F469828

General Info

Members Datasets Scaffolds Average Seq Length
619 251 1238 319

Family's Representative Sequence

Representative Sequence 3300025942|Ga0207689_10117163|Ga0207689_101171633
Length 368
Sequence MGGNRGGNAKSASYLSDREHYQLSHRHRGHGSGKAEAVDEPALHHRRTILRIGVFTPLLSNFPLPEVLARLKAQNIDTVELATGNYPGDAHCKVSMLENKTQLEEFRRTIADHGFTISALSCHGNPLHPDPARAAHDQAVNKKTILLAEKLGVPVVVDFSGCPGDSPKAQQPNWVTCPWPPDFLDVLRWQWDDVVAPYWIERAKFAADHGVKIAIEMHPGFVVYNPETMLKLRSIAGPAIGCNYDPSHMFWQGIDPIAAIRILGDSIFHVHAKDTQIYDRNLPLTGVLDTKPYTDERNRSWIFRTCGYGHGESWWREFASTLRMFGYDYVLSIEHEDSLLSPGEGLSRAATFLKQVVPVEKPAAAWWV

Samples

Sample ID Description Type Environment
1 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
2 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
26 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
33 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
39 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
40 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
44 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
45 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
48 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
49 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
50 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
54 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
55 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
56 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
57 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
58 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
59 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
61 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
62 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
63 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
64 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
66 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
68 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
69 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
70 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
71 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
72 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
73 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
74 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
75 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
76 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
77 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
78 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
79 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
80 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
81 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
82 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
83 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
84 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
85 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
86 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
87 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
88 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
89 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
90 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
91 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
92 3300022730 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU2 Metagenome Rhizosphere
93 3300022732 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU1 Metagenome Rhizosphere
94 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
95 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
96 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
148 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
151 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
152 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
153 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
154 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
155 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
156 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
157 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
158 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
159 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
160 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
161 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
162 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
163 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
164 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
165 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
166 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
167 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
168 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
169 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
170 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
171 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
172 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
173 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
174 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
175 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
176 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
177 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
178 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
179 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
180 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
181 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
182 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
183 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
184 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
185 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
186 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
187 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
188 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
189 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
190 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
191 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
192 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
193 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
194 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
195 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
196 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
197 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
198 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
199 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
200 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
201 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
202 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
203 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
204 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
205 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
206 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
207 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
208 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
209 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
210 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
211 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
212 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
213 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
214 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
215 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
216 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
217 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
218 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
219 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
220 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
221 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
222 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
223 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
224 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
225 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
226 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
227 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
228 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
229 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
230 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
231 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
232 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
233 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
234 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
235 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
236 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
237 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
238 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
239 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
240 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
241 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
242 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
243 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
244 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
245 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
246 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
247 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
248 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
249 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
250 2643221546 Microbacterium sp. Root53 Isolate Unclassified
251 2884215851 Edaphobacter sp. 12200R-103 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.87
Metatranscriptomes 0.81
Isolates 0.32

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.16
Nodule 0
Rhizoplane 3.39
Rhizosphere 95.32
Stem 0
Stem Tuber 0
Unclassified 8.56

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207689_10117163 3300025942 Bacteria 2190
2 LJNas_1007075 3300000546 Bacteria 1214
3 Ga0065715_10121774 3300005293 Bacteria 2221
4 Ga0070658_10059838 3300005327 Bacteria 3102
5 Ga0070683_100000011 3300005329 Bacteria 283682
6 Ga0070683_100036638 3300005329 Bacteria 4489
7 Ga0070683_100043326 3300005329 Bacteria 4148
8 Ga0070683_100116043 3300005329 Bacteria 2528
9 Ga0070683_100247448 3300005329 Bacteria 1695
10 Ga0070690_100171491 3300005330 Bacteria 1493
11 Ga0070670_100115326 3300005331 Bacteria 2316
12 Ga0070670_100247496 3300005331 Bacteria 1553
13 Ga0070670_100315628 3300005331 Bacteria 1369
14 Ga0068869_100001437 3300005334 Bacteria 14118
15 Ga0068869_100043596 3300005334 Bacteria 3223
16 Ga0068869_100217215 3300005334 Bacteria 1514
17 Ga0070666_10005097 3300005335 Bacteria 8039
18 Ga0070666_10011905 3300005335 Bacteria 5472
19 Ga0070682_100096613 3300005337 Bacteria 1943
20 Ga0068868_100008768 3300005338 Bacteria 7245
21 Ga0068868_100040858 3300005338 Bacteria 3612
22 Ga0070660_100016512 3300005339 Bacteria 5360
23 Ga0070660_100023608 3300005339 Bacteria 4557
24 Ga0070660_100120976 3300005339 Bacteria 2089
25 Ga0070689_100083267 3300005340 Bacteria 2514
26 Ga0070689_100103055 3300005340 Unclassified 2261
27 Ga0070689_100204173 3300005340 Bacteria 1615
28 Ga0070691_10003785 3300005341 Bacteria 6836
29 Ga0070661_100264300 3300005344 Bacteria 1331
30 Ga0070692_10167810 3300005345 Bacteria 1263
31 Ga0070692_10219476 3300005345 Bacteria 1123
32 Ga0070675_100273015 3300005354 Bacteria 1484
33 Ga0070671_100002009 3300005355 Bacteria 15630
34 Ga0070671_100042485 3300005355 Bacteria 3779
35 Ga0070671_100068288 3300005355 Bacteria 2964
36 Ga0070673_100004846 3300005364 Bacteria 8561
37 Ga0070673_100365582 3300005364 Bacteria 1283
38 Ga0070659_100062256 3300005366 Bacteria 2949
39 Ga0070667_100014333 3300005367 Bacteria 6551
40 Ga0070667_100041561 3300005367 Bacteria 3857
41 Ga0070709_10028518 3300005434 Unclassified 3330
42 Ga0070709_10101931 3300005434 Unclassified 1914
43 Ga0070714_100000065 3300005435 Bacteria 96459
44 Ga0070714_100111457 3300005435 Bacteria 2423
45 Ga0070714_100304266 3300005435 Unclassified 1487
46 Ga0070713_100000118 3300005436 Bacteria 51698
47 Ga0070713_100001370 3300005436 Bacteria 15591
48 Ga0070713_100010646 3300005436 Bacteria 6655
49 Ga0070713_100014924 3300005436 Bacteria 5784
50 Ga0070713_100076236 3300005436 Bacteria 2847
51 Ga0070713_100177864 3300005436 Unclassified 1910
52 Ga0070713_100300491 3300005436 Bacteria 1477
53 Ga0070710_10005391 3300005437 Bacteria 6071
54 Ga0070710_10011160 3300005437 Bacteria 4433
55 Ga0070711_100000993 3300005439 Bacteria 15033
56 Ga0070711_100004251 3300005439 Bacteria 8419
57 Ga0070711_100376318 3300005439 Bacteria 1147
58 Ga0070663_100011716 3300005455 Bacteria 5516
59 Ga0070663_100340101 3300005455 Bacteria 1212
60 Ga0070678_100253254 3300005456 Bacteria 1477
61 Ga0070662_100044287 3300005457 Bacteria 3187
62 Ga0070662_100053325 3300005457 Bacteria 2927
63 Ga0070662_100145634 3300005457 Bacteria 1840
64 Ga0070681_10005832 3300005458 Bacteria 11922
65 Ga0070681_10285608 3300005458 Bacteria 1561
66 Ga0070681_10341380 3300005458 Bacteria 1407
67 Ga0068867_100008533 3300005459 Bacteria 7231
68 Ga0068867_100130365 3300005459 Bacteria 1953
69 Ga0068867_100422590 3300005459 Bacteria 1129
70 Ga0070706_100039055 3300005467 Bacteria 4382
71 Ga0070706_100043010 3300005467 Bacteria 4174
72 Ga0070707_100153402 3300005468 Bacteria 2243
73 Ga0070679_100003970 3300005530 Bacteria 13624
74 Ga0070679_100622976 3300005530 Bacteria 1022
75 Ga0070684_100000001 3300005535 Bacteria 300240
76 Ga0070684_100003181 3300005535 Bacteria 12278
77 Ga0070684_100047344 3300005535 Bacteria 3726
78 Ga0070684_100055763 3300005535 Bacteria 3446
79 Ga0070697_100420108 3300005536 Bacteria 1162
80 Ga0068853_100030707 3300005539 Bacteria 4540
81 Ga0068853_100282216 3300005539 Bacteria 1531
82 Ga0070686_100350227 3300005544 Bacteria 1109
83 Ga0070695_100095527 3300005545 Bacteria 1992
84 Ga0070693_100028349 3300005547 Bacteria 3044
85 Ga0070665_100072803 3300005548 Bacteria 3443
86 Ga0070665_100219339 3300005548 Bacteria 1902
87 Ga0068855_100028078 3300005563 Bacteria 6730
88 Ga0068855_100029202 3300005563 Bacteria 6595
89 Ga0068855_100120050 3300005563 Bacteria 3009
90 Ga0068855_100597740 3300005563 Bacteria 1190
91 Ga0070664_100048519 3300005564 Bacteria 3588
92 Ga0068857_100001525 3300005577 Bacteria 18503
93 Ga0068857_100010359 3300005577 Bacteria 8100
94 Ga0068857_100011601 3300005577 Bacteria 7666
95 Ga0068857_100078344 3300005577 Bacteria 2950
96 Ga0068857_100234086 3300005577 Bacteria 1680
97 Ga0068857_100356417 3300005577 Unclassified 1355
98 Ga0068854_100024257 3300005578 Bacteria 4150
99 Ga0068856_100001953 3300005614 Bacteria 21469
100 Ga0068856_100034144 3300005614 Bacteria 4983
101 Ga0068856_100068611 3300005614 Bacteria 3505
102 Ga0068856_100074873 3300005614 Bacteria 3353
103 Ga0068856_100258241 3300005614 Bacteria 1757
104 Ga0068852_100045720 3300005616 Bacteria 3726
105 Ga0068852_100223141 3300005616 Bacteria 1793
106 Ga0068859_100005424 3300005617 Bacteria 12967
107 Ga0068859_100011625 3300005617 Bacteria 8851
108 Ga0068859_100483181 3300005617 Bacteria 1334
109 Ga0068864_100024591 3300005618 Bacteria 5068
110 Ga0068864_100083465 3300005618 Bacteria 2806
111 Ga0068861_100035841 3300005719 Bacteria 3678
112 Ga0068863_100004537 3300005841 Bacteria 13691
113 Ga0068863_100059029 3300005841 Bacteria 3630
114 Ga0068863_100126850 3300005841 Bacteria 2435
115 Ga0068863_100240431 3300005841 Unclassified 1748
116 Ga0068858_100001774 3300005842 Bacteria 21999
117 Ga0068858_100010989 3300005842 Bacteria 8557
118 Ga0068858_100056200 3300005842 Bacteria 3638
119 Ga0068860_100000390 3300005843 Bacteria 57357
120 Ga0068860_100016299 3300005843 Bacteria 7246
121 Ga0068860_100021444 3300005843 Bacteria 6255
122 Ga0068860_100047210 3300005843 Bacteria 4105
123 Ga0068860_100085942 3300005843 Unclassified 2993
124 Ga0081540_1049178 3300005983 Unclassified 2105
125 Ga0070717_10001647 3300006028 Bacteria 15524
126 Ga0070717_10026829 3300006028 Bacteria 4600
127 Ga0070717_10043600 3300006028 Unclassified 3662
128 Ga0070717_10063238 3300006028 Unclassified 3071
129 Ga0070717_10090427 3300006028 Bacteria 2583
130 Ga0070717_10096111 3300006028 Bacteria 2509
131 Ga0075365_10016406 3300006038 Bacteria 4505
132 Ga0070716_100034878 3300006173 Bacteria 2762
133 Ga0070712_100000621 3300006175 Bacteria 20835
134 Ga0070712_100001749 3300006175 Bacteria 13283
135 Ga0097621_100002271 3300006237 Bacteria 13157
136 Ga0097621_100002620 3300006237 Bacteria 12314
137 Ga0097621_100003350 3300006237 Bacteria 11022
138 Ga0097621_100010151 3300006237 Bacteria 6875
139 Ga0097621_100062208 3300006237 Bacteria 3064
140 Ga0097621_100121639 3300006237 Bacteria 2214
141 Ga0097621_100299632 3300006237 Bacteria 1419
142 Ga0097621_100365161 3300006237 Bacteria 1287
143 Ga0068871_100003737 3300006358 Bacteria 10476
144 Ga0068871_100015785 3300006358 Bacteria 5666
145 Ga0068871_100040473 3300006358 Bacteria 3733
146 Ga0068871_100066075 3300006358 Bacteria 2964
147 Ga0068871_100157275 3300006358 Unclassified 1942
148 Ga0068871_100208126 3300006358 Unclassified 1691
149 Ga0075430_100179215 3300006846 Bacteria 1763
150 Ga0075431_100011469 3300006847 Bacteria 8932
151 Ga0068865_100011527 3300006881 Bacteria 5539
152 Ga0068865_100043782 3300006881 Bacteria 3061
153 Ga0097620_100005424 3300006931 Bacteria 12967
154 Ga0097620_100011625 3300006931 Bacteria 8851
155 Ga0097620_100030663 3300006931 Bacteria 5396
156 Ga0097620_100483170 3300006931 Bacteria 1334
157 Ga0105240_10000042 3300009093 Bacteria 263795
158 Ga0105240_10004528 3300009093 Bacteria 21116
159 Ga0105240_10018305 3300009093 Bacteria 9415
160 Ga0105240_10084612 3300009093 Bacteria 3889
161 Ga0105240_10185202 3300009093 Bacteria 2453
162 Ga0105240_10431104 3300009093 Bacteria 1479
163 Ga0111539_10717610 3300009094 Bacteria 1164
164 Ga0105245_10000962 3300009098 Bacteria 26213
165 Ga0105245_10001528 3300009098 Bacteria 20966
166 Ga0105245_10001723 3300009098 Bacteria 19950
167 Ga0105245_10006955 3300009098 Bacteria 9921
168 Ga0105245_10025151 3300009098 Bacteria 5236
169 Ga0105245_10045931 3300009098 Bacteria 3902
170 Ga0105245_10098586 3300009098 Unclassified 2700
171 Ga0105245_10308897 3300009098 Bacteria 1554
172 Ga0105247_10200305 3300009101 Viruses 1341
173 Ga0105241_10007688 3300009174 Bacteria 7926
174 Ga0105241_10013137 3300009174 Bacteria 6076
175 Ga0105241_10049516 3300009174 Bacteria 3200
176 Ga0105241_10114002 3300009174 Bacteria 2168
177 Ga0105241_10135289 3300009174 Bacteria 2000
178 Ga0105241_10237368 3300009174 Bacteria 1540
179 Ga0105242_10003792 3300009176 Bacteria 11748
180 Ga0105242_10010394 3300009176 Bacteria 7139
181 Ga0105242_10012665 3300009176 Bacteria 6495
182 Ga0105242_10019579 3300009176 Bacteria 5305
183 Ga0105242_10035813 3300009176 Bacteria 3980
184 Ga0105242_10173433 3300009176 Bacteria 1897
185 Ga0105242_10455015 3300009176 Unclassified 1208
186 Ga0105248_10000826 3300009177 Bacteria 34800
187 Ga0105248_10001527 3300009177 Bacteria 25763
188 Ga0105248_10004859 3300009177 Bacteria 14883
189 Ga0105248_10008473 3300009177 Bacteria 11283
190 Ga0105248_10013169 3300009177 Bacteria 9105
191 Ga0105248_10017925 3300009177 Bacteria 7813
192 Ga0105248_10125207 3300009177 Unclassified 2899
193 Ga0105248_10178097 3300009177 Bacteria 2396
194 Ga0105248_10415265 3300009177 Bacteria 1515
195 Ga0105237_10025678 3300009545 Bacteria 6022
196 Ga0105237_10034225 3300009545 Bacteria 5145
197 Ga0105237_10041372 3300009545 Bacteria 4648
198 Ga0105237_10056009 3300009545 Bacteria 3948
199 Ga0105237_10078057 3300009545 Bacteria 3301
200 Ga0105237_10139453 3300009545 Bacteria 2419
201 Ga0105238_10014593 3300009551 Bacteria 7943
202 Ga0105238_10022125 3300009551 Bacteria 6483
203 Ga0105238_10040471 3300009551 Bacteria 4723
204 Ga0105238_10057181 3300009551 Bacteria 3911
205 Ga0105238_10110665 3300009551 Bacteria 2727
206 Ga0105238_10254881 3300009551 Unclassified 1734
207 Ga0105249_10049170 3300009553 Bacteria 3845
208 Ga0105239_10005326 3300010375 Bacteria 15096
209 Ga0105239_10007346 3300010375 Bacteria 12657
210 Ga0105239_10009528 3300010375 Bacteria 10931
211 Ga0105239_10010285 3300010375 Bacteria 10481
212 Ga0105246_10000823 3300011119 Bacteria 17650
213 Ga0105246_10002971 3300011119 Bacteria 10272
214 Ga0105246_10021041 3300011119 Bacteria 4191
215 Ga0105246_10033536 3300011119 Unclassified 3414
216 Ga0105246_10153074 3300011119 Bacteria 1748
217 Ga0105246_10188917 3300011119 Bacteria 1593
218 Ga0157371_10098822 3300013102 Bacteria 2070
219 Ga0157370_10010264 3300013104 Bacteria 9886
220 Ga0157370_10502462 3300013104 Bacteria 1113
221 Ga0157369_10001374 3300013105 Bacteria 29992
222 Ga0157369_10004817 3300013105 Bacteria 15848
223 Ga0157369_10045771 3300013105 Bacteria 4757
224 Ga0157369_10063902 3300013105 Bacteria 3965
225 Ga0157369_10270656 3300013105 Bacteria 1770
226 Ga0157369_10292477 3300013105 Bacteria 1695
227 Ga0157369_10361548 3300013105 Bacteria 1507
228 Ga0157374_10033370 3300013296 Unclassified 4696
229 Ga0157374_10095349 3300013296 Bacteria 2845
230 Ga0157374_10114272 3300013296 Bacteria 2599
231 Ga0157374_10207489 3300013296 Bacteria 1920
232 Ga0157374_10281489 3300013296 Bacteria 1642
233 Ga0157378_10001381 3300013297 Bacteria 21801
234 Ga0157378_10049527 3300013297 Unclassified 3738
235 Ga0157378_10053544 3300013297 Bacteria 3593
236 Ga0163162_10004193 3300013306 Bacteria 13861
237 Ga0163162_10005667 3300013306 Bacteria 12066
238 Ga0163162_10019825 3300013306 Bacteria 6603
239 Ga0163162_10031039 3300013306 Bacteria 5298
240 Ga0163162_10115724 3300013306 Bacteria 2782
241 Ga0163162_10219015 3300013306 Bacteria 2033
242 Ga0157372_10011786 3300013307 Bacteria 9314
243 Ga0157372_10012073 3300013307 Bacteria 9200
244 Ga0157372_10023996 3300013307 Bacteria 6616
245 Ga0157372_10027131 3300013307 Bacteria 6234
246 Ga0157372_10364100 3300013307 Bacteria 1685
247 Ga0157375_10002812 3300013308 Bacteria 15065
248 Ga0157375_10032513 3300013308 Bacteria 4949
249 Ga0157375_10079982 3300013308 Bacteria 3305
250 Ga0157375_10494181 3300013308 Bacteria 1388
251 Ga0163163_10006378 3300014325 Bacteria 10300
252 Ga0163163_10024298 3300014325 Bacteria 5766
253 Ga0163163_10025500 3300014325 Bacteria 5636
254 Ga0163163_10048771 3300014325 Unclassified 4165
255 Ga0163163_10062046 3300014325 Bacteria 3704
256 Ga0163163_10162384 3300014325 Bacteria 2280
257 Ga0163163_10168441 3300014325 Unclassified 2237
258 Ga0163163_10251466 3300014325 Bacteria 1818
259 Ga0163163_10385473 3300014325 Unclassified 1459
260 Ga0182008_10026936 3300014497 Bacteria 2913
261 Ga0157379_10007393 3300014968 Bacteria 9515
262 Ga0157379_10384558 3300014968 Unclassified 1288
263 Ga0157379_10431491 3300014968 Bacteria 1214
264 Ga0157376_10000991 3300014969 Bacteria 18517
265 Ga0157376_10013864 3300014969 Bacteria 6025
266 Ga0157376_10016520 3300014969 Bacteria 5606
267 Ga0157376_10061600 3300014969 Bacteria 3155
268 Ga0157376_10074036 3300014969 Bacteria 2902
269 Ga0157376_10089233 3300014969 Bacteria 2665
270 Ga0157376_10094963 3300014969 Bacteria 2592
271 Ga0157376_10209796 3300014969 Bacteria 1798
272 Ga0157376_10270310 3300014969 Bacteria 1596
273 Ga0157376_10323337 3300014969 Bacteria 1467
274 Ga0182006_1010975 3300015261 Bacteria 4002
275 Ga0213872_10004316 3300021361 Bacteria 7590
276 Ga0213872_10007149 3300021361 Bacteria 5519
277 Ga0213872_10043655 3300021361 Bacteria 2042
278 Ga0213871_10001487 3300021441 Bacteria 3951
279 Ga0224570_101021 3300022730 Bacteria 2208
280 Ga0224569_101006 3300022732 Bacteria 2407
281 Ga0224572_1001123 3300024225 Bacteria 3788
282 Ga0224572_1002619 3300024225 Bacteria 2940
283 Ga0228598_1000250 3300024227 Bacteria 10386
284 Ga0228598_1000568 3300024227 Bacteria 7733
285 Ga0228598_1002290 3300024227 Bacteria 4190
286 Ga0228598_1006661 3300024227 Bacteria 2383
287 Ga0207692_10069333 3300025898 Bacteria 1852
288 Ga0207642_10055478 3300025899 Bacteria 1813
289 Ga0207710_10128819 3300025900 Bacteria 1214
290 Ga0207680_10002337 3300025903 Bacteria 8821
291 Ga0207680_10007594 3300025903 Bacteria 5294
292 Ga0207680_10049501 3300025903 Bacteria 2501
293 Ga0207647_10001920 3300025904 Bacteria 15897
294 Ga0207685_10004732 3300025905 Bacteria 3501
295 Ga0207699_10002353 3300025906 Bacteria 8933
296 Ga0207699_10025116 3300025906 Bacteria 3268
297 Ga0207699_10089676 3300025906 Bacteria 1928
298 Ga0207699_10134040 3300025906 Bacteria 1620
299 Ga0207705_10044007 3300025909 Bacteria 3208
300 Ga0207705_10200127 3300025909 Bacteria 1513
301 Ga0207705_10262386 3300025909 Bacteria 1319
302 Ga0207684_10085532 3300025910 Bacteria 2686
303 Ga0207654_10007255 3300025911 Bacteria 5586
304 Ga0207654_10023009 3300025911 Bacteria 3333
305 Ga0207654_10035598 3300025911 Bacteria 2775
306 Ga0207654_10090948 3300025911 Unclassified 1860
307 Ga0207707_10001442 3300025912 Bacteria 21981
308 Ga0207707_10009834 3300025912 Bacteria 8294
309 Ga0207707_10319166 3300025912 Bacteria 1341
310 Ga0207695_10000002 3300025913 Bacteria 2188391
311 Ga0207695_10003161 3300025913 Bacteria 23484
312 Ga0207695_10004204 3300025913 Bacteria 19775
313 Ga0207695_10015802 3300025913 Bacteria 8865
314 Ga0207695_10121651 3300025913 Bacteria 2577
315 Ga0207695_10235108 3300025913 Unclassified 1735
316 Ga0207671_10011281 3300025914 Bacteria 7288
317 Ga0207671_10012043 3300025914 Bacteria 6987
318 Ga0207693_10000087 3300025915 Bacteria 82834
319 Ga0207693_10002319 3300025915 Bacteria 16545
320 Ga0207663_10000771 3300025916 Bacteria 14321
321 Ga0207663_10005027 3300025916 Bacteria 6639
322 Ga0207663_10050154 3300025916 Bacteria 2593
323 Ga0207663_10061767 3300025916 Unclassified 2379
324 Ga0207657_10003252 3300025919 Bacteria 17394
325 Ga0207657_10055529 3300025919 Bacteria 3420
326 Ga0207649_10059038 3300025920 Bacteria 2405
327 Ga0207652_10080722 3300025921 Bacteria 2844
328 Ga0207646_10082450 3300025922 Bacteria 2876
329 Ga0207694_10001991 3300025924 Bacteria 16906
330 Ga0207694_10006081 3300025924 Bacteria 9227
331 Ga0207694_10006148 3300025924 Bacteria 9174
332 Ga0207694_10007023 3300025924 Bacteria 8550
333 Ga0207694_10039786 3300025924 Bacteria 3618
334 Ga0207694_10146399 3300025924 Bacteria 1901
335 Ga0207694_10248032 3300025924 Bacteria 1456
336 Ga0207650_10071580 3300025925 Bacteria 2609
337 Ga0207650_10142787 3300025925 Bacteria 1883
338 Ga0207687_10000622 3300025927 Bacteria 23930
339 Ga0207687_10008991 3300025927 Bacteria 6530
340 Ga0207687_10009395 3300025927 Bacteria 6396
341 Ga0207687_10016457 3300025927 Bacteria 4858
342 Ga0207687_10021675 3300025927 Unclassified 4270
343 Ga0207700_10001196 3300025928 Bacteria 14929
344 Ga0207700_10119982 3300025928 Bacteria 2131
345 Ga0207700_10190877 3300025928 Bacteria 1721
346 Ga0207664_10000496 3300025929 Bacteria 27992
347 Ga0207664_10009623 3300025929 Bacteria 6791
348 Ga0207664_10022516 3300025929 Bacteria 4708
349 Ga0207664_10175830 3300025929 Bacteria 1835
350 Ga0207644_10012309 3300025931 Bacteria 5680
351 Ga0207706_10020522 3300025933 Bacteria 5939
352 Ga0207706_10022622 3300025933 Bacteria 5642
353 Ga0207706_10040514 3300025933 Bacteria 4128
354 Ga0207686_10013946 3300025934 Bacteria 4461
355 Ga0207686_10019348 3300025934 Bacteria 3870
356 Ga0207686_10057109 3300025934 Bacteria 2456
357 Ga0207686_10141785 3300025934 Bacteria 1662
358 Ga0207686_10147413 3300025934 Bacteria 1634
359 Ga0207709_10055542 3300025935 Bacteria 2447
360 Ga0207709_10105936 3300025935 Bacteria 1870
361 Ga0207670_10245261 3300025936 Unclassified 1382
362 Ga0207704_10005998 3300025938 Bacteria 5633
363 Ga0207704_10029155 3300025938 Bacteria 3073
364 Ga0207704_10033812 3300025938 Unclassified 2911
365 Ga0207704_10122433 3300025938 Bacteria 1783
366 Ga0207665_10011079 3300025939 Bacteria 5917
367 Ga0207665_10074141 3300025939 Unclassified 2329
368 Ga0207711_10001054 3300025941 Bacteria 26394
369 Ga0207711_10001453 3300025941 Bacteria 22141
370 Ga0207711_10005197 3300025941 Bacteria 11022
371 Ga0207711_10007323 3300025941 Bacteria 9238
372 Ga0207711_10009300 3300025941 Bacteria 8204
373 Ga0207711_10021670 3300025941 Bacteria 5368
374 Ga0207711_10189747 3300025941 Unclassified 1872
375 Ga0207711_10391769 3300025941 Bacteria 1290
376 Ga0207689_10000166 3300025942 Bacteria 57369
377 Ga0207689_10128735 3300025942 Bacteria 2083
378 Ga0207661_10000016 3300025944 Bacteria 305159
379 Ga0207661_10004163 3300025944 Bacteria 10120
380 Ga0207661_10015537 3300025944 Bacteria 5605
381 Ga0207661_10017846 3300025944 Bacteria 5260
382 Ga0207661_10035860 3300025944 Bacteria 3868
383 Ga0207661_10095425 3300025944 Bacteria 2486
384 Ga0207661_10165165 3300025944 Unclassified 1923
385 Ga0207679_10051062 3300025945 Bacteria 3025
386 Ga0207679_10057721 3300025945 Unclassified 2872
387 Ga0207679_10094361 3300025945 Bacteria 2323
388 Ga0207679_10204034 3300025945 Bacteria 1653
389 Ga0207667_10002404 3300025949 Bacteria 23430
390 Ga0207667_10011243 3300025949 Bacteria 10412
391 Ga0207667_10011868 3300025949 Bacteria 10091
392 Ga0207667_10105110 3300025949 Bacteria 2913
393 Ga0207667_10125344 3300025949 Bacteria 2645
394 Ga0207667_10485377 3300025949 Unclassified 1254
395 Ga0207651_10053954 3300025960 Bacteria 2751
396 Ga0207712_10090732 3300025961 Bacteria 2249
397 Ga0207712_10301219 3300025961 Bacteria 1316
398 Ga0207640_10246744 3300025981 Bacteria 1383
399 Ga0207658_10025845 3300025986 Bacteria 4113
400 Ga0207677_10061926 3300026023 Bacteria 2593
401 Ga0207677_10090612 3300026023 Unclassified 2222
402 Ga0207677_10506978 3300026023 Bacteria 1044
403 Ga0207703_10001398 3300026035 Bacteria 21976
404 Ga0207703_10005501 3300026035 Bacteria 10182
405 Ga0207703_10009629 3300026035 Bacteria 7585
406 Ga0207703_10029671 3300026035 Bacteria 4317
407 Ga0207703_10075315 3300026035 Bacteria 2797
408 Ga0207639_10003599 3300026041 Bacteria 10410
409 Ga0207678_10002148 3300026067 Bacteria 17852
410 Ga0207702_10004748 3300026078 Bacteria 11997
411 Ga0207702_10178770 3300026078 Bacteria 1952
412 Ga0207702_10213598 3300026078 Bacteria 1795
413 Ga0207641_10133933 3300026088 Bacteria 2228
414 Ga0207641_10362684 3300026088 Unclassified 1384
415 Ga0207648_10007509 3300026089 Bacteria 10706
416 Ga0207648_10050550 3300026089 Bacteria 3635
417 Ga0207648_10089802 3300026089 Unclassified 2685
418 Ga0207648_10174980 3300026089 Bacteria 1898
419 Ga0207648_10338020 3300026089 Unclassified 1356
420 Ga0207676_10088109 3300026095 Bacteria 2540
421 Ga0207674_10000493 3300026116 Bacteria 51995
422 Ga0207674_10016507 3300026116 Bacteria 8079
423 Ga0207674_10172350 3300026116 Bacteria 2117
424 Ga0207674_10408367 3300026116 Unclassified 1312
425 Ga0207675_100111969 3300026118 Bacteria 2576
426 Ga0207683_10076187 3300026121 Bacteria 2970
427 Ga0207698_10170932 3300026142 Bacteria 1913
428 Ga0207698_10227289 3300026142 Bacteria 1691
429 Ga0265356_1000015 3300028017 Bacteria 27405
430 Ga0268265_10018474 3300028380 Bacteria 4833
431 Ga0268264_10000988 3300028381 Bacteria 29062
432 Ga0268264_10012229 3300028381 Bacteria 7061
433 Ga0268264_10014141 3300028381 Bacteria 6562
434 Ga0268264_10079535 3300028381 Bacteria 2797
435 Ga0265323_10003354 3300028653 Bacteria 7095
436 Ga0265338_10023768 3300028800 Bacteria 6286
437 Ga0265338_10035289 3300028800 Bacteria 4812
438 Ga0265338_10055840 3300028800 Unclassified 3509
439 Ga0265338_10071348 3300028800 Bacteria 2972
440 Ga0265762_1000483 3300030760 Bacteria 6900
441 Ga0265760_10000510 3300031090 Bacteria 10847
442 Ga0265760_10002913 3300031090 Bacteria 5000
443 Ga0265760_10011145 3300031090 Bacteria 2569
444 Ga0265760_10035805 3300031090 Unclassified 1471
445 Ga0265325_10057297 3300031241 Bacteria 1987
446 Ga0265331_10070740 3300031250 Unclassified 1633
447 Ga0265316_10004882 3300031344 Bacteria 13202
448 Ga0265316_10011307 3300031344 Bacteria 8064
449 Ga0265316_10073726 3300031344 Unclassified 2628
450 Ga0265316_10092209 3300031344 Bacteria 2310
451 Ga0265316_10367553 3300031344 Bacteria 1039
452 Ga0265313_10032951 3300031595 Bacteria 2638
453 Ga0265314_10001421 3300031711 Bacteria 26829
454 Ga0265314_10001752 3300031711 Bacteria 23459
455 Ga0265314_10003877 3300031711 Bacteria 14238
456 Ga0265314_10018921 3300031711 Bacteria 5346
457 Ga0373936_0004464 3300035113 Bacteria 5292
458 Ga0373954_0001623 3300035118 Bacteria 9199
459 Ga0373954_0012510 3300035118 Bacteria 3773
460 Ga0373954_0039950 3300035118 Bacteria 2185
461 Ga0373957_0003802 3300035120 Bacteria 4525
462 Ga0373957_0145391 3300035120 Bacteria 971
463 Ga0373943_0000171 3300035170 Bacteria 25394
464 Ga0373955_0061612 3300035172 Bacteria 2072
465 Ga0373955_0068148 3300035172 Bacteria 1982
466 Ga0373955_0191378 3300035172 Bacteria 1216
467 Ga0373935_0001385 3300035692 Bacteria 13401
468 Ga0373935_0180263 3300035692 Bacteria 1450
469 Ga0373927_0000454 3300035695 Bacteria 31317
470 Ga0373927_0006299 3300035695 Bacteria 8091
471 Ga0373927_0067666 3300035695 Bacteria 2311
472 Ga0373933_0025736 3300035724 Bacteria 3376
473 Ga0373933_0074496 3300035724 Bacteria 2071
474 Ga0373947_0001248 3300035725 Bacteria 15655
475 Ga0373937_0001151 3300036401 Bacteria 22158
476 Ga0373937_0004958 3300036401 Bacteria 11319
477 Ga0373937_0022004 3300036401 Bacteria 5725
478 Ga0373937_0144471 3300036401 Bacteria 2227
479 Ga0373937_0620308 3300036401 Bacteria 1026
480 Ga0373925_0001175 3300037068 Bacteria 23154
481 Ga0373925_0005255 3300037068 Bacteria 9668
482 Ga0373925_0049045 3300037068 Bacteria 3147
483 Ga0373925_0057010 3300037068 Bacteria 2926
484 Ga0373925_0144630 3300037068 Bacteria 1863
485 Ga0395898_0214660 3300037466 Bacteria 1835
486 Ga0436364_0480896 3300037853 Bacteria 2984
487 Ga0436364_1289035 3300037853 Bacteria 14704
488 Ga0436365_1657733 3300039437 Bacteria 2262
489 Ga0436360_0510304 3300039438 Bacteria 6014
490 Ga0436360_0546468 3300039438 Bacteria 2441
491 Ga0436361_0215804 3300039447 Bacteria 3587
492 Ga0436361_0548546 3300039447 Bacteria 30262
493 Ga0436361_0923210 3300039447 Bacteria 26083
494 Ga0436363_0666147 3300039450 Bacteria 1997
495 Ga0466961_0137877 3300044693 Bacteria 1528
496 Ga0466964_0029156 3300044706 Bacteria 2178
497 Ga0451576_0030592 3300045051 Bacteria 5753
498 Ga0495592_0027142 3300046454 Bacteria 4341
499 Ga0495592_0067940 3300046454 Bacteria 2603
500 Ga0495603_0051006 3300046455 Unclassified 2459
501 Ga0495629_0020251 3300046459 Unclassified 4750
502 Ga0495629_0035458 3300046459 Bacteria 3525
503 Ga0495651_0016881 3300046462 Bacteria 5654
504 Ga0495651_0118090 3300046462 Unclassified 1952
505 Ga0495653_0015281 3300046463 Bacteria 6257
506 Ga0495580_0000470 3300046472 Bacteria 33520
507 Ga0495580_0005878 3300046472 Bacteria 10069
508 Ga0495580_0032832 3300046472 Bacteria 3742
509 Ga0495580_0042256 3300046472 Bacteria 3248
510 Ga0495580_0078689 3300046472 Bacteria 2300
511 Ga0495580_0139499 3300046472 Bacteria 1681
512 Ga0495580_0169309 3300046472 Bacteria 1511
513 Ga0495582_0000322 3300046473 Bacteria 26167
514 Ga0495582_0001074 3300046473 Bacteria 15354
515 Ga0495662_0000425 3300046476 Bacteria 18888
516 Ga0495664_0004702 3300046477 Bacteria 7468
517 Ga0495594_0000093 3300046499 Bacteria 41149
518 Ga0495594_0001164 3300046499 Bacteria 13758
519 Ga0495606_0078139 3300046507 Bacteria 2065
520 Ga0495608_0023005 3300046511 Bacteria 4273
521 Ga0495608_0256399 3300046511 Bacteria 1090
522 Ga0495630_0028614 3300046517 Bacteria 4140
523 Ga0495630_0161648 3300046517 Bacteria 1705
524 Ga0495644_0004451 3300046523 Bacteria 5505
525 Ga0495666_0116734 3300046526 Bacteria 1251
526 Ga0495652_0013665 3300046529 Bacteria 7305
527 Ga0495652_0023858 3300046529 Bacteria 5419
528 Ga0495652_0039813 3300046529 Bacteria 4063
529 Ga0495665_0000456 3300046531 Bacteria 20542
530 Ga0495640_0010608 3300046533 Bacteria 7107
531 Ga0495586_0000798 3300046535 Bacteria 18124
532 Ga0495587_0005464 3300046536 Bacteria 8290
533 Ga0495587_0026815 3300046536 Unclassified 3510
534 Ga0495645_0004187 3300046543 Bacteria 9861
535 Ga0495645_0107072 3300046543 Bacteria 1982
536 Ga0495645_0193952 3300046543 Bacteria 1382
537 Ga0495622_0044580 3300046557 Bacteria 2061
538 Ga0495667_0011906 3300046559 Bacteria 5893
539 Ga0495667_0033900 3300046559 Bacteria 3415
540 Ga0495667_0068113 3300046559 Bacteria 2325
541 Ga0495634_0007566 3300046642 Bacteria 8144
542 Ga0495635_0008967 3300046663 Bacteria 6982
543 Ga0495588_0042726 3300046674 Bacteria 2318
544 Ga0495599_0008739 3300046678 Bacteria 6169
545 Ga0495599_0045797 3300046678 Bacteria 2743
546 Ga0495623_0076094 3300046679 Bacteria 2083
547 Ga0495623_0126123 3300046679 Bacteria 1537
548 Ga0495646_0004513 3300046680 Bacteria 8763
549 Ga0495646_0026992 3300046680 Bacteria 3605
550 Ga0495658_0048042 3300046683 Bacteria 2405
551 Ga0495669_0007038 3300046684 Bacteria 4709
552 Ga0495613_0012267 3300046689 Bacteria 6367
553 Ga0495613_0017500 3300046689 Bacteria 5335
554 Ga0495624_0028297 3300046690 Bacteria 3665
555 Ga0495624_0058280 3300046690 Bacteria 2426
556 Ga0495600_0000182 3300046809 Bacteria 36962
557 Ga0495600_0091370 3300046809 Bacteria 1986
558 Ga0495581_0000827 3300047315 Bacteria 16505
559 Ga0495604_0001256 3300047317 Bacteria 20748
560 Ga0495674_0004545 3300047319 Bacteria 13347
561 Ga0495674_0023818 3300047319 Bacteria 5634
562 Ga0495674_0042549 3300047319 Unclassified 4050
563 Ga0495674_0045737 3300047319 Bacteria 3887
564 Ga0495674_0291651 3300047319 Unclassified 1334
565 Ga0495676_0001269 3300047321 Bacteria 21668
566 Ga0495676_0101525 3300047321 Bacteria 2128
567 Ga0495680_0221721 3300047322 Bacteria 1349
568 Ga0495675_0001092 3300047444 Bacteria 16469
569 Ga0495675_0076739 3300047444 Bacteria 2106
570 Ga0495675_0098839 3300047444 Bacteria 1828
571 Ga0495675_0106313 3300047444 Bacteria 1754
572 Ga0495675_0156698 3300047444 Bacteria 1404
573 Ga0495684_0046520 3300047471 Unclassified 3319
574 Ga0495684_0079825 3300047471 Bacteria 2484
575 Ga0495684_0149365 3300047471 Bacteria 1748
576 Ga0495602_0038205 3300048088 Bacteria 4443
577 Ga0495602_0096496 3300048088 Bacteria 2438
578 Ga0495602_0144832 3300048088 Bacteria 1876
579 Ga0495614_0000054 3300048089 Bacteria 35520
580 Ga0495614_0041124 3300048089 Bacteria 1983
581 Ga0496101_0365020 3300048904 Bacteria 1135
582 Ga0496102_0057635 3300048905 Bacteria 3548
583 Ga0496103_0098355 3300048906 Bacteria 1850
584 Ga0496104_0023069 3300048907 Bacteria 5719
585 Ga0496104_0127769 3300048907 Bacteria 2441
586 Ga0496104_0152717 3300048907 Bacteria 2216
587 Ga0496105_0034704 3300048908 Unclassified 4150
588 Ga0496105_0093590 3300048908 Bacteria 2482
589 Ga0496106_0140963 3300048909 Bacteria 1896
590 Ga0496106_0355252 3300048909 Bacteria 1177
591 Ga0496108_0165422 3300048911 Bacteria 1912
592 Ga0496109_0060778 3300048912 Bacteria 3453
593 Ga0496110_0022393 3300048913 Bacteria 5365
594 Ga0496111_0001291 3300048914 Bacteria 14037
595 Ga0496112_0015071 3300048915 Bacteria 7198
596 Ga0496112_0094028 3300048915 Bacteria 2968
597 Ga0496112_0303893 3300048915 Bacteria 1541
598 Ga0496112_0450964 3300048915 Bacteria 1224
599 Ga0496113_0035906 3300048916 Bacteria 3628
600 Ga0496115_0002037 3300048918 Bacteria 14464
601 Ga0496115_0174820 3300048918 Bacteria 1776
602 Ga0496126_0009051 3300048929 Bacteria 10645
603 Ga0496126_0100732 3300048929 Bacteria 2528
604 Ga0501032_0016858 3300049569 Bacteria 5134
605 Ga0501033_0006005 3300049570 Bacteria 9527
606 Ga0501034_0023544 3300049571 Bacteria 6275
607 Ga0501037_0004871 3300049573 Bacteria 9766
608 Ga0501039_0052591 3300049575 Bacteria 3151
609 Ga0501043_0001022 3300049579 Bacteria 24577
610 Ga0501046_0000748 3300049580 Bacteria 31334
611 Ga0501047_0000623 3300049581 Bacteria 37406
612 Ga0501070_0245608 3300049586 Bacteria 1465
613 Ga0501073_0004507 3300049589 Bacteria 10467
614 Ga0501035_0009187 3300049822 Bacteria 9191
615 nmdc:mga0qj67_13989_c1 3300050509 Bacteria 6060
616 nmdc:mga06r32_85715_c1 3300050510 Unclassified 3071
617 Ga0495601_0174968 3300053077 Bacteria 1403
618 2643751877 2643221546 Bacteria 2910897
619 2884217398 2884215851 Bacteria 4554841
620 Ga0207689_10117163
621 LJNas_1007075
622 Ga0065715_10121774
623 Ga0070658_10059838
624 Ga0070683_100000011
625 Ga0070683_100036638
626 Ga0070683_100043326
627 Ga0070683_100116043
628 Ga0070683_100247448
629 Ga0070690_100171491
630 Ga0070670_100115326
631 Ga0070670_100247496
632 Ga0070670_100315628
633 Ga0068869_100001437
634 Ga0068869_100043596
635 Ga0068869_100217215
636 Ga0070666_10005097
637 Ga0070666_10011905
638 Ga0070682_100096613
639 Ga0068868_100008768
640 Ga0068868_100040858
641 Ga0070660_100016512
642 Ga0070660_100023608
643 Ga0070660_100120976
644 Ga0070689_100083267
645 Ga0070689_100103055
646 Ga0070689_100204173
647 Ga0070691_10003785
648 Ga0070661_100264300
649 Ga0070692_10167810
650 Ga0070692_10219476
651 Ga0070675_100273015
652 Ga0070671_100002009
653 Ga0070671_100042485
654 Ga0070671_100068288
655 Ga0070673_100004846
656 Ga0070673_100365582
657 Ga0070659_100062256
658 Ga0070667_100014333
659 Ga0070667_100041561
660 Ga0070709_10028518
661 Ga0070709_10101931
662 Ga0070714_100000065
663 Ga0070714_100111457
664 Ga0070714_100304266
665 Ga0070713_100000118
666 Ga0070713_100001370
667 Ga0070713_100010646
668 Ga0070713_100014924
669 Ga0070713_100076236
670 Ga0070713_100177864
671 Ga0070713_100300491
672 Ga0070710_10005391
673 Ga0070710_10011160
674 Ga0070711_100000993
675 Ga0070711_100004251
676 Ga0070711_100376318
677 Ga0070663_100011716
678 Ga0070663_100340101
679 Ga0070678_100253254
680 Ga0070662_100044287
681 Ga0070662_100053325
682 Ga0070662_100145634
683 Ga0070681_10005832
684 Ga0070681_10285608
685 Ga0070681_10341380
686 Ga0068867_100008533
687 Ga0068867_100130365
688 Ga0068867_100422590
689 Ga0070706_100039055
690 Ga0070706_100043010
691 Ga0070707_100153402
692 Ga0070679_100003970
693 Ga0070679_100622976
694 Ga0070684_100000001
695 Ga0070684_100003181
696 Ga0070684_100047344
697 Ga0070684_100055763
698 Ga0070697_100420108
699 Ga0068853_100030707
700 Ga0068853_100282216
701 Ga0070686_100350227
702 Ga0070695_100095527
703 Ga0070693_100028349
704 Ga0070665_100072803
705 Ga0070665_100219339
706 Ga0068855_100028078
707 Ga0068855_100029202
708 Ga0068855_100120050
709 Ga0068855_100597740
710 Ga0070664_100048519
711 Ga0068857_100001525
712 Ga0068857_100010359
713 Ga0068857_100011601
714 Ga0068857_100078344
715 Ga0068857_100234086
716 Ga0068857_100356417
717 Ga0068854_100024257
718 Ga0068856_100001953
719 Ga0068856_100034144
720 Ga0068856_100068611
721 Ga0068856_100074873
722 Ga0068856_100258241
723 Ga0068852_100045720
724 Ga0068852_100223141
725 Ga0068859_100005424
726 Ga0068859_100011625
727 Ga0068859_100483181
728 Ga0068864_100024591
729 Ga0068864_100083465
730 Ga0068861_100035841
731 Ga0068863_100004537
732 Ga0068863_100059029
733 Ga0068863_100126850
734 Ga0068863_100240431
735 Ga0068858_100001774
736 Ga0068858_100010989
737 Ga0068858_100056200
738 Ga0068860_100000390
739 Ga0068860_100016299
740 Ga0068860_100021444
741 Ga0068860_100047210
742 Ga0068860_100085942
743 Ga0081540_1049178
744 Ga0070717_10001647
745 Ga0070717_10026829
746 Ga0070717_10043600
747 Ga0070717_10063238
748 Ga0070717_10090427
749 Ga0070717_10096111
750 Ga0075365_10016406
751 Ga0070716_100034878
752 Ga0070712_100000621
753 Ga0070712_100001749
754 Ga0097621_100002271
755 Ga0097621_100002620
756 Ga0097621_100003350
757 Ga0097621_100010151
758 Ga0097621_100062208
759 Ga0097621_100121639
760 Ga0097621_100299632
761 Ga0097621_100365161
762 Ga0068871_100003737
763 Ga0068871_100015785
764 Ga0068871_100040473
765 Ga0068871_100066075
766 Ga0068871_100157275
767 Ga0068871_100208126
768 Ga0075430_100179215
769 Ga0075431_100011469
770 Ga0068865_100011527
771 Ga0068865_100043782
772 Ga0097620_100005424
773 Ga0097620_100011625
774 Ga0097620_100030663
775 Ga0097620_100483170
776 Ga0105240_10000042
777 Ga0105240_10004528
778 Ga0105240_10018305
779 Ga0105240_10084612
780 Ga0105240_10185202
781 Ga0105240_10431104
782 Ga0111539_10717610
783 Ga0105245_10000962
784 Ga0105245_10001528
785 Ga0105245_10001723
786 Ga0105245_10006955
787 Ga0105245_10025151
788 Ga0105245_10045931
789 Ga0105245_10098586
790 Ga0105245_10308897
791 Ga0105247_10200305
792 Ga0105241_10007688
793 Ga0105241_10013137
794 Ga0105241_10049516
795 Ga0105241_10114002
796 Ga0105241_10135289
797 Ga0105241_10237368
798 Ga0105242_10003792
799 Ga0105242_10010394
800 Ga0105242_10012665
801 Ga0105242_10019579
802 Ga0105242_10035813
803 Ga0105242_10173433
804 Ga0105242_10455015
805 Ga0105248_10000826
806 Ga0105248_10001527
807 Ga0105248_10004859
808 Ga0105248_10008473
809 Ga0105248_10013169
810 Ga0105248_10017925
811 Ga0105248_10125207
812 Ga0105248_10178097
813 Ga0105248_10415265
814 Ga0105237_10025678
815 Ga0105237_10034225
816 Ga0105237_10041372
817 Ga0105237_10056009
818 Ga0105237_10078057
819 Ga0105237_10139453
820 Ga0105238_10014593
821 Ga0105238_10022125
822 Ga0105238_10040471
823 Ga0105238_10057181
824 Ga0105238_10110665
825 Ga0105238_10254881
826 Ga0105249_10049170
827 Ga0105239_10005326
828 Ga0105239_10007346
829 Ga0105239_10009528
830 Ga0105239_10010285
831 Ga0105246_10000823
832 Ga0105246_10002971
833 Ga0105246_10021041
834 Ga0105246_10033536
835 Ga0105246_10153074
836 Ga0105246_10188917
837 Ga0157371_10098822
838 Ga0157370_10010264
839 Ga0157370_10502462
840 Ga0157369_10001374
841 Ga0157369_10004817
842 Ga0157369_10045771
843 Ga0157369_10063902
844 Ga0157369_10270656
845 Ga0157369_10292477
846 Ga0157369_10361548
847 Ga0157374_10033370
848 Ga0157374_10095349
849 Ga0157374_10114272
850 Ga0157374_10207489
851 Ga0157374_10281489
852 Ga0157378_10001381
853 Ga0157378_10049527
854 Ga0157378_10053544
855 Ga0163162_10004193
856 Ga0163162_10005667
857 Ga0163162_10019825
858 Ga0163162_10031039
859 Ga0163162_10115724
860 Ga0163162_10219015
861 Ga0157372_10011786
862 Ga0157372_10012073
863 Ga0157372_10023996
864 Ga0157372_10027131
865 Ga0157372_10364100
866 Ga0157375_10002812
867 Ga0157375_10032513
868 Ga0157375_10079982
869 Ga0157375_10494181
870 Ga0163163_10006378
871 Ga0163163_10024298
872 Ga0163163_10025500
873 Ga0163163_10048771
874 Ga0163163_10062046
875 Ga0163163_10162384
876 Ga0163163_10168441
877 Ga0163163_10251466
878 Ga0163163_10385473
879 Ga0182008_10026936
880 Ga0157379_10007393
881 Ga0157379_10384558
882 Ga0157379_10431491
883 Ga0157376_10000991
884 Ga0157376_10013864
885 Ga0157376_10016520
886 Ga0157376_10061600
887 Ga0157376_10074036
888 Ga0157376_10089233
889 Ga0157376_10094963
890 Ga0157376_10209796
891 Ga0157376_10270310
892 Ga0157376_10323337
893 Ga0182006_1010975
894 Ga0213872_10004316
895 Ga0213872_10007149
896 Ga0213872_10043655
897 Ga0213871_10001487
898 Ga0224570_101021
899 Ga0224569_101006
900 Ga0224572_1001123
901 Ga0224572_1002619
902 Ga0228598_1000250
903 Ga0228598_1000568
904 Ga0228598_1002290
905 Ga0228598_1006661
906 Ga0207692_10069333
907 Ga0207642_10055478
908 Ga0207710_10128819
909 Ga0207680_10002337
910 Ga0207680_10007594
911 Ga0207680_10049501
912 Ga0207647_10001920
913 Ga0207685_10004732
914 Ga0207699_10002353
915 Ga0207699_10025116
916 Ga0207699_10089676
917 Ga0207699_10134040
918 Ga0207705_10044007
919 Ga0207705_10200127
920 Ga0207705_10262386
921 Ga0207684_10085532
922 Ga0207654_10007255
923 Ga0207654_10023009
924 Ga0207654_10035598
925 Ga0207654_10090948
926 Ga0207707_10001442
927 Ga0207707_10009834
928 Ga0207707_10319166
929 Ga0207695_10000002
930 Ga0207695_10003161
931 Ga0207695_10004204
932 Ga0207695_10015802
933 Ga0207695_10121651
934 Ga0207695_10235108
935 Ga0207671_10011281
936 Ga0207671_10012043
937 Ga0207693_10000087
938 Ga0207693_10002319
939 Ga0207663_10000771
940 Ga0207663_10005027
941 Ga0207663_10050154
942 Ga0207663_10061767
943 Ga0207657_10003252
944 Ga0207657_10055529
945 Ga0207649_10059038
946 Ga0207652_10080722
947 Ga0207646_10082450
948 Ga0207694_10001991
949 Ga0207694_10006081
950 Ga0207694_10006148
951 Ga0207694_10007023
952 Ga0207694_10039786
953 Ga0207694_10146399
954 Ga0207694_10248032
955 Ga0207650_10071580
956 Ga0207650_10142787
957 Ga0207687_10000622
958 Ga0207687_10008991
959 Ga0207687_10009395
960 Ga0207687_10016457
961 Ga0207687_10021675
962 Ga0207700_10001196
963 Ga0207700_10119982
964 Ga0207700_10190877
965 Ga0207664_10000496
966 Ga0207664_10009623
967 Ga0207664_10022516
968 Ga0207664_10175830
969 Ga0207644_10012309
970 Ga0207706_10020522
971 Ga0207706_10022622
972 Ga0207706_10040514
973 Ga0207686_10013946
974 Ga0207686_10019348
975 Ga0207686_10057109
976 Ga0207686_10141785
977 Ga0207686_10147413
978 Ga0207709_10055542
979 Ga0207709_10105936
980 Ga0207670_10245261
981 Ga0207704_10005998
982 Ga0207704_10029155
983 Ga0207704_10033812
984 Ga0207704_10122433
985 Ga0207665_10011079
986 Ga0207665_10074141
987 Ga0207711_10001054
988 Ga0207711_10001453
989 Ga0207711_10005197
990 Ga0207711_10007323
991 Ga0207711_10009300
992 Ga0207711_10021670
993 Ga0207711_10189747
994 Ga0207711_10391769
995 Ga0207689_10000166
996 Ga0207689_10128735
997 Ga0207661_10000016
998 Ga0207661_10004163
999 Ga0207661_10015537
1000 Ga0207661_10017846
1001 Ga0207661_10035860
1002 Ga0207661_10095425
1003 Ga0207661_10165165
1004 Ga0207679_10051062
1005 Ga0207679_10057721
1006 Ga0207679_10094361
1007 Ga0207679_10204034
1008 Ga0207667_10002404
1009 Ga0207667_10011243
1010 Ga0207667_10011868
1011 Ga0207667_10105110
1012 Ga0207667_10125344
1013 Ga0207667_10485377
1014 Ga0207651_10053954
1015 Ga0207712_10090732
1016 Ga0207712_10301219
1017 Ga0207640_10246744
1018 Ga0207658_10025845
1019 Ga0207677_10061926
1020 Ga0207677_10090612
1021 Ga0207677_10506978
1022 Ga0207703_10001398
1023 Ga0207703_10005501
1024 Ga0207703_10009629
1025 Ga0207703_10029671
1026 Ga0207703_10075315
1027 Ga0207639_10003599
1028 Ga0207678_10002148
1029 Ga0207702_10004748
1030 Ga0207702_10178770
1031 Ga0207702_10213598
1032 Ga0207641_10133933
1033 Ga0207641_10362684
1034 Ga0207648_10007509
1035 Ga0207648_10050550
1036 Ga0207648_10089802
1037 Ga0207648_10174980
1038 Ga0207648_10338020
1039 Ga0207676_10088109
1040 Ga0207674_10000493
1041 Ga0207674_10016507
1042 Ga0207674_10172350
1043 Ga0207674_10408367
1044 Ga0207675_100111969
1045 Ga0207683_10076187
1046 Ga0207698_10170932
1047 Ga0207698_10227289
1048 Ga0265356_1000015
1049 Ga0268265_10018474
1050 Ga0268264_10000988
1051 Ga0268264_10012229
1052 Ga0268264_10014141
1053 Ga0268264_10079535
1054 Ga0265323_10003354
1055 Ga0265338_10023768
1056 Ga0265338_10035289
1057 Ga0265338_10055840
1058 Ga0265338_10071348
1059 Ga0265762_1000483
1060 Ga0265760_10000510
1061 Ga0265760_10002913
1062 Ga0265760_10011145
1063 Ga0265760_10035805
1064 Ga0265325_10057297
1065 Ga0265331_10070740
1066 Ga0265316_10004882
1067 Ga0265316_10011307
1068 Ga0265316_10073726
1069 Ga0265316_10092209
1070 Ga0265316_10367553
1071 Ga0265313_10032951
1072 Ga0265314_10001421
1073 Ga0265314_10001752
1074 Ga0265314_10003877
1075 Ga0265314_10018921
1076 Ga0373936_0004464
1077 Ga0373954_0001623
1078 Ga0373954_0012510
1079 Ga0373954_0039950
1080 Ga0373957_0003802
1081 Ga0373957_0145391
1082 Ga0373943_0000171
1083 Ga0373955_0061612
1084 Ga0373955_0068148
1085 Ga0373955_0191378
1086 Ga0373935_0001385
1087 Ga0373935_0180263
1088 Ga0373927_0000454
1089 Ga0373927_0006299
1090 Ga0373927_0067666
1091 Ga0373933_0025736
1092 Ga0373933_0074496
1093 Ga0373947_0001248
1094 Ga0373937_0001151
1095 Ga0373937_0004958
1096 Ga0373937_0022004
1097 Ga0373937_0144471
1098 Ga0373937_0620308
1099 Ga0373925_0001175
1100 Ga0373925_0005255
1101 Ga0373925_0049045
1102 Ga0373925_0057010
1103 Ga0373925_0144630
1104 Ga0395898_0214660
1105 Ga0436364_0480896
1106 Ga0436364_1289035
1107 Ga0436365_1657733
1108 Ga0436360_0510304
1109 Ga0436360_0546468
1110 Ga0436361_0215804
1111 Ga0436361_0548546
1112 Ga0436361_0923210
1113 Ga0436363_0666147
1114 Ga0466961_0137877
1115 Ga0466964_0029156
1116 Ga0451576_0030592
1117 Ga0495592_0027142
1118 Ga0495592_0067940
1119 Ga0495603_0051006
1120 Ga0495629_0020251
1121 Ga0495629_0035458
1122 Ga0495651_0016881
1123 Ga0495651_0118090
1124 Ga0495653_0015281
1125 Ga0495580_0000470
1126 Ga0495580_0005878
1127 Ga0495580_0032832
1128 Ga0495580_0042256
1129 Ga0495580_0078689
1130 Ga0495580_0139499
1131 Ga0495580_0169309
1132 Ga0495582_0000322
1133 Ga0495582_0001074
1134 Ga0495662_0000425
1135 Ga0495664_0004702
1136 Ga0495594_0000093
1137 Ga0495594_0001164
1138 Ga0495606_0078139
1139 Ga0495608_0023005
1140 Ga0495608_0256399
1141 Ga0495630_0028614
1142 Ga0495630_0161648
1143 Ga0495644_0004451
1144 Ga0495666_0116734
1145 Ga0495652_0013665
1146 Ga0495652_0023858
1147 Ga0495652_0039813
1148 Ga0495665_0000456
1149 Ga0495640_0010608
1150 Ga0495586_0000798
1151 Ga0495587_0005464
1152 Ga0495587_0026815
1153 Ga0495645_0004187
1154 Ga0495645_0107072
1155 Ga0495645_0193952
1156 Ga0495622_0044580
1157 Ga0495667_0011906
1158 Ga0495667_0033900
1159 Ga0495667_0068113
1160 Ga0495634_0007566
1161 Ga0495635_0008967
1162 Ga0495588_0042726
1163 Ga0495599_0008739
1164 Ga0495599_0045797
1165 Ga0495623_0076094
1166 Ga0495623_0126123
1167 Ga0495646_0004513
1168 Ga0495646_0026992
1169 Ga0495658_0048042
1170 Ga0495669_0007038
1171 Ga0495613_0012267
1172 Ga0495613_0017500
1173 Ga0495624_0028297
1174 Ga0495624_0058280
1175 Ga0495600_0000182
1176 Ga0495600_0091370
1177 Ga0495581_0000827
1178 Ga0495604_0001256
1179 Ga0495674_0004545
1180 Ga0495674_0023818
1181 Ga0495674_0042549
1182 Ga0495674_0045737
1183 Ga0495674_0291651
1184 Ga0495676_0001269
1185 Ga0495676_0101525
1186 Ga0495680_0221721
1187 Ga0495675_0001092
1188 Ga0495675_0076739
1189 Ga0495675_0098839
1190 Ga0495675_0106313
1191 Ga0495675_0156698
1192 Ga0495684_0046520
1193 Ga0495684_0079825
1194 Ga0495684_0149365
1195 Ga0495602_0038205
1196 Ga0495602_0096496
1197 Ga0495602_0144832
1198 Ga0495614_0000054
1199 Ga0495614_0041124
1200 Ga0496101_0365020
1201 Ga0496102_0057635
1202 Ga0496103_0098355
1203 Ga0496104_0023069
1204 Ga0496104_0127769
1205 Ga0496104_0152717
1206 Ga0496105_0034704
1207 Ga0496105_0093590
1208 Ga0496106_0140963
1209 Ga0496106_0355252
1210 Ga0496108_0165422
1211 Ga0496109_0060778
1212 Ga0496110_0022393
1213 Ga0496111_0001291
1214 Ga0496112_0015071
1215 Ga0496112_0094028
1216 Ga0496112_0303893
1217 Ga0496112_0450964
1218 Ga0496113_0035906
1219 Ga0496115_0002037
1220 Ga0496115_0174820
1221 Ga0496126_0009051
1222 Ga0496126_0100732
1223 Ga0501032_0016858
1224 Ga0501033_0006005
1225 Ga0501034_0023544
1226 Ga0501037_0004871
1227 Ga0501039_0052591
1228 Ga0501043_0001022
1229 Ga0501046_0000748
1230 Ga0501047_0000623
1231 Ga0501070_0245608
1232 Ga0501073_0004507
1233 Ga0501035_0009187
1234 nmdc:mga0qj67_13989_c1
1235 nmdc:mga06r32_85715_c1
1236 Ga0495601_0174968
1237 2643751877
1238 2884217398

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01261

AP_endonuc_2

Xylose isomerase-like TIM barrel

68

356

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
3lmz-assembly1.cif.gz_A-2 crystal structure of putative sugar isomerase. (yp_001305105.1) from parabacteroides distasonis atcc 8503 at 1.44 a resolution 0.8525 1 307
2zds-assembly1.cif.gz_F crystal structure of sco6571 from streptomyces coelicolor a3(2) 0.8353 1 313
2zds-assembly1.cif.gz_F crystal structure of sco6571 from streptomyces coelicolor a3(2) 0.8181 1 313
3p6l-assembly1.cif.gz_A crystal structure of a sugar phosphate isomerase/epimerase (bdi_1903) from parabacteroides distasonis atcc 8503 at 1.85 a resolution 0.8142 2 307
3lmz-assembly1.cif.gz_A-2 crystal structure of putative sugar isomerase. (yp_001305105.1) from parabacteroides distasonis atcc 8503 at 1.44 a resolution 0.8016 1 307
ID Description Score Start End Superfamily
af_Q2G1E4_1_314_3.20.20.150 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.9807 1 311 3.20.20.150
af_Q2G1E4_1_314_3.20.20.150 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.9684 1 311 3.20.20.150
3lmzA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.8288 2 307 3.20.20.150
af_P45541_1_270_3.20.20.150 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.8066 1 306 3.20.20.150
3p6lA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.8047 2 307 3.20.20.150
ID Description Score Start End GO Terms
AF-A0A2V9IQ23-F1-model_v4 Xylose isomerase 0.9848 147 292 GO:0016853
AF-A0A2V9K6X6-F1-model_v4 Xylose isomerase 0.9793 1 273 GO:0016853
AF-A0A527VU07-F1-model_v4 Sugar phosphate isomerase/epimerase 0.9773 173 311 GO:0016853
AF-A0A847QT36-F1-model_v4 Sugar phosphate isomerase/epimerase 0.9764 1 252 GO:0016853
AF-A0A1R4FUZ1-F1-model_v4 Inosose isomerase (EC 5.3.99.-) 0.9747 1 317 GO:0016853

Map