F469855

General Info

Members Datasets Scaffolds Average Seq Length
619 304 1238 218

Family's Representative Sequence

Representative Sequence 3300048913|Ga0496110_0366677|Ga0496110_0366677_161_856
Length 219
Sequence MIRLGGGNRPAGRWRMIEAVVFDLDGVLVDSEPVWEQVRRQVVADYGGHWLPDAQQRLMGMSTGEWARYLSQDLGIGLPPPTVAAAVIERMQARYREGVPLMPSPLGLASSSPPVLIGAVLDGAGLRECFTATLSTEQVSRGKPAPDIYLAVTDLLGFPPQACAAVEDSTNGLRSAAAAGLQVIAVPHPRYPPEPAALRAARLVLTGLAELTVQAVAEL

Samples

Sample ID Description Type Environment
1 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
2 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
20 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
21 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
22 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
23 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
26 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
27 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
28 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
29 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
32 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
33 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
34 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
45 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
46 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
47 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
50 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
51 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
52 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
53 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
54 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
55 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
56 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
57 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
58 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
59 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
60 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
61 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
62 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
64 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
65 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
66 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
68 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
70 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
71 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
72 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
73 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
74 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
75 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
76 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
77 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
78 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
79 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
80 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
81 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
82 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
83 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
84 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
85 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
86 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
87 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
88 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
89 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
90 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
91 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
92 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
129 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
130 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
131 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
132 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
133 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
134 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
135 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
136 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
137 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
138 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
139 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
140 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
141 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
142 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
143 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
144 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
145 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
146 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
147 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
148 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
149 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
150 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
151 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
152 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
153 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
154 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
155 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
156 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
157 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
158 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
159 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
160 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
161 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
162 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
163 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
164 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
165 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
166 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
167 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
168 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
169 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
170 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
171 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
172 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
173 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
174 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
175 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
176 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
177 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
178 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
179 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
180 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
181 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
182 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
183 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
184 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
185 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
186 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
187 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
188 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
189 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
190 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
191 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
192 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
193 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
194 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
195 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
196 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
197 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
198 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
199 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
200 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
201 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
202 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
203 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
204 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
205 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
206 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
207 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
208 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
209 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
210 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
211 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
212 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
213 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
214 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
215 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
216 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
217 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
218 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
219 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
220 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
221 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
222 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
223 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
224 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
225 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
226 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
227 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
228 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
229 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
230 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
231 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
232 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
233 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
234 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
235 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
236 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
237 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
238 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
239 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
240 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
241 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
242 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
243 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
244 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
245 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
246 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
247 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
248 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
249 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
250 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
251 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
252 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
253 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
254 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
255 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
256 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
257 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
258 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
259 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
260 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
261 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
262 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
263 2501939600 Micromonospora sp. L5 Isolate Unclassified
264 2515154202 Salinispora pacifica CNT084 Isolate Rhizosphere
265 2515154203 Salinispora arenicola CNR921 Isolate Rhizosphere
266 2551306166 Nocardia tenerifensis NBRC 101015 Isolate Rhizosphere
267 2622736626 Micromonospora rhizosphaerae DSM 45431 Isolate Rhizosphere
268 2751185725 Microbispora sp. NRRL B-24597 Isolate Unclassified
269 2751185792 Kitasatospora arboriphila NRRL B-24581 Isolate Unclassified
270 2772190715 Micromonospora chokoriensis NRRL B-24750 Isolate Unclassified
271 2831935698 Jishengella sp. AZ1-13 Isolate Unclassified
272 2832004796 Micromonospora endophytica JCM 18317 Isolate Unclassified
273 2855670206 Micromonospora noduli Lupac 07 Isolate Nodule
274 2855676851 Micromonospora saelicesensis GAR05 Isolate Unclassified
275 2855683550 Micromonospora sp. RP3T Isolate Unclassified
276 2856858025 Micromonospora aurantiaca 110B(2018) Isolate Unclassified
277 2857288857 Micromonospora noduli ONO23 Isolate Unclassified
278 2858848962 Micromonospora saelicesensis GAR06 Isolate Unclassified
279 2858868258 Micromonospora sp. MH33 Isolate Unclassified
280 2858882152 Micromonospora noduli MED15 Isolate Nodule
281 2858888857 Micromonospora saelicesensis Lupac 06 Isolate Unclassified
282 2858895516 Micromonospora saelicesensis PSN13 Isolate Unclassified
283 2858902515 Micromonospora sp. MW-13 Isolate Rhizosphere
284 2866065130 Micromonospora endophytica DSM 45430 Isolate Unclassified
285 2867302475 Micromonospora globbae WPS1-2 Isolate Unclassified
286 2867312974 Micromonospora musae NGC1-4 Isolate Unclassified
287 2867319477 Micromonospora musae MS1-9 Isolate Unclassified
288 2867507094 Micromonospora zingiberis PLAI 1-1 Isolate Unclassified
289 2869061728 Micromonospora noduli ONO86 Isolate Unclassified
290 2869068681 Micromonospora noduli GUI43 Isolate Unclassified
291 2880489317 Micromonospora ureilytica DSM 101692 Isolate Unclassified
292 2880495981 Micromonospora vinacea DSM 101695 Isolate Unclassified
293 2899370129 Amycolatopsis alkalitolerans SYSUP0005 Isolate Stem Tuber
294 2902582711 Micromonospora sp. AP08 Isolate Unclassified
295 2917736166 Amycolatopsis dendrobii DR6-1 Isolate Unclassified
296 2929219909 Micromonospora sp. R-75348 Hybrid assembly Isolate Unclassified
297 2929226422 Micromonospora sp. R-74116 Hybrid assembly Isolate Unclassified
298 649633069 Micromonospora sp. L5 Isolate Unclassified
299 8003830390 Micromonospora parastrephiae STR1_7 Isolate Rhizosphere
300 8003870546 Micromonospora tarensis STR1s_6 Isolate Rhizosphere
301 8054704163 Micromonospora trifolii NIE79 Isolate Nodule
302 8054727385 Micromonospora alfalfae MED01 Isolate Nodule
303 8054734606 Micromonospora hortensis NIE111 Isolate Nodule
304 8055412473 Micromonospora phytophila DSM 105363 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 92.73
Metatranscriptomes 0.48
Isolates 6.79

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.16
Nodule 0.97
Rhizoplane 4.04
Rhizosphere 87.72
Stem 0
Stem Tuber 0.16
Unclassified 0.65

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496110_0366677 3300048913 Bacteria 1312
2 JGI25404J52841_10019753 3300003659 Bacteria 1460
3 Ga0070658_10042883 3300005327 Bacteria 3655
4 Ga0070683_100040810 3300005329 Bacteria 4267
5 Ga0070683_100441160 3300005329 Bacteria 1242
6 Ga0068869_100085738 3300005334 Bacteria 2359
7 Ga0070666_10134127 3300005335 Bacteria 1722
8 Ga0070680_100035326 3300005336 Bacteria 4034
9 Ga0068868_100109012 3300005338 Bacteria 2248
10 Ga0068868_100275180 3300005338 Bacteria 1423
11 Ga0070660_100195973 3300005339 Bacteria 1637
12 Ga0070692_10027927 3300005345 Bacteria 2801
13 Ga0070668_100653798 3300005347 Bacteria 924
14 Ga0070671_100016031 3300005355 Bacteria 6055
15 Ga0070673_100032580 3300005364 Bacteria 3926
16 Ga0070659_100135619 3300005366 Bacteria 2001
17 Ga0070667_100079838 3300005367 Bacteria 2798
18 Ga0070709_10000377 3300005434 Bacteria 27511
19 Ga0070709_10001437 3300005434 Bacteria 12862
20 Ga0070709_10466808 3300005434 Bacteria 953
21 Ga0070714_100001403 3300005435 Bacteria 17466
22 Ga0070714_100003191 3300005435 Bacteria 12190
23 Ga0070714_100022881 3300005435 Bacteria 5128
24 Ga0070714_100301659 3300005435 Bacteria 1493
25 Ga0070714_100498082 3300005435 Bacteria 1162
26 Ga0070714_100645490 3300005435 Bacteria 1019
27 Ga0070714_100697174 3300005435 Bacteria 980
28 Ga0070714_101022404 3300005435 Bacteria 804
29 Ga0070713_100002255 3300005436 Bacteria 12518
30 Ga0070713_100005307 3300005436 Bacteria 8790
31 Ga0070713_100030209 3300005436 Bacteria 4301
32 Ga0070713_100094642 3300005436 Bacteria 2576
33 Ga0070713_100294537 3300005436 Bacteria 1492
34 Ga0070710_10000960 3300005437 Bacteria 13669
35 Ga0070710_10100683 3300005437 Bacteria 1720
36 Ga0070711_100006736 3300005439 Bacteria 6951
37 Ga0070711_100223277 3300005439 Bacteria 1465
38 Ga0070705_100466684 3300005440 Bacteria 951
39 Ga0070708_100015482 3300005445 Bacteria 6302
40 Ga0070708_100117474 3300005445 Bacteria 2450
41 Ga0070708_100367159 3300005445 Bacteria 1357
42 Ga0070708_100370778 3300005445 Bacteria 1350
43 Ga0070708_100468432 3300005445 Bacteria 1189
44 Ga0070708_100734967 3300005445 Bacteria 928
45 Ga0070663_100011727 3300005455 Bacteria 5514
46 Ga0070681_10137691 3300005458 Bacteria 2371
47 Ga0070685_10031523 3300005466 Bacteria 2963
48 Ga0070706_100004766 3300005467 Bacteria 13009
49 Ga0070706_100025838 3300005467 Bacteria 5404
50 Ga0070706_100119383 3300005467 Bacteria 2457
51 Ga0070706_100241452 3300005467 Bacteria 1687
52 Ga0070707_100000012 3300005468 Bacteria 157939
53 Ga0070707_100002570 3300005468 Bacteria 17244
54 Ga0070707_100025483 3300005468 Bacteria 5610
55 Ga0070707_100232669 3300005468 Bacteria 1793
56 Ga0070707_100399434 3300005468 Bacteria 1334
57 Ga0070707_100543102 3300005468 Bacteria 1124
58 Ga0070698_100000317 3300005471 Bacteria 49042
59 Ga0070698_100001877 3300005471 Bacteria 23416
60 Ga0070698_100022586 3300005471 Bacteria 6581
61 Ga0070698_100316028 3300005471 Bacteria 1492
62 Ga0070698_100527392 3300005471 Bacteria 1119
63 Ga0070699_100000802 3300005518 Bacteria 28996
64 Ga0070699_100023429 3300005518 Bacteria 5318
65 Ga0070699_100497942 3300005518 Bacteria 1107
66 Ga0070684_100010631 3300005535 Bacteria 7298
67 Ga0070684_100184747 3300005535 Bacteria 1896
68 Ga0070684_100239396 3300005535 Bacteria 1658
69 Ga0070684_100249600 3300005535 Bacteria 1622
70 Ga0070697_100002709 3300005536 Bacteria 13648
71 Ga0070697_100023607 3300005536 Bacteria 4891
72 Ga0070697_100058263 3300005536 Bacteria 3143
73 Ga0070686_100322144 3300005544 Bacteria 1153
74 Ga0070695_100010689 3300005545 Bacteria 5484
75 Ga0070696_100026907 3300005546 Bacteria 3915
76 Ga0070696_100134435 3300005546 Bacteria 1802
77 Ga0070665_100152024 3300005548 Bacteria 2317
78 Ga0068855_100111239 3300005563 Bacteria 3144
79 Ga0068855_100320332 3300005563 Bacteria 1714
80 Ga0070664_100093423 3300005564 Bacteria 2606
81 Ga0068857_100044927 3300005577 Bacteria 3918
82 Ga0068854_100006602 3300005578 Bacteria 7389
83 Ga0068856_100712915 3300005614 Bacteria 1023
84 Ga0068852_100061116 3300005616 Bacteria 3273
85 Ga0068859_100026997 3300005617 Bacteria 5760
86 Ga0068859_100632629 3300005617 Bacteria 1162
87 Ga0068859_101123954 3300005617 Bacteria 864
88 Ga0068864_100023306 3300005618 Bacteria 5197
89 Ga0068864_100137355 3300005618 Bacteria 2202
90 Ga0068864_100547804 3300005618 Bacteria 1118
91 Ga0068861_100205303 3300005719 Bacteria 1657
92 Ga0068870_10016058 3300005840 Bacteria 3568
93 Ga0068863_100086765 3300005841 Bacteria 2965
94 Ga0068858_100094952 3300005842 Bacteria 2778
95 Ga0068860_100214551 3300005843 Bacteria 1867
96 Ga0068860_100640846 3300005843 Bacteria 1070
97 Ga0068862_100057582 3300005844 Bacteria 3333
98 Ga0081540_1000154 3300005983 Bacteria 70679
99 Ga0081540_1000654 3300005983 Bacteria 32728
100 Ga0081539_10000569 3300005985 Bacteria 76165
101 Ga0081539_10108138 3300005985 Bacteria 1405
102 Ga0070717_10004786 3300006028 Bacteria 9845
103 Ga0070717_10017512 3300006028 Bacteria 5576
104 Ga0070717_10021291 3300006028 Bacteria 5107
105 Ga0070717_10035009 3300006028 Bacteria 4062
106 Ga0070717_10053253 3300006028 Bacteria 3335
107 Ga0070717_10056555 3300006028 Bacteria 3241
108 Ga0070717_10104482 3300006028 Bacteria 2409
109 Ga0070717_10156704 3300006028 Bacteria 1973
110 Ga0070717_10254412 3300006028 Bacteria 1552
111 Ga0070717_10346890 3300006028 Bacteria 1327
112 Ga0070717_10353310 3300006028 Bacteria 1314
113 Ga0070717_10409142 3300006028 Bacteria 1219
114 Ga0070717_10467045 3300006028 Bacteria 1138
115 Ga0075432_10019651 3300006058 Bacteria 2309
116 Ga0070715_10033721 3300006163 Bacteria 2094
117 Ga0070716_100000082 3300006173 Bacteria 37745
118 Ga0070716_100003183 3300006173 Bacteria 7691
119 Ga0070716_100131501 3300006173 Bacteria 1583
120 Ga0070716_100717325 3300006173 Bacteria 766
121 Ga0070712_100002122 3300006175 Bacteria 12193
122 Ga0070712_100029384 3300006175 Bacteria 3683
123 Ga0070712_100114882 3300006175 Bacteria 2016
124 Ga0070712_100424537 3300006175 Bacteria 1102
125 Ga0070712_100456804 3300006175 Bacteria 1064
126 Ga0070712_100677968 3300006175 Unclassified 877
127 Ga0068871_100034582 3300006358 Bacteria 4011
128 Ga0068871_100059663 3300006358 Bacteria 3109
129 Ga0075428_100551656 3300006844 Bacteria 1232
130 Ga0075428_101080244 3300006844 Bacteria 848
131 Ga0075433_10072883 3300006852 Bacteria 3020
132 Ga0075433_10201437 3300006852 Bacteria 1770
133 Ga0075434_100277042 3300006871 Bacteria 1697
134 Ga0075434_100463421 3300006871 Bacteria 1288
135 Ga0075434_100933127 3300006871 Bacteria 882
136 Ga0075436_100114954 3300006914 Bacteria 1879
137 Ga0075436_100147910 3300006914 Bacteria 1652
138 Ga0075436_100239575 3300006914 Bacteria 1290
139 Ga0097620_100026996 3300006931 Bacteria 5760
140 Ga0097620_100632653 3300006931 Bacteria 1162
141 Ga0097620_101123911 3300006931 Bacteria 864
142 Ga0075435_100460078 3300007076 Bacteria 1097
143 Ga0075435_100486054 3300007076 Bacteria 1067
144 Ga0105251_10141442 3300009011 Bacteria 1089
145 Ga0105240_10232703 3300009093 Bacteria 2140
146 Ga0111539_10024102 3300009094 Bacteria 7473
147 Ga0111539_10463466 3300009094 Bacteria 1476
148 Ga0105247_10522090 3300009101 Bacteria 869
149 Ga0114129_10389529 3300009147 Bacteria 1838
150 Ga0114129_10653332 3300009147 Bacteria 1357
151 Ga0105241_10028261 3300009174 Bacteria 4179
152 Ga0105242_10075348 3300009176 Bacteria 2809
153 Ga0105248_10146133 3300009177 Bacteria 2668
154 Ga0105248_10347733 3300009177 Bacteria 1669
155 Ga0105249_10182458 3300009553 Bacteria 2043
156 Ga0105239_10829298 3300010375 Bacteria 1060
157 Ga0105239_10884522 3300010375 Bacteria 1025
158 Ga0105246_10275541 3300011119 Bacteria 1347
159 Ga0157338_1008103 3300012515 Bacteria 1011
160 Ga0157373_10319533 3300013100 Bacteria 1104
161 Ga0157371_10048358 3300013102 Bacteria 3023
162 Ga0157370_10721680 3300013104 Bacteria 909
163 Ga0157369_10239857 3300013105 Bacteria 1894
164 Ga0157369_10444412 3300013105 Bacteria 1343
165 Ga0157369_11332322 3300013105 Bacteria 731
166 Ga0157374_10056601 3300013296 Bacteria 3662
167 Ga0157374_10104637 3300013296 Bacteria 2717
168 Ga0157374_10279001 3300013296 Bacteria 1649
169 Ga0163162_10166372 3300013306 Bacteria 2329
170 Ga0163162_10984738 3300013306 Bacteria 953
171 Ga0157372_10418230 3300013307 Bacteria 1562
172 Ga0157375_10175068 3300013308 Bacteria 2295
173 Ga0163163_10134285 3300014325 Bacteria 2515
174 Ga0163163_10440369 3300014325 Bacteria 1363
175 Ga0157377_10744282 3300014745 Bacteria 717
176 Ga0157379_10838265 3300014968 Bacteria 869
177 Ga0157376_10712972 3300014969 Bacteria 1009
178 Ga0206354_11602563 3300020081 Bacteria 2420
179 Ga0206354_11699213 3300020081 Bacteria 3132
180 Ga0206353_10027828 3300020082 Bacteria 2482
181 Ga0213876_10089356 3300021384 Bacteria 1632
182 Ga0213875_10000681 3300021388 Bacteria 26594
183 Ga0213875_10002771 3300021388 Bacteria 10347
184 Ga0213875_10004024 3300021388 Bacteria 8182
185 Ga0213875_10097354 3300021388 Bacteria 1372
186 Ga0207692_10009001 3300025898 Bacteria 4156
187 Ga0207692_10040456 3300025898 Bacteria 2300
188 Ga0207692_10216412 3300025898 Bacteria 1133
189 Ga0207647_10054319 3300025904 Bacteria 2465
190 Ga0207685_10010613 3300025905 Bacteria 2729
191 Ga0207699_10001206 3300025906 Bacteria 12253
192 Ga0207699_10005097 3300025906 Bacteria 6287
193 Ga0207699_10024834 3300025906 Bacteria 3282
194 Ga0207699_10391386 3300025906 Bacteria 988
195 Ga0207643_10004276 3300025908 Bacteria 7684
196 Ga0207705_10207770 3300025909 Bacteria 1485
197 Ga0207684_10001996 3300025910 Bacteria 21029
198 Ga0207684_10022938 3300025910 Bacteria 5330
199 Ga0207684_10024939 3300025910 Bacteria 5096
200 Ga0207693_10005985 3300025915 Bacteria 10085
201 Ga0207693_10009464 3300025915 Bacteria 7936
202 Ga0207693_10034273 3300025915 Bacteria 4006
203 Ga0207693_10188221 3300025915 Bacteria 1625
204 Ga0207693_10278448 3300025915 Bacteria 1311
205 Ga0207693_10290517 3300025915 Bacteria 1281
206 Ga0207663_10004078 3300025916 Bacteria 7245
207 Ga0207663_10016037 3300025916 Bacteria 4146
208 Ga0207663_10029399 3300025916 Bacteria 3227
209 Ga0207663_10117019 3300025916 Bacteria 1818
210 Ga0207663_10634061 3300025916 Bacteria 842
211 Ga0207660_10773849 3300025917 Bacteria 783
212 Ga0207657_10001989 3300025919 Bacteria 22083
213 Ga0207649_10099579 3300025920 Bacteria 1921
214 Ga0207646_10000058 3300025922 Bacteria 158096
215 Ga0207646_10003165 3300025922 Bacteria 18843
216 Ga0207646_10234378 3300025922 Bacteria 1658
217 Ga0207646_10285292 3300025922 Bacteria 1492
218 Ga0207681_10124946 3300025923 Bacteria 1893
219 Ga0207700_10000879 3300025928 Bacteria 17301
220 Ga0207700_10008071 3300025928 Bacteria 6493
221 Ga0207700_10021499 3300025928 Bacteria 4407
222 Ga0207700_10027302 3300025928 Bacteria 3995
223 Ga0207700_10053249 3300025928 Bacteria 3031
224 Ga0207700_10073050 3300025928 Bacteria 2647
225 Ga0207700_10092417 3300025928 Bacteria 2392
226 Ga0207700_10141041 3300025928 Bacteria 1980
227 Ga0207664_10036106 3300025929 Bacteria 3818
228 Ga0207664_10046281 3300025929 Bacteria 3414
229 Ga0207664_10086623 3300025929 Bacteria 2559
230 Ga0207664_10227769 3300025929 Bacteria 1619
231 Ga0207664_10613514 3300025929 Bacteria 977
232 Ga0207644_10671008 3300025931 Bacteria 863
233 Ga0207706_10111917 3300025933 Bacteria 2402
234 Ga0207665_10000100 3300025939 Bacteria 55652
235 Ga0207665_10002003 3300025939 Bacteria 13735
236 Ga0207665_10020493 3300025939 Bacteria 4345
237 Ga0207665_10025717 3300025939 Bacteria 3884
238 Ga0207665_10049546 3300025939 Bacteria 2823
239 Ga0207665_10065580 3300025939 Bacteria 2469
240 Ga0207665_10106525 3300025939 Bacteria 1965
241 Ga0207691_10036545 3300025940 Bacteria 4552
242 Ga0207711_10110031 3300025941 Bacteria 2449
243 Ga0207689_10002863 3300025942 Bacteria 15908
244 Ga0207679_10198962 3300025945 Bacteria 1672
245 Ga0207651_10043218 3300025960 Bacteria 3006
246 Ga0207668_10001173 3300025972 Bacteria 15556
247 Ga0207658_10173851 3300025986 Bacteria 1777
248 Ga0207677_10410126 3300026023 Bacteria 1151
249 Ga0207639_10025965 3300026041 Bacteria 4252
250 Ga0207678_10002393 3300026067 Bacteria 17038
251 Ga0207702_10072520 3300026078 Bacteria 2968
252 Ga0207702_10232883 3300026078 Bacteria 1722
253 Ga0207702_10495483 3300026078 Bacteria 1190
254 Ga0207641_10033799 3300026088 Bacteria 4249
255 Ga0207641_10969018 3300026088 Bacteria 846
256 Ga0207648_10053154 3300026089 Bacteria 3541
257 Ga0207676_10055386 3300026095 Bacteria 3113
258 Ga0207676_10446624 3300026095 Bacteria 1218
259 Ga0207674_10027339 3300026116 Bacteria 6037
260 Ga0207683_10006866 3300026121 Bacteria 9748
261 Ga0268265_10180034 3300028380 Bacteria 1815
262 Ga0307513_10021345 3300031456 Bacteria 7646
263 Ga0307513_10620006 3300031456 Bacteria 790
264 Ga0307406_10051227 3300031901 Bacteria 2620
265 Ga0307407_10335337 3300031903 Bacteria 1066
266 Ga0307412_10048648 3300031911 Bacteria 2790
267 Ga0307416_100226804 3300032002 Bacteria 1797
268 Ga0307415_100087546 3300032126 Bacteria 2244
269 Ga0307415_100315609 3300032126 Bacteria 1301
270 Ga0373926_0001345 3300035083 Bacteria 7432
271 Ga0373926_0001517 3300035083 Bacteria 7112
272 Ga0373926_0088851 3300035083 Bacteria 1148
273 Ga0373928_0067084 3300035084 Bacteria 879
274 Ga0373928_0085136 3300035084 Bacteria 803
275 Ga0373934_0151629 3300035086 Bacteria 949
276 Ga0373944_0005963 3300035089 Bacteria 3224
277 Ga0373944_0011357 3300035089 Bacteria 2439
278 Ga0373952_0005014 3300035092 Bacteria 2411
279 Ga0373923_0001225 3300035111 Bacteria 7193
280 Ga0373923_0024095 3300035111 Bacteria 2400
281 Ga0373936_0000553 3300035113 Bacteria 12848
282 Ga0373936_0001326 3300035113 Bacteria 8968
283 Ga0373936_0007690 3300035113 Bacteria 4046
284 Ga0373936_0038643 3300035113 Bacteria 1909
285 Ga0373936_0081088 3300035113 Bacteria 1351
286 Ga0373939_0226362 3300035114 Bacteria 718
287 Ga0373941_0084923 3300035115 Bacteria 1076
288 Ga0373945_0000015 3300035116 Bacteria 35837
289 Ga0373953_0007380 3300035117 Bacteria 3679
290 Ga0373953_0036395 3300035117 Bacteria 1939
291 Ga0373953_0123433 3300035117 Bacteria 1101
292 Ga0373954_0000568 3300035118 Bacteria 13931
293 Ga0373954_0006956 3300035118 Bacteria 4938
294 Ga0373954_0075425 3300035118 Bacteria 1606
295 Ga0373954_0100778 3300035118 Bacteria 1393
296 Ga0373956_0002170 3300035119 Bacteria 8107
297 Ga0373956_0011359 3300035119 Bacteria 3667
298 Ga0373956_0022286 3300035119 Bacteria 2709
299 Ga0373956_0032488 3300035119 Bacteria 2290
300 Ga0373957_0005009 3300035120 Bacteria 4084
301 Ga0373957_0012632 3300035120 Bacteria 2848
302 Ga0373960_0004087 3300035121 Bacteria 3336
303 Ga0373943_0001056 3300035170 Bacteria 12228
304 Ga0373943_0004233 3300035170 Bacteria 6505
305 Ga0373943_0195019 3300035170 Bacteria 1119
306 Ga0373946_0002791 3300035171 Bacteria 6179
307 Ga0373946_0005159 3300035171 Bacteria 4708
308 Ga0373955_0004101 3300035172 Bacteria 6431
309 Ga0373955_0079156 3300035172 Bacteria 1853
310 Ga0373955_0089674 3300035172 Bacteria 1750
311 Ga0373955_0148474 3300035172 Bacteria 1378
312 Ga0373955_0268783 3300035172 Bacteria 1024
313 Ga0373942_0004643 3300035207 Bacteria 3183
314 Ga0373961_0078588 3300035241 Bacteria 1034
315 Ga0373924_0031932 3300035410 Bacteria 2119
316 Ga0373924_0057811 3300035410 Bacteria 1618
317 Ga0373924_0144727 3300035410 Bacteria 1038
318 Ga0373935_0008136 3300035692 Bacteria 6287
319 Ga0373927_0027852 3300035695 Bacteria 3689
320 Ga0373927_0230585 3300035695 Bacteria 1217
321 Ga0373933_0011954 3300035724 Bacteria 4792
322 Ga0373933_0013670 3300035724 Bacteria 4502
323 Ga0373933_0022076 3300035724 Bacteria 3622
324 Ga0373933_0203743 3300035724 Bacteria 1266
325 Ga0373947_0000429 3300035725 Bacteria 23848
326 Ga0373947_0252011 3300035725 Unclassified 1168
327 Ga0373937_0013957 3300036401 Bacteria 7082
328 Ga0373937_0047483 3300036401 Bacteria 3928
329 Ga0373937_0231956 3300036401 Bacteria 1738
330 Ga0373937_0266994 3300036401 Bacteria 1614
331 Ga0373937_0465684 3300036401 Bacteria 1200
332 Ga0373937_0493980 3300036401 Bacteria 1162
333 Ga0373937_0511968 3300036401 Bacteria 1140
334 Ga0373937_0811651 3300036401 Bacteria 883
335 Ga0373925_0019292 3300037068 Bacteria 4959
336 Ga0373925_0104967 3300037068 Bacteria 2176
337 Ga0436364_0164275 3300037853 Bacteria 26469
338 Ga0436364_0383313 3300037853 Bacteria 88995
339 Ga0436364_0639874 3300037853 Unclassified 1029
340 Ga0436364_0948351 3300037853 Bacteria 24426
341 Ga0436364_0985460 3300037853 Bacteria 1436
342 Ga0436365_0565342 3300039437 Bacteria 1185
343 Ga0436365_0763143 3300039437 Bacteria 1698
344 Ga0436365_0798017 3300039437 Bacteria 1685
345 Ga0466966_0053316 3300044684 Bacteria 2566
346 Ga0466963_0015106 3300044694 Bacteria 4774
347 Ga0466963_0476911 3300044694 Bacteria 881
348 Ga0466957_0423759 3300044842 Bacteria 913
349 Ga0466959_0134004 3300045049 Bacteria 1755
350 Ga0466959_0186961 3300045049 Bacteria 1447
351 Ga0466967_0191382 3300045976 Bacteria 1933
352 Ga0495592_0002319 3300046454 Bacteria 13431
353 Ga0495592_0108843 3300046454 Bacteria 1964
354 Ga0495592_0455265 3300046454 Bacteria 801
355 Ga0495603_0059846 3300046455 Bacteria 2251
356 Ga0495629_0006843 3300046459 Bacteria 8421
357 Ga0495629_0033137 3300046459 Bacteria 3655
358 Ga0495641_0012704 3300046461 Bacteria 4688
359 Ga0495651_0005002 3300046462 Bacteria 10124
360 Ga0495651_0010202 3300046462 Bacteria 7212
361 Ga0495651_0024480 3300046462 Bacteria 4696
362 Ga0495651_0034086 3300046462 Bacteria 3969
363 Ga0495651_0057817 3300046462 Bacteria 2976
364 Ga0495651_0082294 3300046462 Bacteria 2429
365 Ga0495651_0235889 3300046462 Bacteria 1257
366 Ga0495651_0317069 3300046462 Bacteria 1040
367 Ga0495653_0015586 3300046463 Bacteria 6195
368 Ga0495653_0039447 3300046463 Bacteria 3699
369 Ga0495653_0085945 3300046463 Bacteria 2312
370 Ga0495580_0036621 3300046472 Bacteria 3522
371 Ga0495582_0018197 3300046473 Bacteria 3844
372 Ga0495582_0036106 3300046473 Bacteria 2718
373 Ga0495582_0042930 3300046473 Bacteria 2490
374 Ga0495582_0341294 3300046473 Bacteria 862
375 Ga0495639_0003446 3300046475 Bacteria 6850
376 Ga0495639_0103961 3300046475 Bacteria 1343
377 Ga0495662_0115187 3300046476 Bacteria 1318
378 Ga0495662_0182723 3300046476 Bacteria 1033
379 Ga0495664_0003767 3300046477 Bacteria 8275
380 Ga0495664_0010788 3300046477 Bacteria 5137
381 Ga0495664_0062994 3300046477 Bacteria 2209
382 Ga0495664_0093772 3300046477 Bacteria 1806
383 Ga0495594_0145343 3300046499 Bacteria 1345
384 Ga0495608_0009418 3300046511 Bacteria 6826
385 Ga0495608_0028823 3300046511 Bacteria 3773
386 Ga0495608_0032818 3300046511 Bacteria 3509
387 Ga0495608_0042516 3300046511 Bacteria 3039
388 Ga0495608_0141154 3300046511 Bacteria 1537
389 Ga0495618_0013573 3300046514 Bacteria 4957
390 Ga0495618_0023853 3300046514 Bacteria 3787
391 Ga0495618_0080884 3300046514 Bacteria 2074
392 Ga0495618_0090995 3300046514 Bacteria 1950
393 Ga0495618_0157757 3300046514 Bacteria 1447
394 Ga0495628_0013603 3300046516 Bacteria 6843
395 Ga0495628_0049167 3300046516 Bacteria 3339
396 Ga0495628_0081069 3300046516 Bacteria 2520
397 Ga0495628_0113978 3300046516 Bacteria 2078
398 Ga0495628_0343761 3300046516 Bacteria 1098
399 Ga0495628_0392137 3300046516 Bacteria 1015
400 Ga0495630_0065513 3300046517 Bacteria 2730
401 Ga0495630_0084352 3300046517 Bacteria 2398
402 Ga0495630_0101761 3300046517 Bacteria 2173
403 Ga0495666_0004637 3300046526 Bacteria 6951
404 Ga0495652_0009200 3300046529 Bacteria 8983
405 Ga0495652_0020495 3300046529 Bacteria 5878
406 Ga0495652_0096356 3300046529 Bacteria 2409
407 Ga0495652_0104973 3300046529 Bacteria 2284
408 Ga0495652_0231474 3300046529 Bacteria 1381
409 Ga0495652_0272285 3300046529 Bacteria 1244
410 Ga0495652_0321157 3300046529 Bacteria 1118
411 Ga0495665_0003865 3300046531 Bacteria 8103
412 Ga0495665_0005557 3300046531 Bacteria 6794
413 Ga0495640_0071402 3300046533 Bacteria 2330
414 Ga0495640_0156146 3300046533 Bacteria 1464
415 Ga0495640_0238714 3300046533 Bacteria 1141
416 Ga0495586_0082362 3300046535 Bacteria 1769
417 Ga0495587_0003048 3300046536 Bacteria 11195
418 Ga0495587_0013712 3300046536 Bacteria 5091
419 Ga0495587_0030681 3300046536 Bacteria 3259
420 Ga0495587_0109878 3300046536 Bacteria 1584
421 Ga0495587_0178053 3300046536 Bacteria 1206
422 Ga0495645_0143863 3300046543 Bacteria 1661
423 Ga0495645_0206822 3300046543 Bacteria 1327
424 Ga0495645_0340198 3300046543 Bacteria 969
425 Ga0495622_0156511 3300046557 Bacteria 1029
426 Ga0495667_0004401 3300046559 Bacteria 9502
427 Ga0495667_0010021 3300046559 Bacteria 6418
428 Ga0495667_0014321 3300046559 Bacteria 5356
429 Ga0495667_0030148 3300046559 Bacteria 3647
430 Ga0495667_0042038 3300046559 Bacteria 3030
431 Ga0495667_0567337 3300046559 Bacteria 708
432 Ga0495634_0004146 3300046642 Bacteria 11454
433 Ga0495634_0032221 3300046642 Bacteria 3605
434 Ga0495634_0033672 3300046642 Bacteria 3519
435 Ga0495634_0034936 3300046642 Bacteria 3447
436 Ga0495635_0002730 3300046663 Bacteria 12093
437 Ga0495635_0024656 3300046663 Bacteria 4192
438 Ga0495635_0028831 3300046663 Bacteria 3858
439 Ga0495635_0198655 3300046663 Bacteria 1360
440 Ga0495635_0361928 3300046663 Bacteria 967
441 Ga0495635_0466488 3300046663 Bacteria 834
442 Ga0495657_0024822 3300046675 Bacteria 4263
443 Ga0495657_0030067 3300046675 Bacteria 3806
444 Ga0495657_0030892 3300046675 Bacteria 3747
445 Ga0495657_0035716 3300046675 Bacteria 3442
446 Ga0495657_0036298 3300046675 Bacteria 3407
447 Ga0495599_0010331 3300046678 Bacteria 5708
448 Ga0495599_0033624 3300046678 Bacteria 3222
449 Ga0495599_0077838 3300046678 Bacteria 2070
450 Ga0495599_0201281 3300046678 Bacteria 1223
451 Ga0495623_0010877 3300046679 Bacteria 5890
452 Ga0495623_0133302 3300046679 Bacteria 1485
453 Ga0495646_0001441 3300046680 Bacteria 14129
454 Ga0495646_0090947 3300046680 Bacteria 1762
455 Ga0495646_0096078 3300046680 Bacteria 1704
456 Ga0495647_0014591 3300046681 Bacteria 2739
457 Ga0495647_0017476 3300046681 Bacteria 2539
458 Ga0495658_0002453 3300046683 Bacteria 9335
459 Ga0495613_0045146 3300046689 Bacteria 3260
460 Ga0495613_0185570 3300046689 Bacteria 1471
461 Ga0495613_0203494 3300046689 Bacteria 1395
462 Ga0495613_0415591 3300046689 Bacteria 916
463 Ga0495624_0010978 3300046690 Bacteria 6238
464 Ga0495624_0016597 3300046690 Bacteria 4956
465 Ga0495624_0039930 3300046690 Bacteria 3008
466 Ga0495624_0207377 3300046690 Bacteria 1189
467 Ga0495600_0022859 3300046809 Bacteria 4019
468 Ga0495600_0028949 3300046809 Bacteria 3585
469 Ga0495600_0067468 3300046809 Bacteria 2338
470 Ga0495581_0007790 3300047315 Bacteria 6201
471 Ga0495581_0074956 3300047315 Bacteria 1958
472 Ga0495581_0233204 3300047315 Bacteria 1076
473 Ga0495604_0007103 3300047317 Bacteria 8878
474 Ga0495604_0046403 3300047317 Bacteria 3387
475 Ga0495604_0139250 3300047317 Bacteria 1735
476 Ga0495674_0000403 3300047319 Bacteria 38789
477 Ga0495674_0015025 3300047319 Bacteria 7245
478 Ga0495674_0018031 3300047319 Bacteria 6571
479 Ga0495674_0074647 3300047319 Bacteria 2919
480 Ga0495674_0313284 3300047319 Bacteria 1280
481 Ga0495676_0027027 3300047321 Bacteria 4929
482 Ga0495676_0050072 3300047321 Bacteria 3352
483 Ga0495676_0528005 3300047321 Bacteria 773
484 Ga0495680_0006532 3300047322 Bacteria 10825
485 Ga0495680_0015758 3300047322 Bacteria 6508
486 Ga0495680_0031053 3300047322 Bacteria 4352
487 Ga0495680_0040978 3300047322 Bacteria 3684
488 Ga0495680_0041109 3300047322 Bacteria 3677
489 Ga0495675_0038883 3300047444 Bacteria 3029
490 Ga0495675_0092736 3300047444 Bacteria 1895
491 Ga0495684_0002595 3300047471 Bacteria 14355
492 Ga0495684_0004320 3300047471 Bacteria 11101
493 Ga0495684_0031459 3300047471 Bacteria 4074
494 Ga0495684_0087225 3300047471 Bacteria 2365
495 Ga0495684_0267311 3300047471 Bacteria 1238
496 Ga0495593_0018158 3300047673 Bacteria 3955
497 Ga0495593_0062100 3300047673 Bacteria 1953
498 Ga0495602_0011198 3300048088 Bacteria 9273
499 Ga0495602_0047211 3300048088 Bacteria 3882
500 Ga0495602_0083577 3300048088 Bacteria 2674
501 Ga0495602_0094165 3300048088 Bacteria 2476
502 Ga0495602_0104179 3300048088 Bacteria 2321
503 Ga0495602_0125193 3300048088 Bacteria 2060
504 Ga0495614_0027005 3300048089 Bacteria 2475
505 Ga0495614_0068334 3300048089 Bacteria 1530
506 Ga0496100_0051167 3300048903 Bacteria 2680
507 Ga0496101_0043816 3300048904 Bacteria 3199
508 Ga0496101_0216771 3300048904 Bacteria 1484
509 Ga0496101_0798697 3300048904 Bacteria 744
510 Ga0496102_0300301 3300048905 Bacteria 1513
511 Ga0496103_0011102 3300048906 Bacteria 5334
512 Ga0496104_0037316 3300048907 Bacteria 4544
513 Ga0496104_0471001 3300048907 Bacteria 1167
514 Ga0496105_0053267 3300048908 Bacteria 3341
515 Ga0496105_0098501 3300048908 Bacteria 2414
516 Ga0496106_0093270 3300048909 Bacteria 2326
517 Ga0496106_0414624 3300048909 Bacteria 1082
518 Ga0496107_0087151 3300048910 Bacteria 2279
519 Ga0496108_0060622 3300048911 Bacteria 3183
520 Ga0496108_0121239 3300048911 Bacteria 2243
521 Ga0496108_0191264 3300048911 Bacteria 1774
522 Ga0496109_0095961 3300048912 Bacteria 2746
523 Ga0496110_0015596 3300048913 Bacteria 6327
524 Ga0496110_0090411 3300048913 Bacteria 2737
525 Ga0496111_0003188 3300048914 Bacteria 10113
526 Ga0496111_0080511 3300048914 Bacteria 2377
527 Ga0496112_0073631 3300048915 Bacteria 3376
528 Ga0496113_0031090 3300048916 Bacteria 3871
529 Ga0496113_0107628 3300048916 Bacteria 2166
530 Ga0501031_0014897 3300049568 Bacteria 5053
531 Ga0501033_0103258 3300049570 Bacteria 2079
532 Ga0501036_0036103 3300049572 Bacteria 4181
533 Ga0501037_0145679 3300049573 Bacteria 1694
534 Ga0501038_0050773 3300049574 Bacteria 3583
535 Ga0501039_0019726 3300049575 Bacteria 5169
536 Ga0501040_0018730 3300049576 Bacteria 4598
537 Ga0501041_0048141 3300049577 Bacteria 2596
538 Ga0501042_0022889 3300049578 Bacteria 4366
539 Ga0501043_0088199 3300049579 Bacteria 2438
540 Ga0501043_0461596 3300049579 Bacteria 953
541 Ga0501046_0098205 3300049580 Bacteria 2249
542 Ga0501048_0273373 3300049582 Bacteria 1201
543 Ga0501067_0073169 3300049583 Bacteria 1899
544 Ga0501068_0111623 3300049584 Bacteria 1700
545 Ga0501071_0096290 3300049587 Bacteria 2178
546 Ga0501072_0004999 3300049588 Bacteria 10087
547 Ga0501074_0014518 3300049590 Bacteria 5731
548 Ga0501075_0002237 3300049591 Bacteria 12819
549 Ga0501076_0002427 3300049592 Bacteria 12785
550 Ga0501077_0006245 3300049593 Bacteria 7286
551 Ga0501081_0033327 3300049743 Bacteria 3499
552 Ga0501081_0164709 3300049743 Bacteria 1599
553 Ga0501083_0082373 3300049744 Bacteria 2132
554 Ga0501045_0007477 3300049824 Bacteria 7586
555 nmdc:mga05p37_339824_c1 3300050507 Bacteria 1771
556 nmdc:mga05p37_527756_c1 3300050507 Bacteria 1349
557 nmdc:mga0n895_129762_c1 3300050512 Bacteria 2545
558 nmdc:mga0n895_222951_c1 3300050512 Bacteria 1914
559 nmdc:mga0n895_778600_c1 3300050512 Unclassified 948
560 nmdc:mga0rr50_360008_c1 3300050513 Bacteria 1224
561 nmdc:mga0rr50_90494_c1 3300050513 Bacteria 2381
562 nmdc:mga08x19_138663_c1 3300050514 Bacteria 1641
563 nmdc:mga08x19_191760_c1 3300050514 Bacteria 1398
564 nmdc:mga08x19_310969_c1 3300050514 Bacteria 1095
565 nmdc:mga0a205_121098_c1 3300050515 Bacteria 2516
566 nmdc:mga0a205_134658_c1 3300050515 Bacteria 2371
567 Ga0495601_0126540 3300053077 Bacteria 1662
568 Ga0495612_0082626 3300053078 Bacteria 1351
569 Ga0495595_0008316 3300053084 Bacteria 4260
570 Ga0495595_0040302 3300053084 Bacteria 2134
571 Ga0495595_0113291 3300053084 Bacteria 1317
572 Ga0495619_0015828 3300053085 Bacteria 4774
573 Ga0495619_0299983 3300053085 Bacteria 1113
574 Ga0500600_0063615 3300053149 Bacteria 2047
575 Ga0501084_0014946 3300054114 Bacteria 6436
576 Ga0466962_0017182 3300061719 Bacteria 3486
577 Ga0530510_0010751 3300061734 Bacteria 6422
578 2501942927 2501939600 Bacteria 6907073
579 2516083592 2515154202 Bacteria 5471270
580 2516089523 2515154203 Bacteria 5458536
581 2552107859 2551306166 Bacteria 9731570
582 2623586259 2622736626 Bacteria 7181580
583 2753038686 2751185725 Bacteria 5740550
584 2753327198 2751185792 Bacteria 5739090
585 2772641435 2772190715 Bacteria 6959372
586 2831937233 2831935698 Bacteria 5963223
587 2832010637 2832004796 Bacteria 6538017
588 2855676589 2855670206 Bacteria 7120389
589 2855683362 2855676851 Bacteria 7063653
590 2855685095 2855683550 Bacteria 7134265
591 2856860136 2856858025 Bacteria 7255264
592 2857292778 2857288857 Bacteria 7189066
593 2858852186 2858848962 Bacteria 6963058
594 2858870123 2858868258 Bacteria 7683772
595 2858888297 2858882152 Bacteria 7230291
596 2858892007 2858888857 Bacteria 7060307
597 2858899056 2858895516 Bacteria 7378898
598 2858905384 2858902515 Bacteria 7086037
599 2866071199 2866065130 Bacteria 6518152
600 2867304225 2867302475 Bacteria 7087181
601 2867313553 2867312974 Bacteria 7058875
602 2867322624 2867319477 Bacteria 7069771
603 2867509162 2867507094 Bacteria 6506033
604 2869064863 2869061728 Bacteria 7112407
605 2869073783 2869068681 Bacteria 7205615
606 2880494014 2880489317 Bacteria 7096270
607 2880498318 2880495981 Bacteria 7340502
608 2899377047 2899370129 Bacteria 6781179
609 2902587386 2902582711 Bacteria 6187705
610 2917744286 2917736166 Bacteria 9690793
611 2929220358 2929219909 Bacteria 6984360
612 2929226907 2929226422 Bacteria 7248583
613 649810619 649633069 Bacteria 6962533
614 8003834612 8003830390 Bacteria 6541657
615 8003877214 8003870546 Bacteria 7396674
616 8054710037 8054704163 Bacteria 7247792
617 8054728247 8054727385 Bacteria 7558670
618 8054735362 8054734606 Bacteria 6947278
619 8055413724 8055412473 Bacteria 6257500
620 Ga0496110_0366677
621 JGI25404J52841_10019753
622 Ga0070658_10042883
623 Ga0070683_100040810
624 Ga0070683_100441160
625 Ga0068869_100085738
626 Ga0070666_10134127
627 Ga0070680_100035326
628 Ga0068868_100109012
629 Ga0068868_100275180
630 Ga0070660_100195973
631 Ga0070692_10027927
632 Ga0070668_100653798
633 Ga0070671_100016031
634 Ga0070673_100032580
635 Ga0070659_100135619
636 Ga0070667_100079838
637 Ga0070709_10000377
638 Ga0070709_10001437
639 Ga0070709_10466808
640 Ga0070714_100001403
641 Ga0070714_100003191
642 Ga0070714_100022881
643 Ga0070714_100301659
644 Ga0070714_100498082
645 Ga0070714_100645490
646 Ga0070714_100697174
647 Ga0070714_101022404
648 Ga0070713_100002255
649 Ga0070713_100005307
650 Ga0070713_100030209
651 Ga0070713_100094642
652 Ga0070713_100294537
653 Ga0070710_10000960
654 Ga0070710_10100683
655 Ga0070711_100006736
656 Ga0070711_100223277
657 Ga0070705_100466684
658 Ga0070708_100015482
659 Ga0070708_100117474
660 Ga0070708_100367159
661 Ga0070708_100370778
662 Ga0070708_100468432
663 Ga0070708_100734967
664 Ga0070663_100011727
665 Ga0070681_10137691
666 Ga0070685_10031523
667 Ga0070706_100004766
668 Ga0070706_100025838
669 Ga0070706_100119383
670 Ga0070706_100241452
671 Ga0070707_100000012
672 Ga0070707_100002570
673 Ga0070707_100025483
674 Ga0070707_100232669
675 Ga0070707_100399434
676 Ga0070707_100543102
677 Ga0070698_100000317
678 Ga0070698_100001877
679 Ga0070698_100022586
680 Ga0070698_100316028
681 Ga0070698_100527392
682 Ga0070699_100000802
683 Ga0070699_100023429
684 Ga0070699_100497942
685 Ga0070684_100010631
686 Ga0070684_100184747
687 Ga0070684_100239396
688 Ga0070684_100249600
689 Ga0070697_100002709
690 Ga0070697_100023607
691 Ga0070697_100058263
692 Ga0070686_100322144
693 Ga0070695_100010689
694 Ga0070696_100026907
695 Ga0070696_100134435
696 Ga0070665_100152024
697 Ga0068855_100111239
698 Ga0068855_100320332
699 Ga0070664_100093423
700 Ga0068857_100044927
701 Ga0068854_100006602
702 Ga0068856_100712915
703 Ga0068852_100061116
704 Ga0068859_100026997
705 Ga0068859_100632629
706 Ga0068859_101123954
707 Ga0068864_100023306
708 Ga0068864_100137355
709 Ga0068864_100547804
710 Ga0068861_100205303
711 Ga0068870_10016058
712 Ga0068863_100086765
713 Ga0068858_100094952
714 Ga0068860_100214551
715 Ga0068860_100640846
716 Ga0068862_100057582
717 Ga0081540_1000154
718 Ga0081540_1000654
719 Ga0081539_10000569
720 Ga0081539_10108138
721 Ga0070717_10004786
722 Ga0070717_10017512
723 Ga0070717_10021291
724 Ga0070717_10035009
725 Ga0070717_10053253
726 Ga0070717_10056555
727 Ga0070717_10104482
728 Ga0070717_10156704
729 Ga0070717_10254412
730 Ga0070717_10346890
731 Ga0070717_10353310
732 Ga0070717_10409142
733 Ga0070717_10467045
734 Ga0075432_10019651
735 Ga0070715_10033721
736 Ga0070716_100000082
737 Ga0070716_100003183
738 Ga0070716_100131501
739 Ga0070716_100717325
740 Ga0070712_100002122
741 Ga0070712_100029384
742 Ga0070712_100114882
743 Ga0070712_100424537
744 Ga0070712_100456804
745 Ga0070712_100677968
746 Ga0068871_100034582
747 Ga0068871_100059663
748 Ga0075428_100551656
749 Ga0075428_101080244
750 Ga0075433_10072883
751 Ga0075433_10201437
752 Ga0075434_100277042
753 Ga0075434_100463421
754 Ga0075434_100933127
755 Ga0075436_100114954
756 Ga0075436_100147910
757 Ga0075436_100239575
758 Ga0097620_100026996
759 Ga0097620_100632653
760 Ga0097620_101123911
761 Ga0075435_100460078
762 Ga0075435_100486054
763 Ga0105251_10141442
764 Ga0105240_10232703
765 Ga0111539_10024102
766 Ga0111539_10463466
767 Ga0105247_10522090
768 Ga0114129_10389529
769 Ga0114129_10653332
770 Ga0105241_10028261
771 Ga0105242_10075348
772 Ga0105248_10146133
773 Ga0105248_10347733
774 Ga0105249_10182458
775 Ga0105239_10829298
776 Ga0105239_10884522
777 Ga0105246_10275541
778 Ga0157338_1008103
779 Ga0157373_10319533
780 Ga0157371_10048358
781 Ga0157370_10721680
782 Ga0157369_10239857
783 Ga0157369_10444412
784 Ga0157369_11332322
785 Ga0157374_10056601
786 Ga0157374_10104637
787 Ga0157374_10279001
788 Ga0163162_10166372
789 Ga0163162_10984738
790 Ga0157372_10418230
791 Ga0157375_10175068
792 Ga0163163_10134285
793 Ga0163163_10440369
794 Ga0157377_10744282
795 Ga0157379_10838265
796 Ga0157376_10712972
797 Ga0206354_11602563
798 Ga0206354_11699213
799 Ga0206353_10027828
800 Ga0213876_10089356
801 Ga0213875_10000681
802 Ga0213875_10002771
803 Ga0213875_10004024
804 Ga0213875_10097354
805 Ga0207692_10009001
806 Ga0207692_10040456
807 Ga0207692_10216412
808 Ga0207647_10054319
809 Ga0207685_10010613
810 Ga0207699_10001206
811 Ga0207699_10005097
812 Ga0207699_10024834
813 Ga0207699_10391386
814 Ga0207643_10004276
815 Ga0207705_10207770
816 Ga0207684_10001996
817 Ga0207684_10022938
818 Ga0207684_10024939
819 Ga0207693_10005985
820 Ga0207693_10009464
821 Ga0207693_10034273
822 Ga0207693_10188221
823 Ga0207693_10278448
824 Ga0207693_10290517
825 Ga0207663_10004078
826 Ga0207663_10016037
827 Ga0207663_10029399
828 Ga0207663_10117019
829 Ga0207663_10634061
830 Ga0207660_10773849
831 Ga0207657_10001989
832 Ga0207649_10099579
833 Ga0207646_10000058
834 Ga0207646_10003165
835 Ga0207646_10234378
836 Ga0207646_10285292
837 Ga0207681_10124946
838 Ga0207700_10000879
839 Ga0207700_10008071
840 Ga0207700_10021499
841 Ga0207700_10027302
842 Ga0207700_10053249
843 Ga0207700_10073050
844 Ga0207700_10092417
845 Ga0207700_10141041
846 Ga0207664_10036106
847 Ga0207664_10046281
848 Ga0207664_10086623
849 Ga0207664_10227769
850 Ga0207664_10613514
851 Ga0207644_10671008
852 Ga0207706_10111917
853 Ga0207665_10000100
854 Ga0207665_10002003
855 Ga0207665_10020493
856 Ga0207665_10025717
857 Ga0207665_10049546
858 Ga0207665_10065580
859 Ga0207665_10106525
860 Ga0207691_10036545
861 Ga0207711_10110031
862 Ga0207689_10002863
863 Ga0207679_10198962
864 Ga0207651_10043218
865 Ga0207668_10001173
866 Ga0207658_10173851
867 Ga0207677_10410126
868 Ga0207639_10025965
869 Ga0207678_10002393
870 Ga0207702_10072520
871 Ga0207702_10232883
872 Ga0207702_10495483
873 Ga0207641_10033799
874 Ga0207641_10969018
875 Ga0207648_10053154
876 Ga0207676_10055386
877 Ga0207676_10446624
878 Ga0207674_10027339
879 Ga0207683_10006866
880 Ga0268265_10180034
881 Ga0307513_10021345
882 Ga0307513_10620006
883 Ga0307406_10051227
884 Ga0307407_10335337
885 Ga0307412_10048648
886 Ga0307416_100226804
887 Ga0307415_100087546
888 Ga0307415_100315609
889 Ga0373926_0001345
890 Ga0373926_0001517
891 Ga0373926_0088851
892 Ga0373928_0067084
893 Ga0373928_0085136
894 Ga0373934_0151629
895 Ga0373944_0005963
896 Ga0373944_0011357
897 Ga0373952_0005014
898 Ga0373923_0001225
899 Ga0373923_0024095
900 Ga0373936_0000553
901 Ga0373936_0001326
902 Ga0373936_0007690
903 Ga0373936_0038643
904 Ga0373936_0081088
905 Ga0373939_0226362
906 Ga0373941_0084923
907 Ga0373945_0000015
908 Ga0373953_0007380
909 Ga0373953_0036395
910 Ga0373953_0123433
911 Ga0373954_0000568
912 Ga0373954_0006956
913 Ga0373954_0075425
914 Ga0373954_0100778
915 Ga0373956_0002170
916 Ga0373956_0011359
917 Ga0373956_0022286
918 Ga0373956_0032488
919 Ga0373957_0005009
920 Ga0373957_0012632
921 Ga0373960_0004087
922 Ga0373943_0001056
923 Ga0373943_0004233
924 Ga0373943_0195019
925 Ga0373946_0002791
926 Ga0373946_0005159
927 Ga0373955_0004101
928 Ga0373955_0079156
929 Ga0373955_0089674
930 Ga0373955_0148474
931 Ga0373955_0268783
932 Ga0373942_0004643
933 Ga0373961_0078588
934 Ga0373924_0031932
935 Ga0373924_0057811
936 Ga0373924_0144727
937 Ga0373935_0008136
938 Ga0373927_0027852
939 Ga0373927_0230585
940 Ga0373933_0011954
941 Ga0373933_0013670
942 Ga0373933_0022076
943 Ga0373933_0203743
944 Ga0373947_0000429
945 Ga0373947_0252011
946 Ga0373937_0013957
947 Ga0373937_0047483
948 Ga0373937_0231956
949 Ga0373937_0266994
950 Ga0373937_0465684
951 Ga0373937_0493980
952 Ga0373937_0511968
953 Ga0373937_0811651
954 Ga0373925_0019292
955 Ga0373925_0104967
956 Ga0436364_0164275
957 Ga0436364_0383313
958 Ga0436364_0639874
959 Ga0436364_0948351
960 Ga0436364_0985460
961 Ga0436365_0565342
962 Ga0436365_0763143
963 Ga0436365_0798017
964 Ga0466966_0053316
965 Ga0466963_0015106
966 Ga0466963_0476911
967 Ga0466957_0423759
968 Ga0466959_0134004
969 Ga0466959_0186961
970 Ga0466967_0191382
971 Ga0495592_0002319
972 Ga0495592_0108843
973 Ga0495592_0455265
974 Ga0495603_0059846
975 Ga0495629_0006843
976 Ga0495629_0033137
977 Ga0495641_0012704
978 Ga0495651_0005002
979 Ga0495651_0010202
980 Ga0495651_0024480
981 Ga0495651_0034086
982 Ga0495651_0057817
983 Ga0495651_0082294
984 Ga0495651_0235889
985 Ga0495651_0317069
986 Ga0495653_0015586
987 Ga0495653_0039447
988 Ga0495653_0085945
989 Ga0495580_0036621
990 Ga0495582_0018197
991 Ga0495582_0036106
992 Ga0495582_0042930
993 Ga0495582_0341294
994 Ga0495639_0003446
995 Ga0495639_0103961
996 Ga0495662_0115187
997 Ga0495662_0182723
998 Ga0495664_0003767
999 Ga0495664_0010788
1000 Ga0495664_0062994
1001 Ga0495664_0093772
1002 Ga0495594_0145343
1003 Ga0495608_0009418
1004 Ga0495608_0028823
1005 Ga0495608_0032818
1006 Ga0495608_0042516
1007 Ga0495608_0141154
1008 Ga0495618_0013573
1009 Ga0495618_0023853
1010 Ga0495618_0080884
1011 Ga0495618_0090995
1012 Ga0495618_0157757
1013 Ga0495628_0013603
1014 Ga0495628_0049167
1015 Ga0495628_0081069
1016 Ga0495628_0113978
1017 Ga0495628_0343761
1018 Ga0495628_0392137
1019 Ga0495630_0065513
1020 Ga0495630_0084352
1021 Ga0495630_0101761
1022 Ga0495666_0004637
1023 Ga0495652_0009200
1024 Ga0495652_0020495
1025 Ga0495652_0096356
1026 Ga0495652_0104973
1027 Ga0495652_0231474
1028 Ga0495652_0272285
1029 Ga0495652_0321157
1030 Ga0495665_0003865
1031 Ga0495665_0005557
1032 Ga0495640_0071402
1033 Ga0495640_0156146
1034 Ga0495640_0238714
1035 Ga0495586_0082362
1036 Ga0495587_0003048
1037 Ga0495587_0013712
1038 Ga0495587_0030681
1039 Ga0495587_0109878
1040 Ga0495587_0178053
1041 Ga0495645_0143863
1042 Ga0495645_0206822
1043 Ga0495645_0340198
1044 Ga0495622_0156511
1045 Ga0495667_0004401
1046 Ga0495667_0010021
1047 Ga0495667_0014321
1048 Ga0495667_0030148
1049 Ga0495667_0042038
1050 Ga0495667_0567337
1051 Ga0495634_0004146
1052 Ga0495634_0032221
1053 Ga0495634_0033672
1054 Ga0495634_0034936
1055 Ga0495635_0002730
1056 Ga0495635_0024656
1057 Ga0495635_0028831
1058 Ga0495635_0198655
1059 Ga0495635_0361928
1060 Ga0495635_0466488
1061 Ga0495657_0024822
1062 Ga0495657_0030067
1063 Ga0495657_0030892
1064 Ga0495657_0035716
1065 Ga0495657_0036298
1066 Ga0495599_0010331
1067 Ga0495599_0033624
1068 Ga0495599_0077838
1069 Ga0495599_0201281
1070 Ga0495623_0010877
1071 Ga0495623_0133302
1072 Ga0495646_0001441
1073 Ga0495646_0090947
1074 Ga0495646_0096078
1075 Ga0495647_0014591
1076 Ga0495647_0017476
1077 Ga0495658_0002453
1078 Ga0495613_0045146
1079 Ga0495613_0185570
1080 Ga0495613_0203494
1081 Ga0495613_0415591
1082 Ga0495624_0010978
1083 Ga0495624_0016597
1084 Ga0495624_0039930
1085 Ga0495624_0207377
1086 Ga0495600_0022859
1087 Ga0495600_0028949
1088 Ga0495600_0067468
1089 Ga0495581_0007790
1090 Ga0495581_0074956
1091 Ga0495581_0233204
1092 Ga0495604_0007103
1093 Ga0495604_0046403
1094 Ga0495604_0139250
1095 Ga0495674_0000403
1096 Ga0495674_0015025
1097 Ga0495674_0018031
1098 Ga0495674_0074647
1099 Ga0495674_0313284
1100 Ga0495676_0027027
1101 Ga0495676_0050072
1102 Ga0495676_0528005
1103 Ga0495680_0006532
1104 Ga0495680_0015758
1105 Ga0495680_0031053
1106 Ga0495680_0040978
1107 Ga0495680_0041109
1108 Ga0495675_0038883
1109 Ga0495675_0092736
1110 Ga0495684_0002595
1111 Ga0495684_0004320
1112 Ga0495684_0031459
1113 Ga0495684_0087225
1114 Ga0495684_0267311
1115 Ga0495593_0018158
1116 Ga0495593_0062100
1117 Ga0495602_0011198
1118 Ga0495602_0047211
1119 Ga0495602_0083577
1120 Ga0495602_0094165
1121 Ga0495602_0104179
1122 Ga0495602_0125193
1123 Ga0495614_0027005
1124 Ga0495614_0068334
1125 Ga0496100_0051167
1126 Ga0496101_0043816
1127 Ga0496101_0216771
1128 Ga0496101_0798697
1129 Ga0496102_0300301
1130 Ga0496103_0011102
1131 Ga0496104_0037316
1132 Ga0496104_0471001
1133 Ga0496105_0053267
1134 Ga0496105_0098501
1135 Ga0496106_0093270
1136 Ga0496106_0414624
1137 Ga0496107_0087151
1138 Ga0496108_0060622
1139 Ga0496108_0121239
1140 Ga0496108_0191264
1141 Ga0496109_0095961
1142 Ga0496110_0015596
1143 Ga0496110_0090411
1144 Ga0496111_0003188
1145 Ga0496111_0080511
1146 Ga0496112_0073631
1147 Ga0496113_0031090
1148 Ga0496113_0107628
1149 Ga0501031_0014897
1150 Ga0501033_0103258
1151 Ga0501036_0036103
1152 Ga0501037_0145679
1153 Ga0501038_0050773
1154 Ga0501039_0019726
1155 Ga0501040_0018730
1156 Ga0501041_0048141
1157 Ga0501042_0022889
1158 Ga0501043_0088199
1159 Ga0501043_0461596
1160 Ga0501046_0098205
1161 Ga0501048_0273373
1162 Ga0501067_0073169
1163 Ga0501068_0111623
1164 Ga0501071_0096290
1165 Ga0501072_0004999
1166 Ga0501074_0014518
1167 Ga0501075_0002237
1168 Ga0501076_0002427
1169 Ga0501077_0006245
1170 Ga0501081_0033327
1171 Ga0501081_0164709
1172 Ga0501083_0082373
1173 Ga0501045_0007477
1174 nmdc:mga05p37_339824_c1
1175 nmdc:mga05p37_527756_c1
1176 nmdc:mga0n895_129762_c1
1177 nmdc:mga0n895_222951_c1
1178 nmdc:mga0n895_778600_c1
1179 nmdc:mga0rr50_360008_c1
1180 nmdc:mga0rr50_90494_c1
1181 nmdc:mga08x19_138663_c1
1182 nmdc:mga08x19_191760_c1
1183 nmdc:mga08x19_310969_c1
1184 nmdc:mga0a205_121098_c1
1185 nmdc:mga0a205_134658_c1
1186 Ga0495601_0126540
1187 Ga0495612_0082626
1188 Ga0495595_0008316
1189 Ga0495595_0040302
1190 Ga0495595_0113291
1191 Ga0495619_0015828
1192 Ga0495619_0299983
1193 Ga0500600_0063615
1194 Ga0501084_0014946
1195 Ga0466962_0017182
1196 Ga0530510_0010751
1197 2501942927
1198 2516083592
1199 2516089523
1200 2552107859
1201 2623586259
1202 2753038686
1203 2753327198
1204 2772641435
1205 2831937233
1206 2832010637
1207 2855676589
1208 2855683362
1209 2855685095
1210 2856860136
1211 2857292778
1212 2858852186
1213 2858870123
1214 2858888297
1215 2858892007
1216 2858899056
1217 2858905384
1218 2866071199
1219 2867304225
1220 2867313553
1221 2867322624
1222 2867509162
1223 2869064863
1224 2869073783
1225 2880494014
1226 2880498318
1227 2899377047
1228 2902587386
1229 2917744286
1230 2929220358
1231 2929226907
1232 649810619
1233 8003834612
1234 8003877214
1235 8054710037
1236 8054728247
1237 8054735362
1238 8055413724

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13419

HAD_2

Haloacid dehalogenase-like hydrolase

20

186

0.94

PF00702

Hydrolase

haloacid dehalogenase-like hydrolase

77

180

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
4uas-assembly2.cif.gz_B crystal structure of cbby from rhodobacter sphaeroides in complex with phosphate 0.8738 1 214
4uau-assembly2.cif.gz_B crystal structure of cbby (mutant d10n) from rhodobacter sphaeroides in complex with xylulose-(1,5)bisphosphate, crystal form ii 0.8724 1 213
7ocs-assembly1.cif.gz_D mannitol-1-phosphate bound to the phosphatase domain of the bifunctional mannitol-1-phosphate dehydrogenase/phosphatase mtld-d16a from acinetobacter baumannii 0.8608 2 207
4uas-assembly2.cif.gz_B crystal structure of cbby from rhodobacter sphaeroides in complex with phosphate 0.8589 1 214
1te2-assembly1.cif.gz_A putative phosphatase ynic from escherichia coli k12 0.8585 2 213
ID Description Score Start End Superfamily
af_P32662_111_227_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9567 87 183 3.40.50.1000
3e58A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9284 2 207 3.40.50.1000
1te2B01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9102 85 213 3.40.50.1000
af_Q84MD8_87_222_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9073 81 208 3.40.50.1000
af_Q9VQ01_41_108_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9056 19 78 3.40.50.1000
ID Description Score Start End GO Terms
AF-A0A538C598-F1-model_v4 HAD family hydrolase 0.9977 85 215 GO:0016787
AF-A0A7X6L5U3-F1-model_v4 HAD family phosphatase 0.9942 2 213
AF-A0A3N2PHD3-F1-model_v4 HAD family hydrolase 0.9909 1 213 GO:0016787
AF-W4A2B8-F1-model_v4 deleted 0.9882 2 215
AF-A0A4R5BV01-F1-model_v4 HAD family phosphatase 0.9857 2 189

Map