F469855
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 619 | 304 | 1238 | 218 |
Family's Representative Sequence
| Representative Sequence | 3300048913|Ga0496110_0366677|Ga0496110_0366677_161_856 |
| Length | 219 |
| Sequence | MIRLGGGNRPAGRWRMIEAVVFDLDGVLVDSEPVWEQVRRQVVADYGGHWLPDAQQRLMGMSTGEWARYLSQDLGIGLPPPTVAAAVIERMQARYREGVPLMPSPLGLASSSPPVLIGAVLDGAGLRECFTATLSTEQVSRGKPAPDIYLAVTDLLGFPPQACAAVEDSTNGLRSAAAAGLQVIAVPHPRYPPEPAALRAARLVLTGLAELTVQAVAEL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 2 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 3 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 5 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 6 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 8 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 9 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 11 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 17 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 19 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 20 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 25 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 31 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 33 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 37 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 39 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 40 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 41 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 42 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 43 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 44 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 45 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 46 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 47 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 48 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 49 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 50 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 51 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 52 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 54 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 55 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 57 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 58 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 59 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 60 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 61 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 62 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 64 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300012515 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 | Metagenome | Rhizosphere |
| 76 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 89 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 90 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 91 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 92 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 129 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 130 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 131 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 132 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 133 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 134 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 135 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 136 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 137 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 138 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 139 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 140 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 141 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 142 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 143 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 144 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 145 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 146 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 147 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 148 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 149 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 150 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 151 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 152 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 153 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 154 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 155 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 156 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 157 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 158 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 159 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 160 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 161 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 162 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 163 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 164 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 165 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 166 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 167 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 168 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 215 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 216 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 217 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 218 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 219 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 220 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 221 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 222 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 223 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 224 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 225 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 226 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 227 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 228 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 229 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 230 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 231 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 232 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 233 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 234 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 235 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 236 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 237 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 238 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 239 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 240 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 241 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 242 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 243 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 244 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 245 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 246 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 247 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 248 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 249 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 250 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 251 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 252 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 253 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 254 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 255 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300053149 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere | Metagenome | Endosphere |
| 260 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 261 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 262 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 263 | 2501939600 | Micromonospora sp. L5 | Isolate | Unclassified |
| 264 | 2515154202 | Salinispora pacifica CNT084 | Isolate | Rhizosphere |
| 265 | 2515154203 | Salinispora arenicola CNR921 | Isolate | Rhizosphere |
| 266 | 2551306166 | Nocardia tenerifensis NBRC 101015 | Isolate | Rhizosphere |
| 267 | 2622736626 | Micromonospora rhizosphaerae DSM 45431 | Isolate | Rhizosphere |
| 268 | 2751185725 | Microbispora sp. NRRL B-24597 | Isolate | Unclassified |
| 269 | 2751185792 | Kitasatospora arboriphila NRRL B-24581 | Isolate | Unclassified |
| 270 | 2772190715 | Micromonospora chokoriensis NRRL B-24750 | Isolate | Unclassified |
| 271 | 2831935698 | Jishengella sp. AZ1-13 | Isolate | Unclassified |
| 272 | 2832004796 | Micromonospora endophytica JCM 18317 | Isolate | Unclassified |
| 273 | 2855670206 | Micromonospora noduli Lupac 07 | Isolate | Nodule |
| 274 | 2855676851 | Micromonospora saelicesensis GAR05 | Isolate | Unclassified |
| 275 | 2855683550 | Micromonospora sp. RP3T | Isolate | Unclassified |
| 276 | 2856858025 | Micromonospora aurantiaca 110B(2018) | Isolate | Unclassified |
| 277 | 2857288857 | Micromonospora noduli ONO23 | Isolate | Unclassified |
| 278 | 2858848962 | Micromonospora saelicesensis GAR06 | Isolate | Unclassified |
| 279 | 2858868258 | Micromonospora sp. MH33 | Isolate | Unclassified |
| 280 | 2858882152 | Micromonospora noduli MED15 | Isolate | Nodule |
| 281 | 2858888857 | Micromonospora saelicesensis Lupac 06 | Isolate | Unclassified |
| 282 | 2858895516 | Micromonospora saelicesensis PSN13 | Isolate | Unclassified |
| 283 | 2858902515 | Micromonospora sp. MW-13 | Isolate | Rhizosphere |
| 284 | 2866065130 | Micromonospora endophytica DSM 45430 | Isolate | Unclassified |
| 285 | 2867302475 | Micromonospora globbae WPS1-2 | Isolate | Unclassified |
| 286 | 2867312974 | Micromonospora musae NGC1-4 | Isolate | Unclassified |
| 287 | 2867319477 | Micromonospora musae MS1-9 | Isolate | Unclassified |
| 288 | 2867507094 | Micromonospora zingiberis PLAI 1-1 | Isolate | Unclassified |
| 289 | 2869061728 | Micromonospora noduli ONO86 | Isolate | Unclassified |
| 290 | 2869068681 | Micromonospora noduli GUI43 | Isolate | Unclassified |
| 291 | 2880489317 | Micromonospora ureilytica DSM 101692 | Isolate | Unclassified |
| 292 | 2880495981 | Micromonospora vinacea DSM 101695 | Isolate | Unclassified |
| 293 | 2899370129 | Amycolatopsis alkalitolerans SYSUP0005 | Isolate | Stem Tuber |
| 294 | 2902582711 | Micromonospora sp. AP08 | Isolate | Unclassified |
| 295 | 2917736166 | Amycolatopsis dendrobii DR6-1 | Isolate | Unclassified |
| 296 | 2929219909 | Micromonospora sp. R-75348 Hybrid assembly | Isolate | Unclassified |
| 297 | 2929226422 | Micromonospora sp. R-74116 Hybrid assembly | Isolate | Unclassified |
| 298 | 649633069 | Micromonospora sp. L5 | Isolate | Unclassified |
| 299 | 8003830390 | Micromonospora parastrephiae STR1_7 | Isolate | Rhizosphere |
| 300 | 8003870546 | Micromonospora tarensis STR1s_6 | Isolate | Rhizosphere |
| 301 | 8054704163 | Micromonospora trifolii NIE79 | Isolate | Nodule |
| 302 | 8054727385 | Micromonospora alfalfae MED01 | Isolate | Nodule |
| 303 | 8054734606 | Micromonospora hortensis NIE111 | Isolate | Nodule |
| 304 | 8055412473 | Micromonospora phytophila DSM 105363 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 92.73 |
| Metatranscriptomes | 0.48 |
| Isolates | 6.79 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.16 |
| Nodule | 0.97 |
| Rhizoplane | 4.04 |
| Rhizosphere | 87.72 |
| Stem | 0 |
| Stem Tuber | 0.16 |
| Unclassified | 0.65 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0496110_0366677 | 3300048913 | Bacteria | 1312 |
| 2 | JGI25404J52841_10019753 | 3300003659 | Bacteria | 1460 |
| 3 | Ga0070658_10042883 | 3300005327 | Bacteria | 3655 |
| 4 | Ga0070683_100040810 | 3300005329 | Bacteria | 4267 |
| 5 | Ga0070683_100441160 | 3300005329 | Bacteria | 1242 |
| 6 | Ga0068869_100085738 | 3300005334 | Bacteria | 2359 |
| 7 | Ga0070666_10134127 | 3300005335 | Bacteria | 1722 |
| 8 | Ga0070680_100035326 | 3300005336 | Bacteria | 4034 |
| 9 | Ga0068868_100109012 | 3300005338 | Bacteria | 2248 |
| 10 | Ga0068868_100275180 | 3300005338 | Bacteria | 1423 |
| 11 | Ga0070660_100195973 | 3300005339 | Bacteria | 1637 |
| 12 | Ga0070692_10027927 | 3300005345 | Bacteria | 2801 |
| 13 | Ga0070668_100653798 | 3300005347 | Bacteria | 924 |
| 14 | Ga0070671_100016031 | 3300005355 | Bacteria | 6055 |
| 15 | Ga0070673_100032580 | 3300005364 | Bacteria | 3926 |
| 16 | Ga0070659_100135619 | 3300005366 | Bacteria | 2001 |
| 17 | Ga0070667_100079838 | 3300005367 | Bacteria | 2798 |
| 18 | Ga0070709_10000377 | 3300005434 | Bacteria | 27511 |
| 19 | Ga0070709_10001437 | 3300005434 | Bacteria | 12862 |
| 20 | Ga0070709_10466808 | 3300005434 | Bacteria | 953 |
| 21 | Ga0070714_100001403 | 3300005435 | Bacteria | 17466 |
| 22 | Ga0070714_100003191 | 3300005435 | Bacteria | 12190 |
| 23 | Ga0070714_100022881 | 3300005435 | Bacteria | 5128 |
| 24 | Ga0070714_100301659 | 3300005435 | Bacteria | 1493 |
| 25 | Ga0070714_100498082 | 3300005435 | Bacteria | 1162 |
| 26 | Ga0070714_100645490 | 3300005435 | Bacteria | 1019 |
| 27 | Ga0070714_100697174 | 3300005435 | Bacteria | 980 |
| 28 | Ga0070714_101022404 | 3300005435 | Bacteria | 804 |
| 29 | Ga0070713_100002255 | 3300005436 | Bacteria | 12518 |
| 30 | Ga0070713_100005307 | 3300005436 | Bacteria | 8790 |
| 31 | Ga0070713_100030209 | 3300005436 | Bacteria | 4301 |
| 32 | Ga0070713_100094642 | 3300005436 | Bacteria | 2576 |
| 33 | Ga0070713_100294537 | 3300005436 | Bacteria | 1492 |
| 34 | Ga0070710_10000960 | 3300005437 | Bacteria | 13669 |
| 35 | Ga0070710_10100683 | 3300005437 | Bacteria | 1720 |
| 36 | Ga0070711_100006736 | 3300005439 | Bacteria | 6951 |
| 37 | Ga0070711_100223277 | 3300005439 | Bacteria | 1465 |
| 38 | Ga0070705_100466684 | 3300005440 | Bacteria | 951 |
| 39 | Ga0070708_100015482 | 3300005445 | Bacteria | 6302 |
| 40 | Ga0070708_100117474 | 3300005445 | Bacteria | 2450 |
| 41 | Ga0070708_100367159 | 3300005445 | Bacteria | 1357 |
| 42 | Ga0070708_100370778 | 3300005445 | Bacteria | 1350 |
| 43 | Ga0070708_100468432 | 3300005445 | Bacteria | 1189 |
| 44 | Ga0070708_100734967 | 3300005445 | Bacteria | 928 |
| 45 | Ga0070663_100011727 | 3300005455 | Bacteria | 5514 |
| 46 | Ga0070681_10137691 | 3300005458 | Bacteria | 2371 |
| 47 | Ga0070685_10031523 | 3300005466 | Bacteria | 2963 |
| 48 | Ga0070706_100004766 | 3300005467 | Bacteria | 13009 |
| 49 | Ga0070706_100025838 | 3300005467 | Bacteria | 5404 |
| 50 | Ga0070706_100119383 | 3300005467 | Bacteria | 2457 |
| 51 | Ga0070706_100241452 | 3300005467 | Bacteria | 1687 |
| 52 | Ga0070707_100000012 | 3300005468 | Bacteria | 157939 |
| 53 | Ga0070707_100002570 | 3300005468 | Bacteria | 17244 |
| 54 | Ga0070707_100025483 | 3300005468 | Bacteria | 5610 |
| 55 | Ga0070707_100232669 | 3300005468 | Bacteria | 1793 |
| 56 | Ga0070707_100399434 | 3300005468 | Bacteria | 1334 |
| 57 | Ga0070707_100543102 | 3300005468 | Bacteria | 1124 |
| 58 | Ga0070698_100000317 | 3300005471 | Bacteria | 49042 |
| 59 | Ga0070698_100001877 | 3300005471 | Bacteria | 23416 |
| 60 | Ga0070698_100022586 | 3300005471 | Bacteria | 6581 |
| 61 | Ga0070698_100316028 | 3300005471 | Bacteria | 1492 |
| 62 | Ga0070698_100527392 | 3300005471 | Bacteria | 1119 |
| 63 | Ga0070699_100000802 | 3300005518 | Bacteria | 28996 |
| 64 | Ga0070699_100023429 | 3300005518 | Bacteria | 5318 |
| 65 | Ga0070699_100497942 | 3300005518 | Bacteria | 1107 |
| 66 | Ga0070684_100010631 | 3300005535 | Bacteria | 7298 |
| 67 | Ga0070684_100184747 | 3300005535 | Bacteria | 1896 |
| 68 | Ga0070684_100239396 | 3300005535 | Bacteria | 1658 |
| 69 | Ga0070684_100249600 | 3300005535 | Bacteria | 1622 |
| 70 | Ga0070697_100002709 | 3300005536 | Bacteria | 13648 |
| 71 | Ga0070697_100023607 | 3300005536 | Bacteria | 4891 |
| 72 | Ga0070697_100058263 | 3300005536 | Bacteria | 3143 |
| 73 | Ga0070686_100322144 | 3300005544 | Bacteria | 1153 |
| 74 | Ga0070695_100010689 | 3300005545 | Bacteria | 5484 |
| 75 | Ga0070696_100026907 | 3300005546 | Bacteria | 3915 |
| 76 | Ga0070696_100134435 | 3300005546 | Bacteria | 1802 |
| 77 | Ga0070665_100152024 | 3300005548 | Bacteria | 2317 |
| 78 | Ga0068855_100111239 | 3300005563 | Bacteria | 3144 |
| 79 | Ga0068855_100320332 | 3300005563 | Bacteria | 1714 |
| 80 | Ga0070664_100093423 | 3300005564 | Bacteria | 2606 |
| 81 | Ga0068857_100044927 | 3300005577 | Bacteria | 3918 |
| 82 | Ga0068854_100006602 | 3300005578 | Bacteria | 7389 |
| 83 | Ga0068856_100712915 | 3300005614 | Bacteria | 1023 |
| 84 | Ga0068852_100061116 | 3300005616 | Bacteria | 3273 |
| 85 | Ga0068859_100026997 | 3300005617 | Bacteria | 5760 |
| 86 | Ga0068859_100632629 | 3300005617 | Bacteria | 1162 |
| 87 | Ga0068859_101123954 | 3300005617 | Bacteria | 864 |
| 88 | Ga0068864_100023306 | 3300005618 | Bacteria | 5197 |
| 89 | Ga0068864_100137355 | 3300005618 | Bacteria | 2202 |
| 90 | Ga0068864_100547804 | 3300005618 | Bacteria | 1118 |
| 91 | Ga0068861_100205303 | 3300005719 | Bacteria | 1657 |
| 92 | Ga0068870_10016058 | 3300005840 | Bacteria | 3568 |
| 93 | Ga0068863_100086765 | 3300005841 | Bacteria | 2965 |
| 94 | Ga0068858_100094952 | 3300005842 | Bacteria | 2778 |
| 95 | Ga0068860_100214551 | 3300005843 | Bacteria | 1867 |
| 96 | Ga0068860_100640846 | 3300005843 | Bacteria | 1070 |
| 97 | Ga0068862_100057582 | 3300005844 | Bacteria | 3333 |
| 98 | Ga0081540_1000154 | 3300005983 | Bacteria | 70679 |
| 99 | Ga0081540_1000654 | 3300005983 | Bacteria | 32728 |
| 100 | Ga0081539_10000569 | 3300005985 | Bacteria | 76165 |
| 101 | Ga0081539_10108138 | 3300005985 | Bacteria | 1405 |
| 102 | Ga0070717_10004786 | 3300006028 | Bacteria | 9845 |
| 103 | Ga0070717_10017512 | 3300006028 | Bacteria | 5576 |
| 104 | Ga0070717_10021291 | 3300006028 | Bacteria | 5107 |
| 105 | Ga0070717_10035009 | 3300006028 | Bacteria | 4062 |
| 106 | Ga0070717_10053253 | 3300006028 | Bacteria | 3335 |
| 107 | Ga0070717_10056555 | 3300006028 | Bacteria | 3241 |
| 108 | Ga0070717_10104482 | 3300006028 | Bacteria | 2409 |
| 109 | Ga0070717_10156704 | 3300006028 | Bacteria | 1973 |
| 110 | Ga0070717_10254412 | 3300006028 | Bacteria | 1552 |
| 111 | Ga0070717_10346890 | 3300006028 | Bacteria | 1327 |
| 112 | Ga0070717_10353310 | 3300006028 | Bacteria | 1314 |
| 113 | Ga0070717_10409142 | 3300006028 | Bacteria | 1219 |
| 114 | Ga0070717_10467045 | 3300006028 | Bacteria | 1138 |
| 115 | Ga0075432_10019651 | 3300006058 | Bacteria | 2309 |
| 116 | Ga0070715_10033721 | 3300006163 | Bacteria | 2094 |
| 117 | Ga0070716_100000082 | 3300006173 | Bacteria | 37745 |
| 118 | Ga0070716_100003183 | 3300006173 | Bacteria | 7691 |
| 119 | Ga0070716_100131501 | 3300006173 | Bacteria | 1583 |
| 120 | Ga0070716_100717325 | 3300006173 | Bacteria | 766 |
| 121 | Ga0070712_100002122 | 3300006175 | Bacteria | 12193 |
| 122 | Ga0070712_100029384 | 3300006175 | Bacteria | 3683 |
| 123 | Ga0070712_100114882 | 3300006175 | Bacteria | 2016 |
| 124 | Ga0070712_100424537 | 3300006175 | Bacteria | 1102 |
| 125 | Ga0070712_100456804 | 3300006175 | Bacteria | 1064 |
| 126 | Ga0070712_100677968 | 3300006175 | Unclassified | 877 |
| 127 | Ga0068871_100034582 | 3300006358 | Bacteria | 4011 |
| 128 | Ga0068871_100059663 | 3300006358 | Bacteria | 3109 |
| 129 | Ga0075428_100551656 | 3300006844 | Bacteria | 1232 |
| 130 | Ga0075428_101080244 | 3300006844 | Bacteria | 848 |
| 131 | Ga0075433_10072883 | 3300006852 | Bacteria | 3020 |
| 132 | Ga0075433_10201437 | 3300006852 | Bacteria | 1770 |
| 133 | Ga0075434_100277042 | 3300006871 | Bacteria | 1697 |
| 134 | Ga0075434_100463421 | 3300006871 | Bacteria | 1288 |
| 135 | Ga0075434_100933127 | 3300006871 | Bacteria | 882 |
| 136 | Ga0075436_100114954 | 3300006914 | Bacteria | 1879 |
| 137 | Ga0075436_100147910 | 3300006914 | Bacteria | 1652 |
| 138 | Ga0075436_100239575 | 3300006914 | Bacteria | 1290 |
| 139 | Ga0097620_100026996 | 3300006931 | Bacteria | 5760 |
| 140 | Ga0097620_100632653 | 3300006931 | Bacteria | 1162 |
| 141 | Ga0097620_101123911 | 3300006931 | Bacteria | 864 |
| 142 | Ga0075435_100460078 | 3300007076 | Bacteria | 1097 |
| 143 | Ga0075435_100486054 | 3300007076 | Bacteria | 1067 |
| 144 | Ga0105251_10141442 | 3300009011 | Bacteria | 1089 |
| 145 | Ga0105240_10232703 | 3300009093 | Bacteria | 2140 |
| 146 | Ga0111539_10024102 | 3300009094 | Bacteria | 7473 |
| 147 | Ga0111539_10463466 | 3300009094 | Bacteria | 1476 |
| 148 | Ga0105247_10522090 | 3300009101 | Bacteria | 869 |
| 149 | Ga0114129_10389529 | 3300009147 | Bacteria | 1838 |
| 150 | Ga0114129_10653332 | 3300009147 | Bacteria | 1357 |
| 151 | Ga0105241_10028261 | 3300009174 | Bacteria | 4179 |
| 152 | Ga0105242_10075348 | 3300009176 | Bacteria | 2809 |
| 153 | Ga0105248_10146133 | 3300009177 | Bacteria | 2668 |
| 154 | Ga0105248_10347733 | 3300009177 | Bacteria | 1669 |
| 155 | Ga0105249_10182458 | 3300009553 | Bacteria | 2043 |
| 156 | Ga0105239_10829298 | 3300010375 | Bacteria | 1060 |
| 157 | Ga0105239_10884522 | 3300010375 | Bacteria | 1025 |
| 158 | Ga0105246_10275541 | 3300011119 | Bacteria | 1347 |
| 159 | Ga0157338_1008103 | 3300012515 | Bacteria | 1011 |
| 160 | Ga0157373_10319533 | 3300013100 | Bacteria | 1104 |
| 161 | Ga0157371_10048358 | 3300013102 | Bacteria | 3023 |
| 162 | Ga0157370_10721680 | 3300013104 | Bacteria | 909 |
| 163 | Ga0157369_10239857 | 3300013105 | Bacteria | 1894 |
| 164 | Ga0157369_10444412 | 3300013105 | Bacteria | 1343 |
| 165 | Ga0157369_11332322 | 3300013105 | Bacteria | 731 |
| 166 | Ga0157374_10056601 | 3300013296 | Bacteria | 3662 |
| 167 | Ga0157374_10104637 | 3300013296 | Bacteria | 2717 |
| 168 | Ga0157374_10279001 | 3300013296 | Bacteria | 1649 |
| 169 | Ga0163162_10166372 | 3300013306 | Bacteria | 2329 |
| 170 | Ga0163162_10984738 | 3300013306 | Bacteria | 953 |
| 171 | Ga0157372_10418230 | 3300013307 | Bacteria | 1562 |
| 172 | Ga0157375_10175068 | 3300013308 | Bacteria | 2295 |
| 173 | Ga0163163_10134285 | 3300014325 | Bacteria | 2515 |
| 174 | Ga0163163_10440369 | 3300014325 | Bacteria | 1363 |
| 175 | Ga0157377_10744282 | 3300014745 | Bacteria | 717 |
| 176 | Ga0157379_10838265 | 3300014968 | Bacteria | 869 |
| 177 | Ga0157376_10712972 | 3300014969 | Bacteria | 1009 |
| 178 | Ga0206354_11602563 | 3300020081 | Bacteria | 2420 |
| 179 | Ga0206354_11699213 | 3300020081 | Bacteria | 3132 |
| 180 | Ga0206353_10027828 | 3300020082 | Bacteria | 2482 |
| 181 | Ga0213876_10089356 | 3300021384 | Bacteria | 1632 |
| 182 | Ga0213875_10000681 | 3300021388 | Bacteria | 26594 |
| 183 | Ga0213875_10002771 | 3300021388 | Bacteria | 10347 |
| 184 | Ga0213875_10004024 | 3300021388 | Bacteria | 8182 |
| 185 | Ga0213875_10097354 | 3300021388 | Bacteria | 1372 |
| 186 | Ga0207692_10009001 | 3300025898 | Bacteria | 4156 |
| 187 | Ga0207692_10040456 | 3300025898 | Bacteria | 2300 |
| 188 | Ga0207692_10216412 | 3300025898 | Bacteria | 1133 |
| 189 | Ga0207647_10054319 | 3300025904 | Bacteria | 2465 |
| 190 | Ga0207685_10010613 | 3300025905 | Bacteria | 2729 |
| 191 | Ga0207699_10001206 | 3300025906 | Bacteria | 12253 |
| 192 | Ga0207699_10005097 | 3300025906 | Bacteria | 6287 |
| 193 | Ga0207699_10024834 | 3300025906 | Bacteria | 3282 |
| 194 | Ga0207699_10391386 | 3300025906 | Bacteria | 988 |
| 195 | Ga0207643_10004276 | 3300025908 | Bacteria | 7684 |
| 196 | Ga0207705_10207770 | 3300025909 | Bacteria | 1485 |
| 197 | Ga0207684_10001996 | 3300025910 | Bacteria | 21029 |
| 198 | Ga0207684_10022938 | 3300025910 | Bacteria | 5330 |
| 199 | Ga0207684_10024939 | 3300025910 | Bacteria | 5096 |
| 200 | Ga0207693_10005985 | 3300025915 | Bacteria | 10085 |
| 201 | Ga0207693_10009464 | 3300025915 | Bacteria | 7936 |
| 202 | Ga0207693_10034273 | 3300025915 | Bacteria | 4006 |
| 203 | Ga0207693_10188221 | 3300025915 | Bacteria | 1625 |
| 204 | Ga0207693_10278448 | 3300025915 | Bacteria | 1311 |
| 205 | Ga0207693_10290517 | 3300025915 | Bacteria | 1281 |
| 206 | Ga0207663_10004078 | 3300025916 | Bacteria | 7245 |
| 207 | Ga0207663_10016037 | 3300025916 | Bacteria | 4146 |
| 208 | Ga0207663_10029399 | 3300025916 | Bacteria | 3227 |
| 209 | Ga0207663_10117019 | 3300025916 | Bacteria | 1818 |
| 210 | Ga0207663_10634061 | 3300025916 | Bacteria | 842 |
| 211 | Ga0207660_10773849 | 3300025917 | Bacteria | 783 |
| 212 | Ga0207657_10001989 | 3300025919 | Bacteria | 22083 |
| 213 | Ga0207649_10099579 | 3300025920 | Bacteria | 1921 |
| 214 | Ga0207646_10000058 | 3300025922 | Bacteria | 158096 |
| 215 | Ga0207646_10003165 | 3300025922 | Bacteria | 18843 |
| 216 | Ga0207646_10234378 | 3300025922 | Bacteria | 1658 |
| 217 | Ga0207646_10285292 | 3300025922 | Bacteria | 1492 |
| 218 | Ga0207681_10124946 | 3300025923 | Bacteria | 1893 |
| 219 | Ga0207700_10000879 | 3300025928 | Bacteria | 17301 |
| 220 | Ga0207700_10008071 | 3300025928 | Bacteria | 6493 |
| 221 | Ga0207700_10021499 | 3300025928 | Bacteria | 4407 |
| 222 | Ga0207700_10027302 | 3300025928 | Bacteria | 3995 |
| 223 | Ga0207700_10053249 | 3300025928 | Bacteria | 3031 |
| 224 | Ga0207700_10073050 | 3300025928 | Bacteria | 2647 |
| 225 | Ga0207700_10092417 | 3300025928 | Bacteria | 2392 |
| 226 | Ga0207700_10141041 | 3300025928 | Bacteria | 1980 |
| 227 | Ga0207664_10036106 | 3300025929 | Bacteria | 3818 |
| 228 | Ga0207664_10046281 | 3300025929 | Bacteria | 3414 |
| 229 | Ga0207664_10086623 | 3300025929 | Bacteria | 2559 |
| 230 | Ga0207664_10227769 | 3300025929 | Bacteria | 1619 |
| 231 | Ga0207664_10613514 | 3300025929 | Bacteria | 977 |
| 232 | Ga0207644_10671008 | 3300025931 | Bacteria | 863 |
| 233 | Ga0207706_10111917 | 3300025933 | Bacteria | 2402 |
| 234 | Ga0207665_10000100 | 3300025939 | Bacteria | 55652 |
| 235 | Ga0207665_10002003 | 3300025939 | Bacteria | 13735 |
| 236 | Ga0207665_10020493 | 3300025939 | Bacteria | 4345 |
| 237 | Ga0207665_10025717 | 3300025939 | Bacteria | 3884 |
| 238 | Ga0207665_10049546 | 3300025939 | Bacteria | 2823 |
| 239 | Ga0207665_10065580 | 3300025939 | Bacteria | 2469 |
| 240 | Ga0207665_10106525 | 3300025939 | Bacteria | 1965 |
| 241 | Ga0207691_10036545 | 3300025940 | Bacteria | 4552 |
| 242 | Ga0207711_10110031 | 3300025941 | Bacteria | 2449 |
| 243 | Ga0207689_10002863 | 3300025942 | Bacteria | 15908 |
| 244 | Ga0207679_10198962 | 3300025945 | Bacteria | 1672 |
| 245 | Ga0207651_10043218 | 3300025960 | Bacteria | 3006 |
| 246 | Ga0207668_10001173 | 3300025972 | Bacteria | 15556 |
| 247 | Ga0207658_10173851 | 3300025986 | Bacteria | 1777 |
| 248 | Ga0207677_10410126 | 3300026023 | Bacteria | 1151 |
| 249 | Ga0207639_10025965 | 3300026041 | Bacteria | 4252 |
| 250 | Ga0207678_10002393 | 3300026067 | Bacteria | 17038 |
| 251 | Ga0207702_10072520 | 3300026078 | Bacteria | 2968 |
| 252 | Ga0207702_10232883 | 3300026078 | Bacteria | 1722 |
| 253 | Ga0207702_10495483 | 3300026078 | Bacteria | 1190 |
| 254 | Ga0207641_10033799 | 3300026088 | Bacteria | 4249 |
| 255 | Ga0207641_10969018 | 3300026088 | Bacteria | 846 |
| 256 | Ga0207648_10053154 | 3300026089 | Bacteria | 3541 |
| 257 | Ga0207676_10055386 | 3300026095 | Bacteria | 3113 |
| 258 | Ga0207676_10446624 | 3300026095 | Bacteria | 1218 |
| 259 | Ga0207674_10027339 | 3300026116 | Bacteria | 6037 |
| 260 | Ga0207683_10006866 | 3300026121 | Bacteria | 9748 |
| 261 | Ga0268265_10180034 | 3300028380 | Bacteria | 1815 |
| 262 | Ga0307513_10021345 | 3300031456 | Bacteria | 7646 |
| 263 | Ga0307513_10620006 | 3300031456 | Bacteria | 790 |
| 264 | Ga0307406_10051227 | 3300031901 | Bacteria | 2620 |
| 265 | Ga0307407_10335337 | 3300031903 | Bacteria | 1066 |
| 266 | Ga0307412_10048648 | 3300031911 | Bacteria | 2790 |
| 267 | Ga0307416_100226804 | 3300032002 | Bacteria | 1797 |
| 268 | Ga0307415_100087546 | 3300032126 | Bacteria | 2244 |
| 269 | Ga0307415_100315609 | 3300032126 | Bacteria | 1301 |
| 270 | Ga0373926_0001345 | 3300035083 | Bacteria | 7432 |
| 271 | Ga0373926_0001517 | 3300035083 | Bacteria | 7112 |
| 272 | Ga0373926_0088851 | 3300035083 | Bacteria | 1148 |
| 273 | Ga0373928_0067084 | 3300035084 | Bacteria | 879 |
| 274 | Ga0373928_0085136 | 3300035084 | Bacteria | 803 |
| 275 | Ga0373934_0151629 | 3300035086 | Bacteria | 949 |
| 276 | Ga0373944_0005963 | 3300035089 | Bacteria | 3224 |
| 277 | Ga0373944_0011357 | 3300035089 | Bacteria | 2439 |
| 278 | Ga0373952_0005014 | 3300035092 | Bacteria | 2411 |
| 279 | Ga0373923_0001225 | 3300035111 | Bacteria | 7193 |
| 280 | Ga0373923_0024095 | 3300035111 | Bacteria | 2400 |
| 281 | Ga0373936_0000553 | 3300035113 | Bacteria | 12848 |
| 282 | Ga0373936_0001326 | 3300035113 | Bacteria | 8968 |
| 283 | Ga0373936_0007690 | 3300035113 | Bacteria | 4046 |
| 284 | Ga0373936_0038643 | 3300035113 | Bacteria | 1909 |
| 285 | Ga0373936_0081088 | 3300035113 | Bacteria | 1351 |
| 286 | Ga0373939_0226362 | 3300035114 | Bacteria | 718 |
| 287 | Ga0373941_0084923 | 3300035115 | Bacteria | 1076 |
| 288 | Ga0373945_0000015 | 3300035116 | Bacteria | 35837 |
| 289 | Ga0373953_0007380 | 3300035117 | Bacteria | 3679 |
| 290 | Ga0373953_0036395 | 3300035117 | Bacteria | 1939 |
| 291 | Ga0373953_0123433 | 3300035117 | Bacteria | 1101 |
| 292 | Ga0373954_0000568 | 3300035118 | Bacteria | 13931 |
| 293 | Ga0373954_0006956 | 3300035118 | Bacteria | 4938 |
| 294 | Ga0373954_0075425 | 3300035118 | Bacteria | 1606 |
| 295 | Ga0373954_0100778 | 3300035118 | Bacteria | 1393 |
| 296 | Ga0373956_0002170 | 3300035119 | Bacteria | 8107 |
| 297 | Ga0373956_0011359 | 3300035119 | Bacteria | 3667 |
| 298 | Ga0373956_0022286 | 3300035119 | Bacteria | 2709 |
| 299 | Ga0373956_0032488 | 3300035119 | Bacteria | 2290 |
| 300 | Ga0373957_0005009 | 3300035120 | Bacteria | 4084 |
| 301 | Ga0373957_0012632 | 3300035120 | Bacteria | 2848 |
| 302 | Ga0373960_0004087 | 3300035121 | Bacteria | 3336 |
| 303 | Ga0373943_0001056 | 3300035170 | Bacteria | 12228 |
| 304 | Ga0373943_0004233 | 3300035170 | Bacteria | 6505 |
| 305 | Ga0373943_0195019 | 3300035170 | Bacteria | 1119 |
| 306 | Ga0373946_0002791 | 3300035171 | Bacteria | 6179 |
| 307 | Ga0373946_0005159 | 3300035171 | Bacteria | 4708 |
| 308 | Ga0373955_0004101 | 3300035172 | Bacteria | 6431 |
| 309 | Ga0373955_0079156 | 3300035172 | Bacteria | 1853 |
| 310 | Ga0373955_0089674 | 3300035172 | Bacteria | 1750 |
| 311 | Ga0373955_0148474 | 3300035172 | Bacteria | 1378 |
| 312 | Ga0373955_0268783 | 3300035172 | Bacteria | 1024 |
| 313 | Ga0373942_0004643 | 3300035207 | Bacteria | 3183 |
| 314 | Ga0373961_0078588 | 3300035241 | Bacteria | 1034 |
| 315 | Ga0373924_0031932 | 3300035410 | Bacteria | 2119 |
| 316 | Ga0373924_0057811 | 3300035410 | Bacteria | 1618 |
| 317 | Ga0373924_0144727 | 3300035410 | Bacteria | 1038 |
| 318 | Ga0373935_0008136 | 3300035692 | Bacteria | 6287 |
| 319 | Ga0373927_0027852 | 3300035695 | Bacteria | 3689 |
| 320 | Ga0373927_0230585 | 3300035695 | Bacteria | 1217 |
| 321 | Ga0373933_0011954 | 3300035724 | Bacteria | 4792 |
| 322 | Ga0373933_0013670 | 3300035724 | Bacteria | 4502 |
| 323 | Ga0373933_0022076 | 3300035724 | Bacteria | 3622 |
| 324 | Ga0373933_0203743 | 3300035724 | Bacteria | 1266 |
| 325 | Ga0373947_0000429 | 3300035725 | Bacteria | 23848 |
| 326 | Ga0373947_0252011 | 3300035725 | Unclassified | 1168 |
| 327 | Ga0373937_0013957 | 3300036401 | Bacteria | 7082 |
| 328 | Ga0373937_0047483 | 3300036401 | Bacteria | 3928 |
| 329 | Ga0373937_0231956 | 3300036401 | Bacteria | 1738 |
| 330 | Ga0373937_0266994 | 3300036401 | Bacteria | 1614 |
| 331 | Ga0373937_0465684 | 3300036401 | Bacteria | 1200 |
| 332 | Ga0373937_0493980 | 3300036401 | Bacteria | 1162 |
| 333 | Ga0373937_0511968 | 3300036401 | Bacteria | 1140 |
| 334 | Ga0373937_0811651 | 3300036401 | Bacteria | 883 |
| 335 | Ga0373925_0019292 | 3300037068 | Bacteria | 4959 |
| 336 | Ga0373925_0104967 | 3300037068 | Bacteria | 2176 |
| 337 | Ga0436364_0164275 | 3300037853 | Bacteria | 26469 |
| 338 | Ga0436364_0383313 | 3300037853 | Bacteria | 88995 |
| 339 | Ga0436364_0639874 | 3300037853 | Unclassified | 1029 |
| 340 | Ga0436364_0948351 | 3300037853 | Bacteria | 24426 |
| 341 | Ga0436364_0985460 | 3300037853 | Bacteria | 1436 |
| 342 | Ga0436365_0565342 | 3300039437 | Bacteria | 1185 |
| 343 | Ga0436365_0763143 | 3300039437 | Bacteria | 1698 |
| 344 | Ga0436365_0798017 | 3300039437 | Bacteria | 1685 |
| 345 | Ga0466966_0053316 | 3300044684 | Bacteria | 2566 |
| 346 | Ga0466963_0015106 | 3300044694 | Bacteria | 4774 |
| 347 | Ga0466963_0476911 | 3300044694 | Bacteria | 881 |
| 348 | Ga0466957_0423759 | 3300044842 | Bacteria | 913 |
| 349 | Ga0466959_0134004 | 3300045049 | Bacteria | 1755 |
| 350 | Ga0466959_0186961 | 3300045049 | Bacteria | 1447 |
| 351 | Ga0466967_0191382 | 3300045976 | Bacteria | 1933 |
| 352 | Ga0495592_0002319 | 3300046454 | Bacteria | 13431 |
| 353 | Ga0495592_0108843 | 3300046454 | Bacteria | 1964 |
| 354 | Ga0495592_0455265 | 3300046454 | Bacteria | 801 |
| 355 | Ga0495603_0059846 | 3300046455 | Bacteria | 2251 |
| 356 | Ga0495629_0006843 | 3300046459 | Bacteria | 8421 |
| 357 | Ga0495629_0033137 | 3300046459 | Bacteria | 3655 |
| 358 | Ga0495641_0012704 | 3300046461 | Bacteria | 4688 |
| 359 | Ga0495651_0005002 | 3300046462 | Bacteria | 10124 |
| 360 | Ga0495651_0010202 | 3300046462 | Bacteria | 7212 |
| 361 | Ga0495651_0024480 | 3300046462 | Bacteria | 4696 |
| 362 | Ga0495651_0034086 | 3300046462 | Bacteria | 3969 |
| 363 | Ga0495651_0057817 | 3300046462 | Bacteria | 2976 |
| 364 | Ga0495651_0082294 | 3300046462 | Bacteria | 2429 |
| 365 | Ga0495651_0235889 | 3300046462 | Bacteria | 1257 |
| 366 | Ga0495651_0317069 | 3300046462 | Bacteria | 1040 |
| 367 | Ga0495653_0015586 | 3300046463 | Bacteria | 6195 |
| 368 | Ga0495653_0039447 | 3300046463 | Bacteria | 3699 |
| 369 | Ga0495653_0085945 | 3300046463 | Bacteria | 2312 |
| 370 | Ga0495580_0036621 | 3300046472 | Bacteria | 3522 |
| 371 | Ga0495582_0018197 | 3300046473 | Bacteria | 3844 |
| 372 | Ga0495582_0036106 | 3300046473 | Bacteria | 2718 |
| 373 | Ga0495582_0042930 | 3300046473 | Bacteria | 2490 |
| 374 | Ga0495582_0341294 | 3300046473 | Bacteria | 862 |
| 375 | Ga0495639_0003446 | 3300046475 | Bacteria | 6850 |
| 376 | Ga0495639_0103961 | 3300046475 | Bacteria | 1343 |
| 377 | Ga0495662_0115187 | 3300046476 | Bacteria | 1318 |
| 378 | Ga0495662_0182723 | 3300046476 | Bacteria | 1033 |
| 379 | Ga0495664_0003767 | 3300046477 | Bacteria | 8275 |
| 380 | Ga0495664_0010788 | 3300046477 | Bacteria | 5137 |
| 381 | Ga0495664_0062994 | 3300046477 | Bacteria | 2209 |
| 382 | Ga0495664_0093772 | 3300046477 | Bacteria | 1806 |
| 383 | Ga0495594_0145343 | 3300046499 | Bacteria | 1345 |
| 384 | Ga0495608_0009418 | 3300046511 | Bacteria | 6826 |
| 385 | Ga0495608_0028823 | 3300046511 | Bacteria | 3773 |
| 386 | Ga0495608_0032818 | 3300046511 | Bacteria | 3509 |
| 387 | Ga0495608_0042516 | 3300046511 | Bacteria | 3039 |
| 388 | Ga0495608_0141154 | 3300046511 | Bacteria | 1537 |
| 389 | Ga0495618_0013573 | 3300046514 | Bacteria | 4957 |
| 390 | Ga0495618_0023853 | 3300046514 | Bacteria | 3787 |
| 391 | Ga0495618_0080884 | 3300046514 | Bacteria | 2074 |
| 392 | Ga0495618_0090995 | 3300046514 | Bacteria | 1950 |
| 393 | Ga0495618_0157757 | 3300046514 | Bacteria | 1447 |
| 394 | Ga0495628_0013603 | 3300046516 | Bacteria | 6843 |
| 395 | Ga0495628_0049167 | 3300046516 | Bacteria | 3339 |
| 396 | Ga0495628_0081069 | 3300046516 | Bacteria | 2520 |
| 397 | Ga0495628_0113978 | 3300046516 | Bacteria | 2078 |
| 398 | Ga0495628_0343761 | 3300046516 | Bacteria | 1098 |
| 399 | Ga0495628_0392137 | 3300046516 | Bacteria | 1015 |
| 400 | Ga0495630_0065513 | 3300046517 | Bacteria | 2730 |
| 401 | Ga0495630_0084352 | 3300046517 | Bacteria | 2398 |
| 402 | Ga0495630_0101761 | 3300046517 | Bacteria | 2173 |
| 403 | Ga0495666_0004637 | 3300046526 | Bacteria | 6951 |
| 404 | Ga0495652_0009200 | 3300046529 | Bacteria | 8983 |
| 405 | Ga0495652_0020495 | 3300046529 | Bacteria | 5878 |
| 406 | Ga0495652_0096356 | 3300046529 | Bacteria | 2409 |
| 407 | Ga0495652_0104973 | 3300046529 | Bacteria | 2284 |
| 408 | Ga0495652_0231474 | 3300046529 | Bacteria | 1381 |
| 409 | Ga0495652_0272285 | 3300046529 | Bacteria | 1244 |
| 410 | Ga0495652_0321157 | 3300046529 | Bacteria | 1118 |
| 411 | Ga0495665_0003865 | 3300046531 | Bacteria | 8103 |
| 412 | Ga0495665_0005557 | 3300046531 | Bacteria | 6794 |
| 413 | Ga0495640_0071402 | 3300046533 | Bacteria | 2330 |
| 414 | Ga0495640_0156146 | 3300046533 | Bacteria | 1464 |
| 415 | Ga0495640_0238714 | 3300046533 | Bacteria | 1141 |
| 416 | Ga0495586_0082362 | 3300046535 | Bacteria | 1769 |
| 417 | Ga0495587_0003048 | 3300046536 | Bacteria | 11195 |
| 418 | Ga0495587_0013712 | 3300046536 | Bacteria | 5091 |
| 419 | Ga0495587_0030681 | 3300046536 | Bacteria | 3259 |
| 420 | Ga0495587_0109878 | 3300046536 | Bacteria | 1584 |
| 421 | Ga0495587_0178053 | 3300046536 | Bacteria | 1206 |
| 422 | Ga0495645_0143863 | 3300046543 | Bacteria | 1661 |
| 423 | Ga0495645_0206822 | 3300046543 | Bacteria | 1327 |
| 424 | Ga0495645_0340198 | 3300046543 | Bacteria | 969 |
| 425 | Ga0495622_0156511 | 3300046557 | Bacteria | 1029 |
| 426 | Ga0495667_0004401 | 3300046559 | Bacteria | 9502 |
| 427 | Ga0495667_0010021 | 3300046559 | Bacteria | 6418 |
| 428 | Ga0495667_0014321 | 3300046559 | Bacteria | 5356 |
| 429 | Ga0495667_0030148 | 3300046559 | Bacteria | 3647 |
| 430 | Ga0495667_0042038 | 3300046559 | Bacteria | 3030 |
| 431 | Ga0495667_0567337 | 3300046559 | Bacteria | 708 |
| 432 | Ga0495634_0004146 | 3300046642 | Bacteria | 11454 |
| 433 | Ga0495634_0032221 | 3300046642 | Bacteria | 3605 |
| 434 | Ga0495634_0033672 | 3300046642 | Bacteria | 3519 |
| 435 | Ga0495634_0034936 | 3300046642 | Bacteria | 3447 |
| 436 | Ga0495635_0002730 | 3300046663 | Bacteria | 12093 |
| 437 | Ga0495635_0024656 | 3300046663 | Bacteria | 4192 |
| 438 | Ga0495635_0028831 | 3300046663 | Bacteria | 3858 |
| 439 | Ga0495635_0198655 | 3300046663 | Bacteria | 1360 |
| 440 | Ga0495635_0361928 | 3300046663 | Bacteria | 967 |
| 441 | Ga0495635_0466488 | 3300046663 | Bacteria | 834 |
| 442 | Ga0495657_0024822 | 3300046675 | Bacteria | 4263 |
| 443 | Ga0495657_0030067 | 3300046675 | Bacteria | 3806 |
| 444 | Ga0495657_0030892 | 3300046675 | Bacteria | 3747 |
| 445 | Ga0495657_0035716 | 3300046675 | Bacteria | 3442 |
| 446 | Ga0495657_0036298 | 3300046675 | Bacteria | 3407 |
| 447 | Ga0495599_0010331 | 3300046678 | Bacteria | 5708 |
| 448 | Ga0495599_0033624 | 3300046678 | Bacteria | 3222 |
| 449 | Ga0495599_0077838 | 3300046678 | Bacteria | 2070 |
| 450 | Ga0495599_0201281 | 3300046678 | Bacteria | 1223 |
| 451 | Ga0495623_0010877 | 3300046679 | Bacteria | 5890 |
| 452 | Ga0495623_0133302 | 3300046679 | Bacteria | 1485 |
| 453 | Ga0495646_0001441 | 3300046680 | Bacteria | 14129 |
| 454 | Ga0495646_0090947 | 3300046680 | Bacteria | 1762 |
| 455 | Ga0495646_0096078 | 3300046680 | Bacteria | 1704 |
| 456 | Ga0495647_0014591 | 3300046681 | Bacteria | 2739 |
| 457 | Ga0495647_0017476 | 3300046681 | Bacteria | 2539 |
| 458 | Ga0495658_0002453 | 3300046683 | Bacteria | 9335 |
| 459 | Ga0495613_0045146 | 3300046689 | Bacteria | 3260 |
| 460 | Ga0495613_0185570 | 3300046689 | Bacteria | 1471 |
| 461 | Ga0495613_0203494 | 3300046689 | Bacteria | 1395 |
| 462 | Ga0495613_0415591 | 3300046689 | Bacteria | 916 |
| 463 | Ga0495624_0010978 | 3300046690 | Bacteria | 6238 |
| 464 | Ga0495624_0016597 | 3300046690 | Bacteria | 4956 |
| 465 | Ga0495624_0039930 | 3300046690 | Bacteria | 3008 |
| 466 | Ga0495624_0207377 | 3300046690 | Bacteria | 1189 |
| 467 | Ga0495600_0022859 | 3300046809 | Bacteria | 4019 |
| 468 | Ga0495600_0028949 | 3300046809 | Bacteria | 3585 |
| 469 | Ga0495600_0067468 | 3300046809 | Bacteria | 2338 |
| 470 | Ga0495581_0007790 | 3300047315 | Bacteria | 6201 |
| 471 | Ga0495581_0074956 | 3300047315 | Bacteria | 1958 |
| 472 | Ga0495581_0233204 | 3300047315 | Bacteria | 1076 |
| 473 | Ga0495604_0007103 | 3300047317 | Bacteria | 8878 |
| 474 | Ga0495604_0046403 | 3300047317 | Bacteria | 3387 |
| 475 | Ga0495604_0139250 | 3300047317 | Bacteria | 1735 |
| 476 | Ga0495674_0000403 | 3300047319 | Bacteria | 38789 |
| 477 | Ga0495674_0015025 | 3300047319 | Bacteria | 7245 |
| 478 | Ga0495674_0018031 | 3300047319 | Bacteria | 6571 |
| 479 | Ga0495674_0074647 | 3300047319 | Bacteria | 2919 |
| 480 | Ga0495674_0313284 | 3300047319 | Bacteria | 1280 |
| 481 | Ga0495676_0027027 | 3300047321 | Bacteria | 4929 |
| 482 | Ga0495676_0050072 | 3300047321 | Bacteria | 3352 |
| 483 | Ga0495676_0528005 | 3300047321 | Bacteria | 773 |
| 484 | Ga0495680_0006532 | 3300047322 | Bacteria | 10825 |
| 485 | Ga0495680_0015758 | 3300047322 | Bacteria | 6508 |
| 486 | Ga0495680_0031053 | 3300047322 | Bacteria | 4352 |
| 487 | Ga0495680_0040978 | 3300047322 | Bacteria | 3684 |
| 488 | Ga0495680_0041109 | 3300047322 | Bacteria | 3677 |
| 489 | Ga0495675_0038883 | 3300047444 | Bacteria | 3029 |
| 490 | Ga0495675_0092736 | 3300047444 | Bacteria | 1895 |
| 491 | Ga0495684_0002595 | 3300047471 | Bacteria | 14355 |
| 492 | Ga0495684_0004320 | 3300047471 | Bacteria | 11101 |
| 493 | Ga0495684_0031459 | 3300047471 | Bacteria | 4074 |
| 494 | Ga0495684_0087225 | 3300047471 | Bacteria | 2365 |
| 495 | Ga0495684_0267311 | 3300047471 | Bacteria | 1238 |
| 496 | Ga0495593_0018158 | 3300047673 | Bacteria | 3955 |
| 497 | Ga0495593_0062100 | 3300047673 | Bacteria | 1953 |
| 498 | Ga0495602_0011198 | 3300048088 | Bacteria | 9273 |
| 499 | Ga0495602_0047211 | 3300048088 | Bacteria | 3882 |
| 500 | Ga0495602_0083577 | 3300048088 | Bacteria | 2674 |
| 501 | Ga0495602_0094165 | 3300048088 | Bacteria | 2476 |
| 502 | Ga0495602_0104179 | 3300048088 | Bacteria | 2321 |
| 503 | Ga0495602_0125193 | 3300048088 | Bacteria | 2060 |
| 504 | Ga0495614_0027005 | 3300048089 | Bacteria | 2475 |
| 505 | Ga0495614_0068334 | 3300048089 | Bacteria | 1530 |
| 506 | Ga0496100_0051167 | 3300048903 | Bacteria | 2680 |
| 507 | Ga0496101_0043816 | 3300048904 | Bacteria | 3199 |
| 508 | Ga0496101_0216771 | 3300048904 | Bacteria | 1484 |
| 509 | Ga0496101_0798697 | 3300048904 | Bacteria | 744 |
| 510 | Ga0496102_0300301 | 3300048905 | Bacteria | 1513 |
| 511 | Ga0496103_0011102 | 3300048906 | Bacteria | 5334 |
| 512 | Ga0496104_0037316 | 3300048907 | Bacteria | 4544 |
| 513 | Ga0496104_0471001 | 3300048907 | Bacteria | 1167 |
| 514 | Ga0496105_0053267 | 3300048908 | Bacteria | 3341 |
| 515 | Ga0496105_0098501 | 3300048908 | Bacteria | 2414 |
| 516 | Ga0496106_0093270 | 3300048909 | Bacteria | 2326 |
| 517 | Ga0496106_0414624 | 3300048909 | Bacteria | 1082 |
| 518 | Ga0496107_0087151 | 3300048910 | Bacteria | 2279 |
| 519 | Ga0496108_0060622 | 3300048911 | Bacteria | 3183 |
| 520 | Ga0496108_0121239 | 3300048911 | Bacteria | 2243 |
| 521 | Ga0496108_0191264 | 3300048911 | Bacteria | 1774 |
| 522 | Ga0496109_0095961 | 3300048912 | Bacteria | 2746 |
| 523 | Ga0496110_0015596 | 3300048913 | Bacteria | 6327 |
| 524 | Ga0496110_0090411 | 3300048913 | Bacteria | 2737 |
| 525 | Ga0496111_0003188 | 3300048914 | Bacteria | 10113 |
| 526 | Ga0496111_0080511 | 3300048914 | Bacteria | 2377 |
| 527 | Ga0496112_0073631 | 3300048915 | Bacteria | 3376 |
| 528 | Ga0496113_0031090 | 3300048916 | Bacteria | 3871 |
| 529 | Ga0496113_0107628 | 3300048916 | Bacteria | 2166 |
| 530 | Ga0501031_0014897 | 3300049568 | Bacteria | 5053 |
| 531 | Ga0501033_0103258 | 3300049570 | Bacteria | 2079 |
| 532 | Ga0501036_0036103 | 3300049572 | Bacteria | 4181 |
| 533 | Ga0501037_0145679 | 3300049573 | Bacteria | 1694 |
| 534 | Ga0501038_0050773 | 3300049574 | Bacteria | 3583 |
| 535 | Ga0501039_0019726 | 3300049575 | Bacteria | 5169 |
| 536 | Ga0501040_0018730 | 3300049576 | Bacteria | 4598 |
| 537 | Ga0501041_0048141 | 3300049577 | Bacteria | 2596 |
| 538 | Ga0501042_0022889 | 3300049578 | Bacteria | 4366 |
| 539 | Ga0501043_0088199 | 3300049579 | Bacteria | 2438 |
| 540 | Ga0501043_0461596 | 3300049579 | Bacteria | 953 |
| 541 | Ga0501046_0098205 | 3300049580 | Bacteria | 2249 |
| 542 | Ga0501048_0273373 | 3300049582 | Bacteria | 1201 |
| 543 | Ga0501067_0073169 | 3300049583 | Bacteria | 1899 |
| 544 | Ga0501068_0111623 | 3300049584 | Bacteria | 1700 |
| 545 | Ga0501071_0096290 | 3300049587 | Bacteria | 2178 |
| 546 | Ga0501072_0004999 | 3300049588 | Bacteria | 10087 |
| 547 | Ga0501074_0014518 | 3300049590 | Bacteria | 5731 |
| 548 | Ga0501075_0002237 | 3300049591 | Bacteria | 12819 |
| 549 | Ga0501076_0002427 | 3300049592 | Bacteria | 12785 |
| 550 | Ga0501077_0006245 | 3300049593 | Bacteria | 7286 |
| 551 | Ga0501081_0033327 | 3300049743 | Bacteria | 3499 |
| 552 | Ga0501081_0164709 | 3300049743 | Bacteria | 1599 |
| 553 | Ga0501083_0082373 | 3300049744 | Bacteria | 2132 |
| 554 | Ga0501045_0007477 | 3300049824 | Bacteria | 7586 |
| 555 | nmdc:mga05p37_339824_c1 | 3300050507 | Bacteria | 1771 |
| 556 | nmdc:mga05p37_527756_c1 | 3300050507 | Bacteria | 1349 |
| 557 | nmdc:mga0n895_129762_c1 | 3300050512 | Bacteria | 2545 |
| 558 | nmdc:mga0n895_222951_c1 | 3300050512 | Bacteria | 1914 |
| 559 | nmdc:mga0n895_778600_c1 | 3300050512 | Unclassified | 948 |
| 560 | nmdc:mga0rr50_360008_c1 | 3300050513 | Bacteria | 1224 |
| 561 | nmdc:mga0rr50_90494_c1 | 3300050513 | Bacteria | 2381 |
| 562 | nmdc:mga08x19_138663_c1 | 3300050514 | Bacteria | 1641 |
| 563 | nmdc:mga08x19_191760_c1 | 3300050514 | Bacteria | 1398 |
| 564 | nmdc:mga08x19_310969_c1 | 3300050514 | Bacteria | 1095 |
| 565 | nmdc:mga0a205_121098_c1 | 3300050515 | Bacteria | 2516 |
| 566 | nmdc:mga0a205_134658_c1 | 3300050515 | Bacteria | 2371 |
| 567 | Ga0495601_0126540 | 3300053077 | Bacteria | 1662 |
| 568 | Ga0495612_0082626 | 3300053078 | Bacteria | 1351 |
| 569 | Ga0495595_0008316 | 3300053084 | Bacteria | 4260 |
| 570 | Ga0495595_0040302 | 3300053084 | Bacteria | 2134 |
| 571 | Ga0495595_0113291 | 3300053084 | Bacteria | 1317 |
| 572 | Ga0495619_0015828 | 3300053085 | Bacteria | 4774 |
| 573 | Ga0495619_0299983 | 3300053085 | Bacteria | 1113 |
| 574 | Ga0500600_0063615 | 3300053149 | Bacteria | 2047 |
| 575 | Ga0501084_0014946 | 3300054114 | Bacteria | 6436 |
| 576 | Ga0466962_0017182 | 3300061719 | Bacteria | 3486 |
| 577 | Ga0530510_0010751 | 3300061734 | Bacteria | 6422 |
| 578 | 2501942927 | 2501939600 | Bacteria | 6907073 |
| 579 | 2516083592 | 2515154202 | Bacteria | 5471270 |
| 580 | 2516089523 | 2515154203 | Bacteria | 5458536 |
| 581 | 2552107859 | 2551306166 | Bacteria | 9731570 |
| 582 | 2623586259 | 2622736626 | Bacteria | 7181580 |
| 583 | 2753038686 | 2751185725 | Bacteria | 5740550 |
| 584 | 2753327198 | 2751185792 | Bacteria | 5739090 |
| 585 | 2772641435 | 2772190715 | Bacteria | 6959372 |
| 586 | 2831937233 | 2831935698 | Bacteria | 5963223 |
| 587 | 2832010637 | 2832004796 | Bacteria | 6538017 |
| 588 | 2855676589 | 2855670206 | Bacteria | 7120389 |
| 589 | 2855683362 | 2855676851 | Bacteria | 7063653 |
| 590 | 2855685095 | 2855683550 | Bacteria | 7134265 |
| 591 | 2856860136 | 2856858025 | Bacteria | 7255264 |
| 592 | 2857292778 | 2857288857 | Bacteria | 7189066 |
| 593 | 2858852186 | 2858848962 | Bacteria | 6963058 |
| 594 | 2858870123 | 2858868258 | Bacteria | 7683772 |
| 595 | 2858888297 | 2858882152 | Bacteria | 7230291 |
| 596 | 2858892007 | 2858888857 | Bacteria | 7060307 |
| 597 | 2858899056 | 2858895516 | Bacteria | 7378898 |
| 598 | 2858905384 | 2858902515 | Bacteria | 7086037 |
| 599 | 2866071199 | 2866065130 | Bacteria | 6518152 |
| 600 | 2867304225 | 2867302475 | Bacteria | 7087181 |
| 601 | 2867313553 | 2867312974 | Bacteria | 7058875 |
| 602 | 2867322624 | 2867319477 | Bacteria | 7069771 |
| 603 | 2867509162 | 2867507094 | Bacteria | 6506033 |
| 604 | 2869064863 | 2869061728 | Bacteria | 7112407 |
| 605 | 2869073783 | 2869068681 | Bacteria | 7205615 |
| 606 | 2880494014 | 2880489317 | Bacteria | 7096270 |
| 607 | 2880498318 | 2880495981 | Bacteria | 7340502 |
| 608 | 2899377047 | 2899370129 | Bacteria | 6781179 |
| 609 | 2902587386 | 2902582711 | Bacteria | 6187705 |
| 610 | 2917744286 | 2917736166 | Bacteria | 9690793 |
| 611 | 2929220358 | 2929219909 | Bacteria | 6984360 |
| 612 | 2929226907 | 2929226422 | Bacteria | 7248583 |
| 613 | 649810619 | 649633069 | Bacteria | 6962533 |
| 614 | 8003834612 | 8003830390 | Bacteria | 6541657 |
| 615 | 8003877214 | 8003870546 | Bacteria | 7396674 |
| 616 | 8054710037 | 8054704163 | Bacteria | 7247792 |
| 617 | 8054728247 | 8054727385 | Bacteria | 7558670 |
| 618 | 8054735362 | 8054734606 | Bacteria | 6947278 |
| 619 | 8055413724 | 8055412473 | Bacteria | 6257500 |
| 620 | Ga0496110_0366677 | |||
| 621 | JGI25404J52841_10019753 | |||
| 622 | Ga0070658_10042883 | |||
| 623 | Ga0070683_100040810 | |||
| 624 | Ga0070683_100441160 | |||
| 625 | Ga0068869_100085738 | |||
| 626 | Ga0070666_10134127 | |||
| 627 | Ga0070680_100035326 | |||
| 628 | Ga0068868_100109012 | |||
| 629 | Ga0068868_100275180 | |||
| 630 | Ga0070660_100195973 | |||
| 631 | Ga0070692_10027927 | |||
| 632 | Ga0070668_100653798 | |||
| 633 | Ga0070671_100016031 | |||
| 634 | Ga0070673_100032580 | |||
| 635 | Ga0070659_100135619 | |||
| 636 | Ga0070667_100079838 | |||
| 637 | Ga0070709_10000377 | |||
| 638 | Ga0070709_10001437 | |||
| 639 | Ga0070709_10466808 | |||
| 640 | Ga0070714_100001403 | |||
| 641 | Ga0070714_100003191 | |||
| 642 | Ga0070714_100022881 | |||
| 643 | Ga0070714_100301659 | |||
| 644 | Ga0070714_100498082 | |||
| 645 | Ga0070714_100645490 | |||
| 646 | Ga0070714_100697174 | |||
| 647 | Ga0070714_101022404 | |||
| 648 | Ga0070713_100002255 | |||
| 649 | Ga0070713_100005307 | |||
| 650 | Ga0070713_100030209 | |||
| 651 | Ga0070713_100094642 | |||
| 652 | Ga0070713_100294537 | |||
| 653 | Ga0070710_10000960 | |||
| 654 | Ga0070710_10100683 | |||
| 655 | Ga0070711_100006736 | |||
| 656 | Ga0070711_100223277 | |||
| 657 | Ga0070705_100466684 | |||
| 658 | Ga0070708_100015482 | |||
| 659 | Ga0070708_100117474 | |||
| 660 | Ga0070708_100367159 | |||
| 661 | Ga0070708_100370778 | |||
| 662 | Ga0070708_100468432 | |||
| 663 | Ga0070708_100734967 | |||
| 664 | Ga0070663_100011727 | |||
| 665 | Ga0070681_10137691 | |||
| 666 | Ga0070685_10031523 | |||
| 667 | Ga0070706_100004766 | |||
| 668 | Ga0070706_100025838 | |||
| 669 | Ga0070706_100119383 | |||
| 670 | Ga0070706_100241452 | |||
| 671 | Ga0070707_100000012 | |||
| 672 | Ga0070707_100002570 | |||
| 673 | Ga0070707_100025483 | |||
| 674 | Ga0070707_100232669 | |||
| 675 | Ga0070707_100399434 | |||
| 676 | Ga0070707_100543102 | |||
| 677 | Ga0070698_100000317 | |||
| 678 | Ga0070698_100001877 | |||
| 679 | Ga0070698_100022586 | |||
| 680 | Ga0070698_100316028 | |||
| 681 | Ga0070698_100527392 | |||
| 682 | Ga0070699_100000802 | |||
| 683 | Ga0070699_100023429 | |||
| 684 | Ga0070699_100497942 | |||
| 685 | Ga0070684_100010631 | |||
| 686 | Ga0070684_100184747 | |||
| 687 | Ga0070684_100239396 | |||
| 688 | Ga0070684_100249600 | |||
| 689 | Ga0070697_100002709 | |||
| 690 | Ga0070697_100023607 | |||
| 691 | Ga0070697_100058263 | |||
| 692 | Ga0070686_100322144 | |||
| 693 | Ga0070695_100010689 | |||
| 694 | Ga0070696_100026907 | |||
| 695 | Ga0070696_100134435 | |||
| 696 | Ga0070665_100152024 | |||
| 697 | Ga0068855_100111239 | |||
| 698 | Ga0068855_100320332 | |||
| 699 | Ga0070664_100093423 | |||
| 700 | Ga0068857_100044927 | |||
| 701 | Ga0068854_100006602 | |||
| 702 | Ga0068856_100712915 | |||
| 703 | Ga0068852_100061116 | |||
| 704 | Ga0068859_100026997 | |||
| 705 | Ga0068859_100632629 | |||
| 706 | Ga0068859_101123954 | |||
| 707 | Ga0068864_100023306 | |||
| 708 | Ga0068864_100137355 | |||
| 709 | Ga0068864_100547804 | |||
| 710 | Ga0068861_100205303 | |||
| 711 | Ga0068870_10016058 | |||
| 712 | Ga0068863_100086765 | |||
| 713 | Ga0068858_100094952 | |||
| 714 | Ga0068860_100214551 | |||
| 715 | Ga0068860_100640846 | |||
| 716 | Ga0068862_100057582 | |||
| 717 | Ga0081540_1000154 | |||
| 718 | Ga0081540_1000654 | |||
| 719 | Ga0081539_10000569 | |||
| 720 | Ga0081539_10108138 | |||
| 721 | Ga0070717_10004786 | |||
| 722 | Ga0070717_10017512 | |||
| 723 | Ga0070717_10021291 | |||
| 724 | Ga0070717_10035009 | |||
| 725 | Ga0070717_10053253 | |||
| 726 | Ga0070717_10056555 | |||
| 727 | Ga0070717_10104482 | |||
| 728 | Ga0070717_10156704 | |||
| 729 | Ga0070717_10254412 | |||
| 730 | Ga0070717_10346890 | |||
| 731 | Ga0070717_10353310 | |||
| 732 | Ga0070717_10409142 | |||
| 733 | Ga0070717_10467045 | |||
| 734 | Ga0075432_10019651 | |||
| 735 | Ga0070715_10033721 | |||
| 736 | Ga0070716_100000082 | |||
| 737 | Ga0070716_100003183 | |||
| 738 | Ga0070716_100131501 | |||
| 739 | Ga0070716_100717325 | |||
| 740 | Ga0070712_100002122 | |||
| 741 | Ga0070712_100029384 | |||
| 742 | Ga0070712_100114882 | |||
| 743 | Ga0070712_100424537 | |||
| 744 | Ga0070712_100456804 | |||
| 745 | Ga0070712_100677968 | |||
| 746 | Ga0068871_100034582 | |||
| 747 | Ga0068871_100059663 | |||
| 748 | Ga0075428_100551656 | |||
| 749 | Ga0075428_101080244 | |||
| 750 | Ga0075433_10072883 | |||
| 751 | Ga0075433_10201437 | |||
| 752 | Ga0075434_100277042 | |||
| 753 | Ga0075434_100463421 | |||
| 754 | Ga0075434_100933127 | |||
| 755 | Ga0075436_100114954 | |||
| 756 | Ga0075436_100147910 | |||
| 757 | Ga0075436_100239575 | |||
| 758 | Ga0097620_100026996 | |||
| 759 | Ga0097620_100632653 | |||
| 760 | Ga0097620_101123911 | |||
| 761 | Ga0075435_100460078 | |||
| 762 | Ga0075435_100486054 | |||
| 763 | Ga0105251_10141442 | |||
| 764 | Ga0105240_10232703 | |||
| 765 | Ga0111539_10024102 | |||
| 766 | Ga0111539_10463466 | |||
| 767 | Ga0105247_10522090 | |||
| 768 | Ga0114129_10389529 | |||
| 769 | Ga0114129_10653332 | |||
| 770 | Ga0105241_10028261 | |||
| 771 | Ga0105242_10075348 | |||
| 772 | Ga0105248_10146133 | |||
| 773 | Ga0105248_10347733 | |||
| 774 | Ga0105249_10182458 | |||
| 775 | Ga0105239_10829298 | |||
| 776 | Ga0105239_10884522 | |||
| 777 | Ga0105246_10275541 | |||
| 778 | Ga0157338_1008103 | |||
| 779 | Ga0157373_10319533 | |||
| 780 | Ga0157371_10048358 | |||
| 781 | Ga0157370_10721680 | |||
| 782 | Ga0157369_10239857 | |||
| 783 | Ga0157369_10444412 | |||
| 784 | Ga0157369_11332322 | |||
| 785 | Ga0157374_10056601 | |||
| 786 | Ga0157374_10104637 | |||
| 787 | Ga0157374_10279001 | |||
| 788 | Ga0163162_10166372 | |||
| 789 | Ga0163162_10984738 | |||
| 790 | Ga0157372_10418230 | |||
| 791 | Ga0157375_10175068 | |||
| 792 | Ga0163163_10134285 | |||
| 793 | Ga0163163_10440369 | |||
| 794 | Ga0157377_10744282 | |||
| 795 | Ga0157379_10838265 | |||
| 796 | Ga0157376_10712972 | |||
| 797 | Ga0206354_11602563 | |||
| 798 | Ga0206354_11699213 | |||
| 799 | Ga0206353_10027828 | |||
| 800 | Ga0213876_10089356 | |||
| 801 | Ga0213875_10000681 | |||
| 802 | Ga0213875_10002771 | |||
| 803 | Ga0213875_10004024 | |||
| 804 | Ga0213875_10097354 | |||
| 805 | Ga0207692_10009001 | |||
| 806 | Ga0207692_10040456 | |||
| 807 | Ga0207692_10216412 | |||
| 808 | Ga0207647_10054319 | |||
| 809 | Ga0207685_10010613 | |||
| 810 | Ga0207699_10001206 | |||
| 811 | Ga0207699_10005097 | |||
| 812 | Ga0207699_10024834 | |||
| 813 | Ga0207699_10391386 | |||
| 814 | Ga0207643_10004276 | |||
| 815 | Ga0207705_10207770 | |||
| 816 | Ga0207684_10001996 | |||
| 817 | Ga0207684_10022938 | |||
| 818 | Ga0207684_10024939 | |||
| 819 | Ga0207693_10005985 | |||
| 820 | Ga0207693_10009464 | |||
| 821 | Ga0207693_10034273 | |||
| 822 | Ga0207693_10188221 | |||
| 823 | Ga0207693_10278448 | |||
| 824 | Ga0207693_10290517 | |||
| 825 | Ga0207663_10004078 | |||
| 826 | Ga0207663_10016037 | |||
| 827 | Ga0207663_10029399 | |||
| 828 | Ga0207663_10117019 | |||
| 829 | Ga0207663_10634061 | |||
| 830 | Ga0207660_10773849 | |||
| 831 | Ga0207657_10001989 | |||
| 832 | Ga0207649_10099579 | |||
| 833 | Ga0207646_10000058 | |||
| 834 | Ga0207646_10003165 | |||
| 835 | Ga0207646_10234378 | |||
| 836 | Ga0207646_10285292 | |||
| 837 | Ga0207681_10124946 | |||
| 838 | Ga0207700_10000879 | |||
| 839 | Ga0207700_10008071 | |||
| 840 | Ga0207700_10021499 | |||
| 841 | Ga0207700_10027302 | |||
| 842 | Ga0207700_10053249 | |||
| 843 | Ga0207700_10073050 | |||
| 844 | Ga0207700_10092417 | |||
| 845 | Ga0207700_10141041 | |||
| 846 | Ga0207664_10036106 | |||
| 847 | Ga0207664_10046281 | |||
| 848 | Ga0207664_10086623 | |||
| 849 | Ga0207664_10227769 | |||
| 850 | Ga0207664_10613514 | |||
| 851 | Ga0207644_10671008 | |||
| 852 | Ga0207706_10111917 | |||
| 853 | Ga0207665_10000100 | |||
| 854 | Ga0207665_10002003 | |||
| 855 | Ga0207665_10020493 | |||
| 856 | Ga0207665_10025717 | |||
| 857 | Ga0207665_10049546 | |||
| 858 | Ga0207665_10065580 | |||
| 859 | Ga0207665_10106525 | |||
| 860 | Ga0207691_10036545 | |||
| 861 | Ga0207711_10110031 | |||
| 862 | Ga0207689_10002863 | |||
| 863 | Ga0207679_10198962 | |||
| 864 | Ga0207651_10043218 | |||
| 865 | Ga0207668_10001173 | |||
| 866 | Ga0207658_10173851 | |||
| 867 | Ga0207677_10410126 | |||
| 868 | Ga0207639_10025965 | |||
| 869 | Ga0207678_10002393 | |||
| 870 | Ga0207702_10072520 | |||
| 871 | Ga0207702_10232883 | |||
| 872 | Ga0207702_10495483 | |||
| 873 | Ga0207641_10033799 | |||
| 874 | Ga0207641_10969018 | |||
| 875 | Ga0207648_10053154 | |||
| 876 | Ga0207676_10055386 | |||
| 877 | Ga0207676_10446624 | |||
| 878 | Ga0207674_10027339 | |||
| 879 | Ga0207683_10006866 | |||
| 880 | Ga0268265_10180034 | |||
| 881 | Ga0307513_10021345 | |||
| 882 | Ga0307513_10620006 | |||
| 883 | Ga0307406_10051227 | |||
| 884 | Ga0307407_10335337 | |||
| 885 | Ga0307412_10048648 | |||
| 886 | Ga0307416_100226804 | |||
| 887 | Ga0307415_100087546 | |||
| 888 | Ga0307415_100315609 | |||
| 889 | Ga0373926_0001345 | |||
| 890 | Ga0373926_0001517 | |||
| 891 | Ga0373926_0088851 | |||
| 892 | Ga0373928_0067084 | |||
| 893 | Ga0373928_0085136 | |||
| 894 | Ga0373934_0151629 | |||
| 895 | Ga0373944_0005963 | |||
| 896 | Ga0373944_0011357 | |||
| 897 | Ga0373952_0005014 | |||
| 898 | Ga0373923_0001225 | |||
| 899 | Ga0373923_0024095 | |||
| 900 | Ga0373936_0000553 | |||
| 901 | Ga0373936_0001326 | |||
| 902 | Ga0373936_0007690 | |||
| 903 | Ga0373936_0038643 | |||
| 904 | Ga0373936_0081088 | |||
| 905 | Ga0373939_0226362 | |||
| 906 | Ga0373941_0084923 | |||
| 907 | Ga0373945_0000015 | |||
| 908 | Ga0373953_0007380 | |||
| 909 | Ga0373953_0036395 | |||
| 910 | Ga0373953_0123433 | |||
| 911 | Ga0373954_0000568 | |||
| 912 | Ga0373954_0006956 | |||
| 913 | Ga0373954_0075425 | |||
| 914 | Ga0373954_0100778 | |||
| 915 | Ga0373956_0002170 | |||
| 916 | Ga0373956_0011359 | |||
| 917 | Ga0373956_0022286 | |||
| 918 | Ga0373956_0032488 | |||
| 919 | Ga0373957_0005009 | |||
| 920 | Ga0373957_0012632 | |||
| 921 | Ga0373960_0004087 | |||
| 922 | Ga0373943_0001056 | |||
| 923 | Ga0373943_0004233 | |||
| 924 | Ga0373943_0195019 | |||
| 925 | Ga0373946_0002791 | |||
| 926 | Ga0373946_0005159 | |||
| 927 | Ga0373955_0004101 | |||
| 928 | Ga0373955_0079156 | |||
| 929 | Ga0373955_0089674 | |||
| 930 | Ga0373955_0148474 | |||
| 931 | Ga0373955_0268783 | |||
| 932 | Ga0373942_0004643 | |||
| 933 | Ga0373961_0078588 | |||
| 934 | Ga0373924_0031932 | |||
| 935 | Ga0373924_0057811 | |||
| 936 | Ga0373924_0144727 | |||
| 937 | Ga0373935_0008136 | |||
| 938 | Ga0373927_0027852 | |||
| 939 | Ga0373927_0230585 | |||
| 940 | Ga0373933_0011954 | |||
| 941 | Ga0373933_0013670 | |||
| 942 | Ga0373933_0022076 | |||
| 943 | Ga0373933_0203743 | |||
| 944 | Ga0373947_0000429 | |||
| 945 | Ga0373947_0252011 | |||
| 946 | Ga0373937_0013957 | |||
| 947 | Ga0373937_0047483 | |||
| 948 | Ga0373937_0231956 | |||
| 949 | Ga0373937_0266994 | |||
| 950 | Ga0373937_0465684 | |||
| 951 | Ga0373937_0493980 | |||
| 952 | Ga0373937_0511968 | |||
| 953 | Ga0373937_0811651 | |||
| 954 | Ga0373925_0019292 | |||
| 955 | Ga0373925_0104967 | |||
| 956 | Ga0436364_0164275 | |||
| 957 | Ga0436364_0383313 | |||
| 958 | Ga0436364_0639874 | |||
| 959 | Ga0436364_0948351 | |||
| 960 | Ga0436364_0985460 | |||
| 961 | Ga0436365_0565342 | |||
| 962 | Ga0436365_0763143 | |||
| 963 | Ga0436365_0798017 | |||
| 964 | Ga0466966_0053316 | |||
| 965 | Ga0466963_0015106 | |||
| 966 | Ga0466963_0476911 | |||
| 967 | Ga0466957_0423759 | |||
| 968 | Ga0466959_0134004 | |||
| 969 | Ga0466959_0186961 | |||
| 970 | Ga0466967_0191382 | |||
| 971 | Ga0495592_0002319 | |||
| 972 | Ga0495592_0108843 | |||
| 973 | Ga0495592_0455265 | |||
| 974 | Ga0495603_0059846 | |||
| 975 | Ga0495629_0006843 | |||
| 976 | Ga0495629_0033137 | |||
| 977 | Ga0495641_0012704 | |||
| 978 | Ga0495651_0005002 | |||
| 979 | Ga0495651_0010202 | |||
| 980 | Ga0495651_0024480 | |||
| 981 | Ga0495651_0034086 | |||
| 982 | Ga0495651_0057817 | |||
| 983 | Ga0495651_0082294 | |||
| 984 | Ga0495651_0235889 | |||
| 985 | Ga0495651_0317069 | |||
| 986 | Ga0495653_0015586 | |||
| 987 | Ga0495653_0039447 | |||
| 988 | Ga0495653_0085945 | |||
| 989 | Ga0495580_0036621 | |||
| 990 | Ga0495582_0018197 | |||
| 991 | Ga0495582_0036106 | |||
| 992 | Ga0495582_0042930 | |||
| 993 | Ga0495582_0341294 | |||
| 994 | Ga0495639_0003446 | |||
| 995 | Ga0495639_0103961 | |||
| 996 | Ga0495662_0115187 | |||
| 997 | Ga0495662_0182723 | |||
| 998 | Ga0495664_0003767 | |||
| 999 | Ga0495664_0010788 | |||
| 1000 | Ga0495664_0062994 | |||
| 1001 | Ga0495664_0093772 | |||
| 1002 | Ga0495594_0145343 | |||
| 1003 | Ga0495608_0009418 | |||
| 1004 | Ga0495608_0028823 | |||
| 1005 | Ga0495608_0032818 | |||
| 1006 | Ga0495608_0042516 | |||
| 1007 | Ga0495608_0141154 | |||
| 1008 | Ga0495618_0013573 | |||
| 1009 | Ga0495618_0023853 | |||
| 1010 | Ga0495618_0080884 | |||
| 1011 | Ga0495618_0090995 | |||
| 1012 | Ga0495618_0157757 | |||
| 1013 | Ga0495628_0013603 | |||
| 1014 | Ga0495628_0049167 | |||
| 1015 | Ga0495628_0081069 | |||
| 1016 | Ga0495628_0113978 | |||
| 1017 | Ga0495628_0343761 | |||
| 1018 | Ga0495628_0392137 | |||
| 1019 | Ga0495630_0065513 | |||
| 1020 | Ga0495630_0084352 | |||
| 1021 | Ga0495630_0101761 | |||
| 1022 | Ga0495666_0004637 | |||
| 1023 | Ga0495652_0009200 | |||
| 1024 | Ga0495652_0020495 | |||
| 1025 | Ga0495652_0096356 | |||
| 1026 | Ga0495652_0104973 | |||
| 1027 | Ga0495652_0231474 | |||
| 1028 | Ga0495652_0272285 | |||
| 1029 | Ga0495652_0321157 | |||
| 1030 | Ga0495665_0003865 | |||
| 1031 | Ga0495665_0005557 | |||
| 1032 | Ga0495640_0071402 | |||
| 1033 | Ga0495640_0156146 | |||
| 1034 | Ga0495640_0238714 | |||
| 1035 | Ga0495586_0082362 | |||
| 1036 | Ga0495587_0003048 | |||
| 1037 | Ga0495587_0013712 | |||
| 1038 | Ga0495587_0030681 | |||
| 1039 | Ga0495587_0109878 | |||
| 1040 | Ga0495587_0178053 | |||
| 1041 | Ga0495645_0143863 | |||
| 1042 | Ga0495645_0206822 | |||
| 1043 | Ga0495645_0340198 | |||
| 1044 | Ga0495622_0156511 | |||
| 1045 | Ga0495667_0004401 | |||
| 1046 | Ga0495667_0010021 | |||
| 1047 | Ga0495667_0014321 | |||
| 1048 | Ga0495667_0030148 | |||
| 1049 | Ga0495667_0042038 | |||
| 1050 | Ga0495667_0567337 | |||
| 1051 | Ga0495634_0004146 | |||
| 1052 | Ga0495634_0032221 | |||
| 1053 | Ga0495634_0033672 | |||
| 1054 | Ga0495634_0034936 | |||
| 1055 | Ga0495635_0002730 | |||
| 1056 | Ga0495635_0024656 | |||
| 1057 | Ga0495635_0028831 | |||
| 1058 | Ga0495635_0198655 | |||
| 1059 | Ga0495635_0361928 | |||
| 1060 | Ga0495635_0466488 | |||
| 1061 | Ga0495657_0024822 | |||
| 1062 | Ga0495657_0030067 | |||
| 1063 | Ga0495657_0030892 | |||
| 1064 | Ga0495657_0035716 | |||
| 1065 | Ga0495657_0036298 | |||
| 1066 | Ga0495599_0010331 | |||
| 1067 | Ga0495599_0033624 | |||
| 1068 | Ga0495599_0077838 | |||
| 1069 | Ga0495599_0201281 | |||
| 1070 | Ga0495623_0010877 | |||
| 1071 | Ga0495623_0133302 | |||
| 1072 | Ga0495646_0001441 | |||
| 1073 | Ga0495646_0090947 | |||
| 1074 | Ga0495646_0096078 | |||
| 1075 | Ga0495647_0014591 | |||
| 1076 | Ga0495647_0017476 | |||
| 1077 | Ga0495658_0002453 | |||
| 1078 | Ga0495613_0045146 | |||
| 1079 | Ga0495613_0185570 | |||
| 1080 | Ga0495613_0203494 | |||
| 1081 | Ga0495613_0415591 | |||
| 1082 | Ga0495624_0010978 | |||
| 1083 | Ga0495624_0016597 | |||
| 1084 | Ga0495624_0039930 | |||
| 1085 | Ga0495624_0207377 | |||
| 1086 | Ga0495600_0022859 | |||
| 1087 | Ga0495600_0028949 | |||
| 1088 | Ga0495600_0067468 | |||
| 1089 | Ga0495581_0007790 | |||
| 1090 | Ga0495581_0074956 | |||
| 1091 | Ga0495581_0233204 | |||
| 1092 | Ga0495604_0007103 | |||
| 1093 | Ga0495604_0046403 | |||
| 1094 | Ga0495604_0139250 | |||
| 1095 | Ga0495674_0000403 | |||
| 1096 | Ga0495674_0015025 | |||
| 1097 | Ga0495674_0018031 | |||
| 1098 | Ga0495674_0074647 | |||
| 1099 | Ga0495674_0313284 | |||
| 1100 | Ga0495676_0027027 | |||
| 1101 | Ga0495676_0050072 | |||
| 1102 | Ga0495676_0528005 | |||
| 1103 | Ga0495680_0006532 | |||
| 1104 | Ga0495680_0015758 | |||
| 1105 | Ga0495680_0031053 | |||
| 1106 | Ga0495680_0040978 | |||
| 1107 | Ga0495680_0041109 | |||
| 1108 | Ga0495675_0038883 | |||
| 1109 | Ga0495675_0092736 | |||
| 1110 | Ga0495684_0002595 | |||
| 1111 | Ga0495684_0004320 | |||
| 1112 | Ga0495684_0031459 | |||
| 1113 | Ga0495684_0087225 | |||
| 1114 | Ga0495684_0267311 | |||
| 1115 | Ga0495593_0018158 | |||
| 1116 | Ga0495593_0062100 | |||
| 1117 | Ga0495602_0011198 | |||
| 1118 | Ga0495602_0047211 | |||
| 1119 | Ga0495602_0083577 | |||
| 1120 | Ga0495602_0094165 | |||
| 1121 | Ga0495602_0104179 | |||
| 1122 | Ga0495602_0125193 | |||
| 1123 | Ga0495614_0027005 | |||
| 1124 | Ga0495614_0068334 | |||
| 1125 | Ga0496100_0051167 | |||
| 1126 | Ga0496101_0043816 | |||
| 1127 | Ga0496101_0216771 | |||
| 1128 | Ga0496101_0798697 | |||
| 1129 | Ga0496102_0300301 | |||
| 1130 | Ga0496103_0011102 | |||
| 1131 | Ga0496104_0037316 | |||
| 1132 | Ga0496104_0471001 | |||
| 1133 | Ga0496105_0053267 | |||
| 1134 | Ga0496105_0098501 | |||
| 1135 | Ga0496106_0093270 | |||
| 1136 | Ga0496106_0414624 | |||
| 1137 | Ga0496107_0087151 | |||
| 1138 | Ga0496108_0060622 | |||
| 1139 | Ga0496108_0121239 | |||
| 1140 | Ga0496108_0191264 | |||
| 1141 | Ga0496109_0095961 | |||
| 1142 | Ga0496110_0015596 | |||
| 1143 | Ga0496110_0090411 | |||
| 1144 | Ga0496111_0003188 | |||
| 1145 | Ga0496111_0080511 | |||
| 1146 | Ga0496112_0073631 | |||
| 1147 | Ga0496113_0031090 | |||
| 1148 | Ga0496113_0107628 | |||
| 1149 | Ga0501031_0014897 | |||
| 1150 | Ga0501033_0103258 | |||
| 1151 | Ga0501036_0036103 | |||
| 1152 | Ga0501037_0145679 | |||
| 1153 | Ga0501038_0050773 | |||
| 1154 | Ga0501039_0019726 | |||
| 1155 | Ga0501040_0018730 | |||
| 1156 | Ga0501041_0048141 | |||
| 1157 | Ga0501042_0022889 | |||
| 1158 | Ga0501043_0088199 | |||
| 1159 | Ga0501043_0461596 | |||
| 1160 | Ga0501046_0098205 | |||
| 1161 | Ga0501048_0273373 | |||
| 1162 | Ga0501067_0073169 | |||
| 1163 | Ga0501068_0111623 | |||
| 1164 | Ga0501071_0096290 | |||
| 1165 | Ga0501072_0004999 | |||
| 1166 | Ga0501074_0014518 | |||
| 1167 | Ga0501075_0002237 | |||
| 1168 | Ga0501076_0002427 | |||
| 1169 | Ga0501077_0006245 | |||
| 1170 | Ga0501081_0033327 | |||
| 1171 | Ga0501081_0164709 | |||
| 1172 | Ga0501083_0082373 | |||
| 1173 | Ga0501045_0007477 | |||
| 1174 | nmdc:mga05p37_339824_c1 | |||
| 1175 | nmdc:mga05p37_527756_c1 | |||
| 1176 | nmdc:mga0n895_129762_c1 | |||
| 1177 | nmdc:mga0n895_222951_c1 | |||
| 1178 | nmdc:mga0n895_778600_c1 | |||
| 1179 | nmdc:mga0rr50_360008_c1 | |||
| 1180 | nmdc:mga0rr50_90494_c1 | |||
| 1181 | nmdc:mga08x19_138663_c1 | |||
| 1182 | nmdc:mga08x19_191760_c1 | |||
| 1183 | nmdc:mga08x19_310969_c1 | |||
| 1184 | nmdc:mga0a205_121098_c1 | |||
| 1185 | nmdc:mga0a205_134658_c1 | |||
| 1186 | Ga0495601_0126540 | |||
| 1187 | Ga0495612_0082626 | |||
| 1188 | Ga0495595_0008316 | |||
| 1189 | Ga0495595_0040302 | |||
| 1190 | Ga0495595_0113291 | |||
| 1191 | Ga0495619_0015828 | |||
| 1192 | Ga0495619_0299983 | |||
| 1193 | Ga0500600_0063615 | |||
| 1194 | Ga0501084_0014946 | |||
| 1195 | Ga0466962_0017182 | |||
| 1196 | Ga0530510_0010751 | |||
| 1197 | 2501942927 | |||
| 1198 | 2516083592 | |||
| 1199 | 2516089523 | |||
| 1200 | 2552107859 | |||
| 1201 | 2623586259 | |||
| 1202 | 2753038686 | |||
| 1203 | 2753327198 | |||
| 1204 | 2772641435 | |||
| 1205 | 2831937233 | |||
| 1206 | 2832010637 | |||
| 1207 | 2855676589 | |||
| 1208 | 2855683362 | |||
| 1209 | 2855685095 | |||
| 1210 | 2856860136 | |||
| 1211 | 2857292778 | |||
| 1212 | 2858852186 | |||
| 1213 | 2858870123 | |||
| 1214 | 2858888297 | |||
| 1215 | 2858892007 | |||
| 1216 | 2858899056 | |||
| 1217 | 2858905384 | |||
| 1218 | 2866071199 | |||
| 1219 | 2867304225 | |||
| 1220 | 2867313553 | |||
| 1221 | 2867322624 | |||
| 1222 | 2867509162 | |||
| 1223 | 2869064863 | |||
| 1224 | 2869073783 | |||
| 1225 | 2880494014 | |||
| 1226 | 2880498318 | |||
| 1227 | 2899377047 | |||
| 1228 | 2902587386 | |||
| 1229 | 2917744286 | |||
| 1230 | 2929220358 | |||
| 1231 | 2929226907 | |||
| 1232 | 649810619 | |||
| 1233 | 8003834612 | |||
| 1234 | 8003877214 | |||
| 1235 | 8054710037 | |||
| 1236 | 8054728247 | |||
| 1237 | 8054735362 | |||
| 1238 | 8055413724 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4uas-assembly2.cif.gz_B | crystal structure of cbby from rhodobacter sphaeroides in complex with phosphate | 0.8738 | 1 | 214 |
| 4uau-assembly2.cif.gz_B | crystal structure of cbby (mutant d10n) from rhodobacter sphaeroides in complex with xylulose-(1,5)bisphosphate, crystal form ii | 0.8724 | 1 | 213 |
| 7ocs-assembly1.cif.gz_D | mannitol-1-phosphate bound to the phosphatase domain of the bifunctional mannitol-1-phosphate dehydrogenase/phosphatase mtld-d16a from acinetobacter baumannii | 0.8608 | 2 | 207 |
| 4uas-assembly2.cif.gz_B | crystal structure of cbby from rhodobacter sphaeroides in complex with phosphate | 0.8589 | 1 | 214 |
| 1te2-assembly1.cif.gz_A | putative phosphatase ynic from escherichia coli k12 | 0.8585 | 2 | 213 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P32662_111_227_3.40.50.1000 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like | 0.9567 | 87 | 183 | 3.40.50.1000 |
| 3e58A01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like | 0.9284 | 2 | 207 | 3.40.50.1000 |
| 1te2B01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like | 0.9102 | 85 | 213 | 3.40.50.1000 |
| af_Q84MD8_87_222_3.40.50.1000 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like | 0.9073 | 81 | 208 | 3.40.50.1000 |
| af_Q9VQ01_41_108_3.40.50.1000 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like | 0.9056 | 19 | 78 | 3.40.50.1000 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A538C598-F1-model_v4 | HAD family hydrolase | 0.9977 | 85 | 215 |
GO:0016787
|
| AF-A0A7X6L5U3-F1-model_v4 | HAD family phosphatase | 0.9942 | 2 | 213 |
|
| AF-A0A3N2PHD3-F1-model_v4 | HAD family hydrolase | 0.9909 | 1 | 213 |
GO:0016787
|
| AF-W4A2B8-F1-model_v4 | deleted | 0.9882 | 2 | 215 |
|
| AF-A0A4R5BV01-F1-model_v4 | HAD family phosphatase | 0.9857 | 2 | 189 |
|