1000003 Ga0209130_1000003641 256
278 3300025302 Ga0207426_1000011 Ga0207426_1000011134 256
279 3300026089 Ga0207648_10258982 Ga0207648_102589822 256
280 3300046471 Ga0495650_0125820 Ga0495650_0125820_98_892 256
281 3300046476 Ga0495662_0015387 Ga0495662_0015387_13_807 256
282 3300046501 Ga0495607_0061006 Ga0495607_0061006_219_1037 256
283 3300046507 Ga0495606_0218079 Ga0495606_0218079_192_986 256
284 3300046519 Ga0495632_0087790 Ga0495632_0087790_563_1381 256
285 3300046524 Ga0495648_0203125 Ga0495648_0203125_39_833 256
286 3300046557 Ga0495622_0033298 Ga0495622_0033298_491_1285 256
287 3300046642 Ga0495634_0143241 Ga0495634_0143241_101_895 256
288 3300046663 Ga0495635_0176857 Ga0495635_0176857_460_1254 256
289 3300046683 Ga0495658_0020983 Ga0495658_0020983_2603_3397 256
290 3300046689 Ga0495613_0211508 Ga0495613_0211508_487_1281 256
291 3300046809 Ga0495600_0061722 Ga0495600_0061722_725_1519 256
292 3300047317 Ga0495604_0036684 Ga0495604_0036684_26_820 256
293 3300048088 Ga0495602_0107160 Ga0495602_0107160_369_1163 256
294 3300048927 Ga0496124_0028370 Ga0496124_0028370_3446_4237 256
295 3300048927 Ga0496124_0196161 Ga0496124_0196161_84_875 256
296 3300048929 Ga0496126_0157226 Ga0496126_0157226_524_1315 256
297 3300049822 Ga0501035_0245627 Ga0501035_0245627_571_1371 256
298 3300053085 Ga0495619_0064630 Ga0495619_0064630_1204_1998 256
299 3300053122 Ga0500608_003452 Ga0500608_003452_3495_4289 256
300 3300053148 Ga0500590_000417 Ga0500590_000417_2323_3117 256
301 iso_pu_bacteria 2643221719 2644657285 256
302 iso_pu_bacteria 2888350351 2888350870 256
303 iso_pu_bacteria 2906354277 2906362524 256
304 iso_pu_bacteria 2922130491 2922136676 256
305 iso_pu_bacteria 2922185730 2922190559 256
306 iso_pu_bacteria 2977971508 2977974626 256
307 iso_pu_bacteria 2979742915 2979744927 256
308 3300002773 JGI25152J39213_1007285 JGI25152J39213_10072853 257
309 3300002773 JGI25152J39213_1007516 JGI25152J39213_10075161 257
310 3300002773 JGI25152J39213_1007643 JGI25152J39213_10076433 257
311 3300002774 JGI25150J39212_1004074 JGI25150J39212_10040744 257
312 3300003187 JGI25151J46595_10012596 JGI25151J46595_100125964 257
313 3300003215 JGI25153J46596_10017555 JGI25153J46596_100175551 257
314 3300003215 JGI25153J46596_10017873 JGI25153J46596_100178733 257
315 3300003215 JGI25153J46596_10025313 JGI25153J46596_100253131 257
316 3300003354 JGI25160J50197_1005943 JGI25160J50197_10059433 257
317 3300003771 Ga0055526_1023655 Ga0055526_10236551 257
318 3300003771 Ga0055526_1029958 Ga0055526_10299582 257
319 3300003775 Ga0055524_1020060 Ga0055524_10200601 257
320 3300003775 Ga0055524_1022835 Ga0055524_10228352 257
321 3300003790 Ga0055528_1011290 Ga0055528_10112902 257
322 3300003790 Ga0055528_1018980 Ga0055528_10189802 257
323 3300003790 Ga0055528_1021342 Ga0055528_10213422 257
324 3300003792 Ga0055540_1000483 Ga0055540_100048328 257
325 3300003792 Ga0055540_1042028 Ga0055540_10420281 257
326 3300005347 Ga0070668_100037831 Ga0070668_1000378318 257
327 3300006048 Ga0075363_100020332 Ga0075363_1000203321 257
328 3300006178 Ga0075367_10008236 Ga0075367_100082363 257
329 3300009011 Ga0105251_10072591 Ga0105251_100725912 257
330 3300009177 Ga0105248_10100952 Ga0105248_101009523 257
331 3300009553 Ga0105249_10273575 Ga0105249_102735751 257
332 3300009765 Ga0123341_1000018 Ga0123341_100001816 257
333 3300009766 Ga0123342_1013853 Ga0123342_10138532 257
334 3300021358 Ga0213873_10002659 Ga0213873_100026594 257
335 3300025245 Ga0207425_1002607 Ga0207425_10026074 257
336 3300025258 Ga0209129_1001109 Ga0209129_10011093 257
337 3300025258 Ga0209129_1005322 Ga0209129_10053223 257
338 3300025258 Ga0209129_1011299 Ga0209129_10112992 257
339 3300025273 Ga0209673_1000478 Ga0209673_100047812 257
340 3300025273 Ga0209673_1001106 Ga0209673_100110628 257
341 3300025273 Ga0209673_1002266 Ga0209673_10022661 257
342 3300025273 Ga0209673_1003587 Ga0209673_10035872 257
343 3300025294 Ga0209025_1001251 Ga0209025_100125128 257
344 3300025294 Ga0209025_1022507 Ga0209025_10225071 257
345 3300025295 Ga0209564_1000259 Ga0209564_100025927 257
346 3300025295 Ga0209564_1017246 Ga0209564_10172463 257
347 3300025297 Ga0209758_1002133 Ga0209758_100213310 257
348 3300025297 Ga0209758_1002159 Ga0209758_100215911 257
349 3300025297 Ga0209758_1003413 Ga0209758_10034131 257
350 3300025299 Ga0209256_1003760 Ga0209256_10037606 257
351 3300025299 Ga0209256_1010252 Ga0209256_10102521 257
352 3300025302 Ga0207426_1001078 Ga0207426_100107812 257
353 3300025303 Ga0209051_1000434 Ga0209051_10004349 257
354 3300025931 Ga0207644_10029811 Ga0207644_100298113 257
355 3300026067 Ga0207678_10050378 Ga0207678_100503783 257
356 3300031456 Ga0307513_10530235 Ga0307513_105302351 257
357 3300039437 Ga0436365_0992978 Ga0436365_0992978_1302_2120 257
358 3300039453 Ga0436362_0498094 Ga0436362_0498094_3658_4476 257
359 3300041413 Ga0439465_0009845 Ga0439465_0009845_964_1761 257
360 3300041441 Ga0451787_639956 Ga0451787_639956_173_970 257
361 3300041459 Ga0451800_1239096 Ga0451800_1239096_766_1563 257
362 3300041491 Ga0451833_0025739 Ga0451833_0025739_995_1792 257
363 3300041492 Ga0451835_0543336 Ga0451835_0543336_1619_2416 257
364 3300041494 Ga0451837_0379565 Ga0451837_0379565_391_1188 257
365 3300041496 Ga0451839_0685993 Ga0451839_0685993_484_1281 257
366 3300041503 Ga0451847_0447459 Ga0451847_0447459_395_1192 257
367 3300041505 Ga0451849_0156250 Ga0451849_0156250_161_958 257
368 3300041505 Ga0451849_1292087 Ga0451849_1292087_376_1173 257
369 3300041506 Ga0451850_54302 Ga0451850_54302_63_860 257
370 3300041507 Ga0451851_0048305 Ga0451851_0048305_63_860 257
371 3300041509 Ga0451843_1316499 Ga0451843_1316499_512_1309 257
372 3300041511 Ga0451855_0065409 Ga0451855_0065409_1072_1869 257
373 3300041512 Ga0451853_2392453 Ga0451853_2392453_487_1284 257
374 3300041916 Ga0452271_88678 Ga0452271_88678_299_1096 257
375 3300046460 Ga0495638_0070515 Ga0495638_0070515_998_1795 257
376 3300046492 Ga0495585_0006165 Ga0495585_0006165_3547_4344 257
377 3300046492 Ga0495585_0175732 Ga0495585_0175732_287_1084 257
378 3300046501 Ga0495607_0138855 Ga0495607_0138855_281_1078 257
379 3300046506 Ga0495583_0014258 Ga0495583_0014258_2708_3502 257
380 3300046506 Ga0495583_0087269 Ga0495583_0087269_173_970 257
381 3300046507 Ga0495606_0038087 Ga0495606_0038087_26_823 257
382 3300046512 Ga0495610_0132273 Ga0495610_0132273_32_829 257
383 3300046513 Ga0495616_0014261 Ga0495616_0014261_482_1279 257
384 3300046513 Ga0495616_0098392 Ga0495616_0098392_408_1205 257
385 3300046515 Ga0495620_0101217 Ga0495620_0101217_208_1005 257
386 3300046518 Ga0495631_0001152 Ga0495631_0001152_12077_12874 257
387 3300046518 Ga0495631_0069499 Ga0495631_0069499_700_1494 257
388 3300046519 Ga0495632_0025852 Ga0495632_0025852_2146_2943 257
389 3300046522 Ga0495643_0003080 Ga0495643_0003080_4733_5530 257
390 3300046522 Ga0495643_0008502 Ga0495643_0008502_213_1010 257
391 3300046538 Ga0495609_0125530 Ga0495609_0125530_126_923 257
392 3300046542 Ga0495597_0011162 Ga0495597_0011162_883_1680 257
393 3300046558 Ga0495633_0072440 Ga0495633_0072440_481_1278 257
394 3300046616 Ga0495668_0032836 Ga0495668_0032836_1880_2677 257
395 3300046648 Ga0495611_0111268 Ga0495611_0111268_464_1261 257
396 3300046660 Ga0495625_0001949 Ga0495625_0001949_12180_12977 257
397 3300046660 Ga0495625_0106523 Ga0495625_0106523_612_1409 257
398 3300046665 Ga0495661_0070593 Ga0495661_0070593_647_1444 257
399 3300046691 Ga0495670_0061341 Ga0495670_0061341_977_1774 257
400 3300046694 Ga0495649_0024666 Ga0495649_0024666_715_1512 257
401 3300046694 Ga0495649_0205281 Ga0495649_0205281_167_964 257
402 3300047318 Ga0495636_0049066 Ga0495636_0049066_618_1415 257
403 3300047320 Ga0495672_0020241 Ga0495672_0020241_2986_3783 257
404 3300047446 Ga0495679_037959 Ga0495679_037959_31_828 257
405 3300047472 Ga0495686_0014002 Ga0495686_0014002_2938_3735 257
406 3300048091 Ga0495626_0104089 Ga0495626_0104089_116_913 257
407 3300048904 Ga0496101_0525592 Ga0496101_0525592_66_860 257
408 3300048905 Ga0496102_0457197 Ga0496102_0457197_21_815 257
409 3300048907 Ga0496104_0035114 Ga0496104_0035114_3480_4274 257
410 3300048908 Ga0496105_0159566 Ga0496105_0159566_381_1175 257
411 3300048909 Ga0496106_0002212 Ga0496106_0002212_2070_2867 257
412 3300048913 Ga0496110_0032990 Ga0496110_0032990_3269_4063 257
413 3300048916 Ga0496113_0084367 Ga0496113_0084367_293_1087 257
414 3300048919 Ga0496116_0052138 Ga0496116_0052138_1834_2631 257
415 3300048919 Ga0496116_0062611 Ga0496116_0062611_778_1566 257
416 3300048921 Ga0496118_0019759 Ga0496118_0019759_821_1618 257
417 3300048921 Ga0496118_0052098 Ga0496118_0052098_892_1689 257
418 3300048921 Ga0496118_0119862 Ga0496118_0119862_285_1079 257
419 3300048922 Ga0496119_0029989 Ga0496119_0029989_547_1341 257
420 3300048924 Ga0496121_0027313 Ga0496121_0027313_561_1358 257
421 3300048924 Ga0496121_0104057 Ga0496121_0104057_220_1017 257
422 3300048925 Ga0496122_0012372 Ga0496122_0012372_7026_7823 257
423 3300048926 Ga0496123_0012474 Ga0496123_0012474_1883_2680 257
424 3300048927 Ga0496124_0169550 Ga0496124_0169550_361_1155 257
425 3300048928 Ga0496125_0076997 Ga0496125_0076997_420_1214 257
426 3300048929 Ga0496126_0048702 Ga0496126_0048702_426_1220 257
427 3300049459 Ga0495678_023395 Ga0495678_023395_110_907 257
428 3300049574 Ga0501038_0053872 Ga0501038_0053872_2293_3090 257
429 3300049575 Ga0501039_0212196 Ga0501039_0212196_272_1069 257
430 3300049579 Ga0501043_0141649 Ga0501043_0141649_647_1444 257
431 3300049823 Ga0501044_0141294 Ga0501044_0141294_481_1278 257
432 3300050489 nmdc:mga03683_3292_c1 nmdc:mga03683_3292_c1_753_1550 257
433 3300050492 nmdc:mga0yw44_28491_c1 nmdc:mga0yw44_28491_c1_1284_2081 257
434 3300050493 nmdc:mga0k408_4656_c1 nmdc:mga0k408_4656_c1_1502_2299 257
435 3300050494 nmdc:mga06z11_960_c1 nmdc:mga06z11_960_c1_4811_5608 257
436 3300050496 nmdc:mga07m45_1571_c1 nmdc:mga07m45_1571_c1_5415_6212 257
437 3300050496 nmdc:mga07m45_52666_c1 nmdc:mga07m45_52666_c1_1047_1844 257
438 3300050516 nmdc:mga0sz30_6394_c1 nmdc:mga0sz30_6394_c1_1250_2047 257
439 3300053079 Ga0500610_0012466 Ga0500610_0012466_2631_3428 257
440 3300053083 Ga0495655_0043308 Ga0495655_0043308_87_884 257
441 3300053086 Ga0500578_0103139 Ga0500578_0103139_722_1519 257
442 3300053109 Ga0500569_001795 Ga0500569_001795_1127_1924 257
443 3300053109 Ga0500569_008453 Ga0500569_008453_1387_2184 257
444 3300053118 Ga0500594_0046045 Ga0500594_0046045_186_983 257
445 3300053118 Ga0500594_0106364 Ga0500594_0106364_41_838 257
446 3300053134 Ga0500658_0000532 Ga0500658_0000532_3102_3899 257
447 3300053139 Ga0500568_0003471 Ga0500568_0003471_4510_5307 257
448 3300053139 Ga0500568_0104475 Ga0500568_0104475_228_1025 257
449 3300053151 Ga0500604_0064476 Ga0500604_0064476_174_971 257
450 3300053153 Ga0500616_0001744 Ga0500616_0001744_4227_5024 257
451 3300053153 Ga0500616_0045574 Ga0500616_0045574_1387_2184 257
452 3300053155 Ga0500620_049825 Ga0500620_049825_362_1159 257
453 3300053156 Ga0500622_0001616 Ga0500622_0001616_11697_12494 257
454 3300053156 Ga0500622_0009057 Ga0500622_0009057_522_1319 257
455 iso_pu_bacteria 2643221610 2644065216 257
456 iso_pu_bacteria 2643221675 2644418178 257
457 iso_pu_bacteria 2643221680 2644451434 257
458 iso_pu_bacteria 2643221726 2644691586 257
459 iso_pu_bacteria 2889010040 2889013217 257
460 iso_pu_bacteria 2889016732 2889021931 257
461 iso_pu_bacteria 2958100919 2958104012 257
462 iso_pu_bacteria 2958172287 2958178650 257
463 iso_pu_bacteria 2965119406 2965122590 257
464 iso_pu_bacteria 2968117919 2968118549 257
465 iso_pu_bacteria 2977942078 2977946649 257
466 iso_pu_bacteria 2979710463 2979717347 257
467 3300002739 JGI25158J39367_1000041 JGI25158J39367_100004115 258
468 3300002773 JGI25152J39213_1011539 JGI25152J39213_10115392 258
469 3300002987 JGI25159J45721_1000319 JGI25159J45721_10003195 258
470 3300003215 JGI25153J46596_10028321 JGI25153J46596_100283211 258
471 3300003374 JGI25161J50226_1001204 JGI25161J50226_10012048 258
472 3300003771 Ga0055526_1001128 Ga0055526_10011288 258
473 3300003775 Ga0055524_1001855 Ga0055524_10018557 258
474 3300004625 Ga0055543_1000220 Ga0055543_100022031 258
475 3300005262 Ga0065165_1007891 Ga0065165_10078911 258
476 3300025208 Ga0209436_100098 Ga0209436_10009830 258
477 3300025258 Ga0209129_1006389 Ga0209129_10063893 258
478 3300025273 Ga0209673_1005321 Ga0209673_10053215 258
479 3300025284 Ga0209130_1000023 Ga0209130_1000023186 258
480 3300025295 Ga0209564_1000393 Ga0209564_100039359 258
481 3300025297 Ga0209758_1000666 Ga0209758_100066634 258
482 3300025299 Ga0209256_1003479 Ga0209256_10034794 258
483 3300025302 Ga0207426_1000087 Ga0207426_1000087176 258
484 3300025303 Ga0209051_1007955 Ga0209051_10079553 258
485 3300025304 Ga0209257_1043251 Ga0209257_10432512 258
486 3300049823 Ga0501044_0068605 Ga0501044_0068605_2764_3594 258
487 iso_pu_bacteria 2939669807 2939672564 258
488 iso_pu_bacteria 2987652177 2987653756 258
489 3300005983 Ga0081540_1119821 Ga0081540_11198212 259
490 3300025261 Ga0209233_1000068 Ga0209233_1000068136 259
491 iso_pu_bacteria 2917554339 2917555602 259
492 3300002773 JGI25152J39213_1003427 JGI25152J39213_10034272 260
493 3300002774 JGI25150J39212_1000024 JGI25150J39212_100002412 260
494 3300003187 JGI25151J46595_10000027 JGI25151J46595_1000002778 260
495 3300003215 JGI25153J46596_10005033 JGI25153J46596_100050333 260
496 3300005985 Ga0081539_10006258 Ga0081539_1000625813 260
497 3300025245 Ga0207425_1000043 Ga0207425_100004376 260
498 3300025258 Ga0209129_1000072 Ga0209129_1000072118 260
499 3300025294 Ga0209025_1000120 Ga0209025_1000120118 260
500 3300025297 Ga0209758_1000111 Ga0209758_1000111118 260
501 3300031901 Ga0307406_10006974 Ga0307406_100069743 260
502 3300031911 Ga0307412_10000246 Ga0307412_1000024631 260
503 3300042436 Ga0439435_0028984 Ga0439435_0028984_261_1100 260
504 3300046519 Ga0495632_0008411 Ga0495632_0008411_2001_2813 260
505 3300048904 Ga0496101_0067132 Ga0496101_0067132_504_1346 260
506 3300048904 Ga0496101_0224612 Ga0496101_0224612_625_1437 260
507 3300048919 Ga0496116_0023803 Ga0496116_0023803_268_1110 260
508 3300048919 Ga0496116_0026875 Ga0496116_0026875_1382_2224 260
509 3300048919 Ga0496116_0045149 Ga0496116_0045149_31_873 260
510 3300048920 Ga0496117_0016312 Ga0496117_0016312_3401_4243 260
511 3300048921 Ga0496118_0030526 Ga0496118_0030526_3310_4152 260
512 3300048921 Ga0496118_0038974 Ga0496118_0038974_609_1451 260
513 3300048924 Ga0496121_0064964 Ga0496121_0064964_1978_2820 260
514 3300048924 Ga0496121_0175689 Ga0496121_0175689_92_1000 260
515 3300048925 Ga0496122_0031276 Ga0496122_0031276_208_1050 260
516 3300048925 Ga0496122_0047789 Ga0496122_0047789_119_961 260
517 3300048925 Ga0496122_0063226 Ga0496122_0063226_25_837 260
518 3300048925 Ga0496122_0201653 Ga0496122_0201653_207_1049 260
519 3300048926 Ga0496123_0032519 Ga0496123_0032519_476_1318 260
520 3300048926 Ga0496123_0038758 Ga0496123_0038758_2460_3302 260
521 3300048927 Ga0496124_0013664 Ga0496124_0013664_2441_3283 260
522 3300048927 Ga0496124_0018045 Ga0496124_0018045_2067_2909 260
523 3300048927 Ga0496124_0048779 Ga0496124_0048779_256_1098 260
524 3300048928 Ga0496125_0029263 Ga0496125_0029263_560_1402 260
525 3300048929 Ga0496126_0043581 Ga0496126_0043581_2766_3608 260
526 iso_pu_bacteria 2513237088 2513598355 260
527 iso_pu_bacteria 2513237144 2513910590 260
528 iso_pu_bacteria 2513237146 2513928031 260
529 iso_pu_bacteria 2585427594 2585847756 260
530 iso_pu_bacteria 2599185170 2599421042 260
531 iso_pu_bacteria 2738541293 2738803320 260
532 iso_pu_bacteria 2802429633 2806047470 260
533 iso_pu_bacteria 2802429636 2806069745 260
534 iso_pu_bacteria 2838035591 2838041402 260
535 iso_pu_bacteria 2838661181 2838665795 260
536 3300015265 Ga0182005_1005850 Ga0182005_10058503 261
537 3300049571 Ga0501034_0067952 Ga0501034_0067952_1274_2104 261
538 3300025261 Ga0209233_1027145 Ga0209233_10271452 262
539 3300046674 Ga0495588_0004906 Ga0495588_0004906_2566_3432 262
540 3300049573 Ga0501037_0207238 Ga0501037_0207238_337_1146 262
541 3300053134 Ga0500658_0014913 Ga0500658_0014913_1371_2183 262
542 3300053136 Ga0500559_0034610 Ga0500559_0034610_1250_2077 262
543 3300053139 Ga0500568_0006048 Ga0500568_0006048_2147_2959 262
544 iso_pu_bacteria 2513237351 2514592873 262
545 iso_pu_bacteria 2582581294 2585205051 262
546 iso_pu_bacteria 2838042994 2838045667 262
547 iso_pu_bacteria 2924762789 2924764393 262
548 iso_pu_bacteria 2987666974 2987672761 262
549 iso_pu_bacteria 3004334049 3004339170 262
550 3300053153 Ga0500616_0010161 Ga0500616_0010161_4754_5548 263
551 iso_pu_bacteria 2958144490 2958151523 263
552 3300003187 JGI25151J46595_10002431 JGI25151J46595_1000243110 264
553 3300003374 JGI25161J50226_1009887 JGI25161J50226_10098871 264
554 3300003771 Ga0055526_1022668 Ga0055526_10226681 264
555 3300003775 Ga0055524_1013183 Ga0055524_10131833 264
556 3300003790 Ga0055528_1010143 Ga0055528_10101434 264
557 3300003790 Ga0055528_1022000 Ga0055528_10220002 264
558 3300004625 Ga0055543_1000108 Ga0055543_10001088 264
559 3300005262 Ga0065165_1023055 Ga0065165_10230553 264
560 3300006038 Ga0075365_10008264 Ga0075365_100082642 264
561 3300006177 Ga0075362_10001472 Ga0075362_100014725 264
562 3300006178 Ga0075367_10011578 Ga0075367_100115782 264
563 3300006186 Ga0075369_10001165 Ga0075369_100011655 264
564 3300006195 Ga0075366_10019516 Ga0075366_100195162 264
565 3300025258 Ga0209129_1003210 Ga0209129_10032107 264
566 3300025273 Ga0209673_1000125 Ga0209673_1000125135 264
567 3300025273 Ga0209673_1000256 Ga0209673_100025621 264
568 3300025291 Ga0209675_1012500 Ga0209675_10125001 264
569 3300025294 Ga0209025_1000537 Ga0209025_100053713 264
570 3300025294 Ga0209025_1055376 Ga0209025_10553761 264
571 3300025295 Ga0209564_1000778 Ga0209564_100077814 264
572 3300025295 Ga0209564_1005763 Ga0209564_10057631 264
573 3300025297 Ga0209758_1005070 Ga0209758_10050709 264
574 3300025298 Ga0209050_1008653 Ga0209050_10086533 264
575 3300025298 Ga0209050_1029749 Ga0209050_10297492 264
576 3300025299 Ga0209256_1000283 Ga0209256_100028370 264
577 3300025299 Ga0209256_1001708 Ga0209256_100170811 264
578 3300025302 Ga0207426_1000386 Ga0207426_100038623 264
579 3300025304 Ga0209257_1008572 Ga0209257_10085723 264
580 3300028794 Ga0307515_10402244 Ga0307515_104022441 264
581 3300041413 Ga0439465_0007313 Ga0439465_0007313_2357_3175 264
582 3300046616 Ga0495668_0039402 Ga0495668_0039402_1305_2189 264
583 3300047470 Ga0495681_0057653 Ga0495681_0057653_478_1308 264
584 3300049742 Ga0501080_0254720 Ga0501080_0254720_459_1310 264
585 3300049744 Ga0501083_0045818 Ga0501083_0045818_890_1741 264
586 iso_pu_bacteria 2509276021 2509390122 264
587 iso_pu_bacteria 2509276033 2509447591 264
588 iso_pu_bacteria 2517287029 2517408166 264
589 iso_pu_bacteria 2585427528 2585542731 264
590 iso_pu_bacteria 2585427593 2585841373 264
591 iso_pu_bacteria 2615840624 2616296600 264
592 iso_pu_bacteria 2791355259 2793314361 264
593 iso_pu_bacteria 2791355267 2793369932 264
594 iso_pu_bacteria 2933599457 2933600481 264
595 iso_pu_bacteria 2936367885 2936371574 264
596 iso_pu_bacteria 2936375103 2936376946 264
597 iso_pu_bacteria 2937843397 2937846598 264
598 iso_pu_bacteria 8005275841 8005281702 264
599 iso_pu_bacteria 8005282627 8005284339 264
600 iso_pu_bacteria 8005626139 8005630252 264
601 iso_pu_bacteria 8005695170 8005696743 264
602 iso_pu_bacteria 8018127388 8018127624 264
603 iso_pu_bacteria 8018176218 8018179006 264
604 iso_pu_bacteria 8056375014 8056377067 264
605 iso_pu_bacteria 2818991461 2819683855 267
606 3300053087 Ga0500643_042200 Ga0500643_042200_168_986 268
607 3300005455 Ga0070663_100039457 Ga0070663_1000394572 269
608 3300006038 Ga0075365_10053193 Ga0075365_100531932 269
609 3300026067 Ga0207678_10148872 Ga0207678_101488722 269
610 iso_pu_bacteria 2919450847 2919452481 271
611 iso_pu_bacteria 8001845381 8001847113 271
612 3300005563 Ga0068855_100000253 Ga0068855_1000002538 272
613 3300005578 Ga0068854_100121360 Ga0068854_1001213601 272
614 3300006881 Ga0068865_100262865 Ga0068865_1002628652 272
615 3300025938 Ga0207704_10208124 Ga0207704_102081242 272
616 3300025949 Ga0207667_10000035 Ga0207667_10000035283 272
617 3300025981 Ga0207640_10116342 Ga0207640_101163422 272
618 3300026121 Ga0207683_10330785 Ga0207683_103307852 272
619 3300002067 JGI24735J21928_10002268 JGI24735J21928_100022684 276
620 3300013307 Ga0157372_10326181 Ga0157372_103261812 276

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00459

Inositol_P

Inositol monophosphatase family

43

296

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
3luz-assembly1.cif.gz_B crystal structure of extragenic suppressor protein suhb from bartonella henselae, via combined iodide sad molecular replacement 0.8731 9 260
2pcr-assembly1.cif.gz_A crystal structure of myo-inositol-1(or 4)-monophosphatase (aq_1983) from aquifex aeolicus vf5 0.8492 6 259
1awb-assembly1.cif.gz_B human myo-inositol monophosphatase in complex with d-inositol-1-phosphate and calcium 0.8471 6 258
3t0j-assembly1.cif.gz_B crystal structure of inositol monophosphatase - ii from staphylococcus aureus mssa476 0.8446 45 258
2q74-assembly1.cif.gz_C mycobacterium tuberculosis suhb 0.8433 6 258
ID Description Score Start End Superfamily
5zhhC01 Alpha Beta;2-Layer Sandwich;Fructose-1,6-Bisphosphatase; Chain A, domain 1;Fructose-1,6-Bisphosphatase, subunit A, domain 1 0.9534 6 140 3.30.540.10
af_P22255_147_245_3.40.190.80 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2; 0.9408 165 258 3.40.190.80
af_Q6F2U7_1_143_3.30.540.10 Alpha Beta;2-Layer Sandwich;Fructose-1,6-Bisphosphatase; Chain A, domain 1;Fructose-1,6-Bisphosphatase, subunit A, domain 1 0.927 6 132 3.30.540.10
af_Q7KTW5_4_149_3.30.540.10 Alpha Beta;2-Layer Sandwich;Fructose-1,6-Bisphosphatase; Chain A, domain 1;Fructose-1,6-Bisphosphatase, subunit A, domain 1 0.9234 4 132 3.30.540.10
2pcrB01 Alpha Beta;2-Layer Sandwich;Fructose-1,6-Bisphosphatase; Chain A, domain 1;Fructose-1,6-Bisphosphatase, subunit A, domain 1 0.9172 6 132 3.30.540.10
ID Description Score Start End GO Terms
AF-A0A6J4SQP2-F1-model_v4 3'(2'),5'-bisphosphate nucleotidase CysQ (EC 3.1.3.7) (3'(2'),5-bisphosphonucleoside 3'(2')-phosphohydrolase) (3'-phosphoadenosine 5'-phosphate phosphatase) (PAP phosphatase) 0.9826 5 259 GO:0000103
GO:0000287
GO:0005886
GO:0008441
GO:0046854
GO:0050427
AF-A0A257PHC0-F1-model_v4 3'(2'),5'-bisphosphate nucleotidase CysQ 0.9747 4 144 GO:0042578
GO:0046872
AF-A0A2P7S1V3-F1-model_v4 3'(2'),5'-bisphosphate nucleotidase CysQ (EC 3.1.3.7) (3'(2'),5-bisphosphonucleoside 3'(2')-phosphohydrolase) (3'-phosphoadenosine 5'-phosphate phosphatase) (PAP phosphatase) 0.9701 24 259 GO:0000103
GO:0000287
GO:0005886
GO:0008441
GO:0046854
GO:0050427
AF-A0A1I5NIN2-F1-model_v4 3'(2'),5'-bisphosphate nucleotidase CysQ (EC 3.1.3.7) (3'(2'),5-bisphosphonucleoside 3'(2')-phosphohydrolase) (3'-phosphoadenosine 5'-phosphate phosphatase) (PAP phosphatase) 0.9688 8 258 GO:0000103
GO:0000287
GO:0005886
GO:0008441
GO:0046854
GO:0050427
AF-A0A7U8Q0E4-F1-model_v4 deleted 0.9681 1 95

Feature Viewer

pLDDT pTM Quality
92.56 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map