F469655

General Info

Members Datasets Scaffolds Average Seq Length
617 452 360 192

Family's Representative Sequence

Representative Sequence 3300037471|Ga0395905_0003115|Ga0395905_0003115_15944_16591
Length 215
Sequence MEAGTRKGGVSRHFLSFGEQRGSMSAYPEIYLVRHGETEWTKSGRHTGRSDIPLTKAGEDAARAVAGRLPKLDFAAVWSSPSERAQRTCELAGFGAHRVVDPDLAEWDYGAYEGRTTEEIHTDRPDWQLFRDACPNGESAADVGARADAVINRIRAVNAAMLVFSSAHFLRVLGARWVGLPPEGGAHFTLDTASISVLGYEHDLTEPVIRRWNEK

Samples

Sample ID Description Type Environment
1 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
2 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
3 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
4 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
5 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
6 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
7 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
8 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
9 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
10 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
11 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
12 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
13 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
14 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
15 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
16 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
17 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
18 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
19 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
20 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
21 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
22 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
23 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
24 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
25 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
26 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
27 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
28 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
29 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
30 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
31 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
32 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
33 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
34 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
35 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
36 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
37 2643221568 Rhizobium sp. Root564 Isolate Unclassified
38 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
39 2643221599 Rhizobium sp. Root708 Isolate Unclassified
40 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
41 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
42 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
43 2718217882 Rhizobium sp. N741 Isolate Nodule
44 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
45 2718218009 Rhizobium sp. N561 Isolate Nodule
46 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
47 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
48 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
49 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
50 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
51 2718218363 Rhizobium sp. N113 Isolate Nodule
52 2718218365 Rhizobium sp. N731 Isolate Nodule
53 2718218366 Rhizobium sp. N621 Isolate Nodule
54 2721755514 Rhizobium sp. N6212 Isolate Nodule
55 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
56 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
57 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
58 2721755810 Rhizobium sp. N871 Isolate Nodule
59 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
60 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
61 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
62 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
63 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
64 2728369365 Rhizobium sp. N1341 Isolate Nodule
65 2728369397 Rhizobium sp. N1314 Isolate Nodule
66 2738541293 Rhizobium sp. GV031 Isolate Unclassified
67 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
68 2765235802 Phyllobacterium bourgognense 31-25a Isolate Rhizoplane
69 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
70 2767802442 Phyllobacterium brassicacearum 29-15 Isolate Rhizoplane
71 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
72 2791355256 Rhizobium sp. M10 Isolate Nodule
73 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
74 2791355260 Rhizobium sp. L9 Isolate Nodule
75 2791355261 Rhizobium sp. J15 Isolate Nodule
76 2791355262 Rhizobium sp. M1 Isolate Nodule
77 2791355263 Rhizobium chutanense C5 Isolate Nodule
78 2791355264 Rhizobium sp. S9 Isolate Nodule
79 2791355265 Rhizobium sp. H4 Isolate Nodule
80 2791355266 Rhizobium sp. L43 Isolate Nodule
81 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
82 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
83 2802429633 Rhizobium anhuiense J3 Isolate Nodule
84 2802429634 Rhizobium anhuiense S10 Isolate Nodule
85 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
86 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
87 2802429637 Rhizobium anhuiense C15 Isolate Nodule
88 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
89 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
90 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
91 2838048938 Rhizobium pisi 27/80 Isolate Nodule
92 2838061910 Rhizobium phaseoli L15 Isolate Nodule
93 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
94 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
95 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
96 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
97 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
98 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
99 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
100 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
101 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
102 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
103 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
104 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
105 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
106 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
107 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
108 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
109 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
110 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
111 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
112 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
113 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
114 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
115 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
116 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
117 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
118 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
119 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
120 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
121 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
122 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
123 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
124 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
125 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
126 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
127 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
128 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
129 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
130 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
131 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
132 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
133 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
134 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
135 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
136 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
137 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
138 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
139 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
140 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
141 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
142 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
143 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
144 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
145 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
146 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
147 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
148 2869169390 Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 Isolate Nodule
149 2869234852 Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 Isolate Nodule
150 2869242130 Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 Isolate Nodule
151 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
152 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
153 2871435913 Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 Isolate Nodule
154 2871481445 Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 Isolate Nodule
155 2874109183 Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 Isolate Nodule
156 2874116593 Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 Isolate Nodule
157 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
158 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
159 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
160 2876406927 Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 Isolate Nodule
161 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
162 2878730984 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 Isolate Nodule
163 2878774303 Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 Isolate Nodule
164 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
165 2885334103 Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 Isolate Nodule
166 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
167 2903513507 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 Isolate Nodule
168 2904578770 Phyllobacterium sp. 586 Isolate Unclassified
169 2906386501 Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 Isolate Nodule
170 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
171 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
172 2906427513 Mesorhizobium sp. M7A.F.Ca.CA.004.05.1.1 Isolate Nodule
173 2919119836 Phyllobacterium sp. 1468 Isolate Rhizosphere
174 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
175 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
176 2924710171 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 Isolate Nodule
177 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
178 2924741084 Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 Isolate Nodule
179 2924748358 Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 Isolate Nodule
180 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
181 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
182 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
183 2933599457 Rhizobium phaseoli M3 Isolate Nodule
184 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
185 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
186 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
187 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
188 2936381700 Rhizobium chutanense C16 Isolate Unclassified
189 2937861824 Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 Isolate Nodule
190 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
191 2937980651 Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 Isolate Nodule
192 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
193 2958100919 Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 Isolate Nodule
194 2958108152 Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 Isolate Nodule
195 2958137437 Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 Isolate Nodule
196 2958158011 Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 Isolate Nodule
197 2958172287 Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 Isolate Nodule
198 2961136820 Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 Isolate Nodule
199 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
200 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
201 2965047637 Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 Isolate Nodule
202 2965102966 Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 Isolate Nodule
203 2965119406 Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 Isolate Nodule
204 2968138860 Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 Isolate Nodule
205 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
206 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
207 2970532167 Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 Isolate Nodule
208 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
209 2970619444 Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 Isolate Nodule
210 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
211 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
212 2977898635 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 Isolate Nodule
213 2977907340 Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 Isolate Nodule
214 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
215 2978969890 Agrobacterium sp. SORGH_AS 787 Isolate Unclassified
216 2979710463 Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 Isolate Nodule
217 2979764755 Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 Isolate Nodule
218 2979772303 Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 Isolate Nodule
219 2987645492 Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 Isolate Nodule
220 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
221 2996887358 Rhizobium sp. R711 Isolate Nodule
222 3004167301 Mesorhizobium loti 582 Isolate Unclassified
223 3004232784 Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 Isolate Nodule
224 3004248173 Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 Isolate Nodule
225 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
226 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
227 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
228 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
229 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
230 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
231 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
232 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
233 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
234 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
235 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
236 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
237 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
238 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
239 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
240 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
241 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
242 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
243 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
244 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
245 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
246 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
247 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
248 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
249 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
250 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
251 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
252 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
253 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
254 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
255 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
256 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
257 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
258 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
259 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
260 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
261 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
262 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
263 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
264 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
265 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
266 3300009763 Root nodule microbial communities of legume samples collected from Mexico - Siratro Mexico nodule mix Metagenome Nodule
267 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
268 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
269 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
270 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
271 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
272 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
273 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
274 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
275 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
276 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
277 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
278 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
279 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
280 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
281 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
282 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
283 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
284 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
285 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
286 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
287 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
288 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
289 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
290 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
291 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
292 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
293 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
294 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
295 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
296 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
297 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
298 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
299 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
300 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
301 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
302 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
303 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
304 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
305 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
306 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
307 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
308 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
309 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
310 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
311 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
312 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
313 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
314 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
315 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
316 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
317 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
318 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
319 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
320 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
321 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
322 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
323 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
324 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
325 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
326 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
327 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
328 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
329 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
330 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
331 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
332 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
333 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
334 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
335 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
336 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
337 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
338 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
339 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
340 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
341 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
342 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
343 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
344 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
345 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
346 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
347 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
348 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
349 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
350 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
351 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
352 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
353 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
354 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
355 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
356 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
357 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
358 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
359 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
360 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
361 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
362 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
363 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
364 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
365 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
366 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
367 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
368 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
369 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
370 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
371 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
372 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
373 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
374 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
375 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
376 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
377 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
378 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
379 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
380 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
381 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
382 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
383 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
384 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
385 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
386 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
387 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
388 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
389 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
390 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
391 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
392 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
393 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
394 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
395 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
396 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
397 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
398 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
399 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
400 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
401 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
402 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
403 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
404 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
405 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
406 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
407 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
408 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
409 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
410 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
411 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
412 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
413 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
414 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
415 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
416 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
417 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
418 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
419 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
420 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
421 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
422 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
423 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
424 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
425 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
426 8004312739 Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 Isolate Nodule
427 8004695233 Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 Isolate Nodule
428 8004727605 Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 Isolate Nodule
429 8005258706 Rhizobium sp. R693 Isolate Nodule
430 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
431 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
432 8005321885 Rhizobium sp. R72 Isolate Nodule
433 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
434 8005382845 Rhizobium sp. R634 Isolate Nodule
435 8005395548 Rhizobium sp. R339 Isolate Nodule
436 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
437 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
438 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
439 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
440 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
441 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
442 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
443 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
444 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
445 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
446 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
447 8018176218 Rhizobium sp. N122 Isolate Nodule
448 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
449 8024501048 Rhizobium sp. H4 Isolate Nodule
450 8054460903 Agrobacterium vaccinii B7.6 Isolate Unclassified
451 8056382006 Rhizobium croatiense 13T Isolate Nodule
452 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 58.35
Metatranscriptomes 0
Isolates 41.65

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 21.72
Nodule 35.82
Rhizoplane 2.43
Rhizosphere 25.61
Stem 0
Stem Tuber 0
Unclassified 14.42

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25152J39213_1000719 3300002773 Bacteria 17140
2 JGI25152J39213_1004096 3300002773 Bacteria 4723
3 JGI25152J39213_1010296 3300002773 Bacteria 2153
4 JGI25150J39212_1000113 3300002774 Bacteria 45916
5 JGI25159J45721_1000600 3300002987 Bacteria 16096
6 JGI25151J46595_10000099 3300003187 Bacteria 117428
7 JGI25151J46595_10000307 3300003187 Bacteria 53542
8 JGI25151J46595_10000400 3300003187 Bacteria 45092
9 JGI25151J46595_10007513 3300003187 Bacteria 5330
10 JGI25406J46586_10006582 3300003203 Bacteria 5341
11 JGI25153J46596_10000896 3300003215 Bacteria 18118
12 JGI25153J46596_10009283 3300003215 Bacteria 4596
13 JGI25153J46596_10024752 3300003215 Bacteria 2158
14 rootH1_10009379 3300003316 Bacteria 3130
15 rootH2_10050910 3300003320 Bacteria 4580
16 rootH1_10023402 3300003323 Bacteria 5112
17 rootH1_10023403 3300003323 Bacteria 4119
18 JGI25160J50197_1002218 3300003354 Bacteria 9120
19 JGI25160J50197_1002794 3300003354 Bacteria 7992
20 JGI25160J50197_1006348 3300003354 Bacteria 4799
21 JGI25160J50197_1022131 3300003354 Bacteria 1870
22 JGI25161J50226_1000340 3300003374 Bacteria 25075
23 JGI25161J50226_1004091 3300003374 Bacteria 3136
24 Ga0055526_1000847 3300003771 Bacteria 22826
25 Ga0055526_1013343 3300003771 Bacteria 3486
26 Ga0055526_1014187 3300003771 Bacteria 3298
27 Ga0055524_1001577 3300003775 Bacteria 12790
28 Ga0055524_1002213 3300003775 Bacteria 10203
29 Ga0055524_1002406 3300003775 Bacteria 9692
30 Ga0055524_1012047 3300003775 Bacteria 3342
31 Ga0055528_1000263 3300003790 Bacteria 44623
32 Ga0055528_1002773 3300003790 Bacteria 9187
33 Ga0055528_1006250 3300003790 Bacteria 5419
34 Ga0055528_1013654 3300003790 Bacteria 3061
35 Ga0055540_1011649 3300003792 Bacteria 2816
36 Ga0055540_1022119 3300003792 Bacteria 1633
37 Ga0055543_1000370 3300004625 Bacteria 29795
38 Ga0055543_1001122 3300004625 Bacteria 11495
39 Ga0065165_1012699 3300005262 Bacteria 3410
40 Ga0070682_100159178 3300005337 Bacteria 1558
41 Ga0070668_100162757 3300005347 Bacteria 1811
42 Ga0070667_100087817 3300005367 Bacteria 2669
43 Ga0070665_100085438 3300005548 Bacteria 3161
44 Ga0070665_100265563 3300005548 Bacteria 1718
45 Ga0068860_100722668 3300005843 Unclassified 1006
46 Ga0068862_100251754 3300005844 Bacteria 1610
47 Ga0068862_100861676 3300005844 Unclassified 888
48 Ga0081540_1005582 3300005983 Bacteria 9368
49 Ga0081539_10000646 3300005985 Bacteria 70179
50 Ga0075365_10013463 3300006038 Bacteria 4894
51 Ga0075365_10017919 3300006038 Bacteria 4345
52 Ga0075365_10145049 3300006038 Bacteria 1649
53 Ga0075368_10007457 3300006042 Bacteria 3859
54 Ga0075363_100292441 3300006048 Bacteria 944
55 Ga0075362_10007209 3300006177 Bacteria 4194
56 Ga0075367_10004881 3300006178 Bacteria 6602
57 Ga0075367_10369083 3300006178 Bacteria 906
58 Ga0075369_10001799 3300006186 Bacteria 7461
59 Ga0075369_10015860 3300006186 Bacteria 3031
60 Ga0075366_10006410 3300006195 Bacteria 6449
61 Ga0075370_10046285 3300006353 Bacteria 2462
62 Ga0075370_10084529 3300006353 Bacteria 1826
63 Ga0075436_100192215 3300006914 Unclassified 1444
64 Ga0105251_10014918 3300009011 Bacteria 4268
65 Ga0105243_10255490 3300009148 Bacteria 1567
66 Ga0105248_10157189 3300009177 Bacteria 2565
67 Ga0123340_1033737 3300009763 Bacteria 2864
68 Ga0123341_1000027 3300009765 Bacteria 69241
69 Ga0123341_1088946 3300009765 Bacteria 1127
70 Ga0123342_1004498 3300009766 Bacteria 21205
71 Ga0123342_1019697 3300009766 Bacteria 5086
72 Ga0105239_10326956 3300010375 Bacteria 1729
73 Ga0105246_11077372 3300011119 Unclassified 732
74 Ga0157371_10009193 3300013102 Bacteria 7802
75 Ga0157369_10073641 3300013105 Bacteria 3664
76 Ga0157378_10380762 3300013297 Bacteria 1385
77 Ga0209436_100002 3300025208 Bacteria 222172
78 Ga0209147_101611 3300025229 Bacteria 7569
79 Ga0207425_1000012 3300025245 Bacteria 528324
80 Ga0207425_1000661 3300025245 Bacteria 18898
81 Ga0207425_1003147 3300025245 Bacteria 5406
82 Ga0207425_1017992 3300025245 Bacteria 1541
83 Ga0209129_1000086 3300025258 Bacteria 181543
84 Ga0209129_1000299 3300025258 Bacteria 46326
85 Ga0209129_1000428 3300025258 Bacteria 31778
86 Ga0209129_1003133 3300025258 Bacteria 7418
87 Ga0209129_1005022 3300025258 Bacteria 4867
88 Ga0209129_1006286 3300025258 Bacteria 3900
89 Ga0209129_1006828 3300025258 Bacteria 3567
90 Ga0209129_1028708 3300025258 Bacteria 943
91 Ga0209673_1000091 3300025273 Bacteria 201875
92 Ga0209673_1000122 3300025273 Bacteria 170443
93 Ga0209673_1002379 3300025273 Bacteria 13215
94 Ga0209673_1003335 3300025273 Bacteria 9604
95 Ga0209673_1004550 3300025273 Bacteria 7375
96 Ga0209673_1074848 3300025273 Bacteria 794
97 Ga0209130_1000015 3300025284 Bacteria 409631
98 Ga0209130_1000536 3300025284 Bacteria 38224
99 Ga0209675_1024774 3300025291 Bacteria 1526
100 Ga0209676_1021572 3300025292 Bacteria 2158
101 Ga0209025_1000024 3300025294 Bacteria 528324
102 Ga0209025_1000486 3300025294 Bacteria 76804
103 Ga0209025_1000549 3300025294 Bacteria 70203
104 Ga0209025_1008001 3300025294 Bacteria 7716
105 Ga0209025_1010280 3300025294 Bacteria 6362
106 Ga0209025_1015433 3300025294 Bacteria 4605
107 Ga0209025_1028202 3300025294 Bacteria 2760
108 Ga0209025_1044118 3300025294 Bacteria 1868
109 Ga0209564_1000398 3300025295 Bacteria 77724
110 Ga0209564_1000988 3300025295 Bacteria 35558
111 Ga0209564_1002868 3300025295 Bacteria 12650
112 Ga0209564_1005714 3300025295 Bacteria 6968
113 Ga0209564_1010230 3300025295 Bacteria 4350
114 Ga0209758_1000046 3300025297 Bacteria 364931
115 Ga0209758_1000325 3300025297 Bacteria 91078
116 Ga0209758_1009106 3300025297 Bacteria 6260
117 Ga0209758_1011789 3300025297 Bacteria 5005
118 Ga0209758_1019683 3300025297 Bacteria 3240
119 Ga0209758_1027852 3300025297 Bacteria 2405
120 Ga0209256_1000870 3300025299 Bacteria 37394
121 Ga0209256_1001197 3300025299 Bacteria 29055
122 Ga0209256_1004855 3300025299 Bacteria 8122
123 Ga0209256_1011271 3300025299 Bacteria 3601
124 Ga0209256_1014447 3300025299 Bacteria 2840
125 Ga0209256_1044046 3300025299 Bacteria 1116
126 Ga0207426_1000063 3300025302 Bacteria 358920
127 Ga0207426_1000092 3300025302 Bacteria 278907
128 Ga0207426_1000144 3300025302 Bacteria 191590
129 Ga0207426_1003637 3300025302 Bacteria 8158
130 Ga0209051_1003848 3300025303 Bacteria 9604
131 Ga0209051_1010653 3300025303 Bacteria 4614
132 Ga0209051_1028844 3300025303 Bacteria 2183
133 Ga0209257_1033001 3300025304 Bacteria 1633
134 Ga0207711_10113871 3300025941 Bacteria 2408
135 Ga0207658_10032047 3300025986 Bacteria 3737
136 Ga0207658_10311256 3300025986 Bacteria 1360
137 Ga0207683_10449883 3300026121 Unclassified 1187
138 Ga0268266_10069239 3300028379 Bacteria 3057
139 Ga0268266_10410609 3300028379 Bacteria 1282
140 Ga0268264_10438327 3300028381 Bacteria 1263
141 Ga0307515_10314920 3300028794 Bacteria 1236
142 Ga0265338_10000158 3300028800 Bacteria 123828
143 Ga0265338_10010680 3300028800 Bacteria 10730
144 Ga0265329_10042348 3300031242 Bacteria 1459
145 Ga0265331_10053032 3300031250 Bacteria 1936
146 Ga0265316_10040547 3300031344 Bacteria 3732
147 Ga0307508_10028066 3300031616 Bacteria 5092
148 Ga0265342_10021480 3300031712 Bacteria 4120
149 Ga0307405_10021028 3300031731 Bacteria 3660
150 Ga0307406_10012742 3300031901 Bacteria 4798
151 Ga0307412_10000706 3300031911 Bacteria 19233
152 Ga0395905_0003115 3300037471 Bacteria 17894
153 Ga0395905_0009500 3300037471 Bacteria 9504
154 Ga0436364_0372666 3300037853 Unclassified 701
155 Ga0436365_0144244 3300039437 Bacteria 2505
156 Ga0439465_0006613 3300041413 Bacteria 3683
157 Ga0439465_0007923 3300041413 Bacteria 3366
158 Ga0451833_0455905 3300041491 Bacteria 1303
159 Ga0451835_0448481 3300041492 Bacteria 2118
160 Ga0451837_0761505 3300041494 Bacteria 1623
161 Ga0451837_0925794 3300041494 Bacteria 817
162 Ga0451841_0084931 3300041498 Bacteria 617
163 Ga0451841_0491014 3300041498 Bacteria 2781
164 Ga0451849_0681332 3300041505 Bacteria 2490
165 Ga0451851_0363179 3300041507 Bacteria 1259
166 Ga0451855_0000203 3300041511 Bacteria 2003
167 Ga0451855_0346123 3300041511 Bacteria 1103
168 Ga0439432_024681 3300042006 Bacteria 1976
169 Ga0439449_0081017 3300042007 Bacteria 1197
170 Ga0466966_0029705 3300044684 Bacteria 3554
171 Ga0466963_0020974 3300044694 Bacteria 4116
172 Ga0466970_0035800 3300044765 Bacteria 2629
173 Ga0466957_0011840 3300044842 Bacteria 5043
174 Ga0466958_0107461 3300045836 Bacteria 1740
175 Ga0466967_0267483 3300045976 Bacteria 1637
176 Ga0495617_023639 3300046452 Bacteria 2076
177 Ga0495638_0000120 3300046460 Bacteria 127382
178 Ga0495638_0006796 3300046460 Bacteria 8268
179 Ga0495638_0057324 3300046460 Bacteria 2416
180 Ga0495651_0144434 3300046462 Bacteria 1722
181 Ga0495650_0067192 3300046471 Bacteria 1417
182 Ga0495662_0035918 3300046476 Bacteria 2392
183 Ga0495585_0027350 3300046492 Bacteria 3255
184 Ga0495585_0049012 3300046492 Bacteria 2347
185 Ga0495596_0087568 3300046500 Bacteria 1209
186 Ga0495607_0060667 3300046501 Bacteria 2152
187 Ga0495607_0072410 3300046501 Bacteria 1918
188 Ga0495583_0027075 3300046506 Bacteria 2832
189 Ga0495583_0030746 3300046506 Bacteria 2611
190 Ga0495583_0053867 3300046506 Bacteria 1824
191 Ga0495606_0081274 3300046507 Bacteria 2015
192 Ga0495606_0138065 3300046507 Bacteria 1442
193 Ga0495606_0193999 3300046507 Bacteria 1162
194 Ga0495610_0013694 3300046512 Bacteria 4805
195 Ga0495610_0033712 3300046512 Bacteria 2644
196 Ga0495610_0051056 3300046512 Bacteria 2015
197 Ga0495610_0167306 3300046512 Bacteria 925
198 Ga0495620_0006882 3300046515 Bacteria 6212
199 Ga0495620_0033010 3300046515 Bacteria 2353
200 Ga0495628_0633053 3300046516 Bacteria 761
201 Ga0495631_0002712 3300046518 Bacteria 9820
202 Ga0495631_0021310 3300046518 Bacteria 3018
203 Ga0495631_0037997 3300046518 Bacteria 2142
204 Ga0495632_0129638 3300046519 Bacteria 1174
205 Ga0495643_0122158 3300046522 Bacteria 1314
206 Ga0495648_0065736 3300046524 Bacteria 2130
207 Ga0495648_0240397 3300046524 Bacteria 880
208 Ga0495663_0194601 3300046525 Bacteria 706
209 Ga0495652_0349528 3300046529 Bacteria 1060
210 Ga0495654_0053752 3300046530 Bacteria 1956
211 Ga0495640_0102816 3300046533 Bacteria 1874
212 Ga0495597_0230683 3300046542 Bacteria 732
213 Ga0495633_0023116 3300046558 Bacteria 3081
214 Ga0495633_0277575 3300046558 Bacteria 762
215 Ga0495668_0055721 3300046616 Bacteria 2183
216 Ga0495668_0097015 3300046616 Bacteria 1613
217 Ga0495668_0108202 3300046616 Bacteria 1520
218 Ga0495668_0110924 3300046616 Bacteria 1500
219 Ga0495611_0142942 3300046648 Bacteria 1117
220 Ga0495625_0027962 3300046660 Bacteria 4234
221 Ga0495625_0040933 3300046660 Bacteria 3375
222 Ga0495625_0393847 3300046660 Bacteria 867
223 Ga0495635_0050738 3300046663 Bacteria 2860
224 Ga0495661_0240758 3300046665 Bacteria 928
225 Ga0495588_0027620 3300046674 Bacteria 2837
226 Ga0495657_0053881 3300046675 Bacteria 2689
227 Ga0495658_0129024 3300046683 Bacteria 1537
228 Ga0495669_0050650 3300046684 Bacteria 1863
229 Ga0495670_0098550 3300046691 Bacteria 1503
230 Ga0495670_0219455 3300046691 Bacteria 1010
231 Ga0495671_0097777 3300046692 Bacteria 1435
232 Ga0495600_0421315 3300046809 Bacteria 828
233 Ga0495604_0044465 3300047317 Bacteria 3469
234 Ga0495672_0042075 3300047320 Bacteria 2757
235 Ga0495676_0284779 3300047321 Bacteria 1118
236 Ga0495687_034805 3300047443 Bacteria 2271
237 Ga0495687_065914 3300047443 Bacteria 1473
238 Ga0495685_188320 3300047447 Bacteria 663
239 Ga0495673_0056689 3300047469 Bacteria 1694
240 Ga0495673_0180110 3300047469 Bacteria 801
241 Ga0495681_0078124 3300047470 Bacteria 1484
242 Ga0495686_0000574 3300047472 Bacteria 52228
243 Ga0495686_0006479 3300047472 Bacteria 8951
244 Ga0495686_0021442 3300047472 Bacteria 4290
245 Ga0495686_0027674 3300047472 Bacteria 3700
246 Ga0495686_0037989 3300047472 Bacteria 3082
247 Ga0495686_0182308 3300047472 Bacteria 1216
248 Ga0495686_0216338 3300047472 Bacteria 1092
249 Ga0495626_0041063 3300048091 Bacteria 2182
250 Ga0496101_0602768 3300048904 Bacteria 868
251 Ga0496103_0114154 3300048906 Bacteria 1717
252 Ga0496104_0144308 3300048907 Bacteria 2286
253 Ga0496105_0064795 3300048908 Bacteria 3015
254 Ga0496106_0002429 3300048909 Bacteria 13873
255 Ga0496106_0076372 3300048909 Bacteria 2568
256 Ga0496107_0149063 3300048910 Bacteria 1730
257 Ga0496107_0597807 3300048910 Bacteria 815
258 Ga0496108_0032193 3300048911 Bacteria 4354
259 Ga0496110_0103764 3300048913 Bacteria 2550
260 Ga0496111_0169268 3300048914 Bacteria 1623
261 Ga0496114_0162730 3300048917 Bacteria 1941
262 Ga0496114_0221381 3300048917 Bacteria 1661
263 Ga0496116_0014842 3300048919 Bacteria 6191
264 Ga0496116_0042587 3300048919 Bacteria 3101
265 Ga0496116_0052283 3300048919 Bacteria 2707
266 Ga0496116_0070138 3300048919 Bacteria 2225
267 Ga0496116_0155569 3300048919 Bacteria 1262
268 Ga0496116_0255233 3300048919 Bacteria 869
269 Ga0496116_0257811 3300048919 Bacteria 862
270 Ga0496116_0269265 3300048919 Bacteria 834
271 Ga0496117_0035746 3300048920 Bacteria 3725
272 Ga0496117_0046214 3300048920 Bacteria 3134
273 Ga0496117_0150448 3300048920 Bacteria 1378
274 Ga0496118_0015498 3300048921 Bacteria 7053
275 Ga0496118_0034033 3300048921 Bacteria 4168
276 Ga0496118_0158695 3300048921 Bacteria 1402
277 Ga0496118_0258947 3300048921 Bacteria 983
278 Ga0496119_0046438 3300048922 Bacteria 2712
279 Ga0496119_0157514 3300048922 Bacteria 1211
280 Ga0496119_0346972 3300048922 Bacteria 720
281 Ga0496120_0104105 3300048923 Bacteria 1494
282 Ga0496121_0012624 3300048924 Bacteria 9178
283 Ga0496121_0045578 3300048924 Bacteria 3765
284 Ga0496121_0255165 3300048924 Bacteria 1214
285 Ga0496121_0430953 3300048924 Bacteria 855
286 Ga0496121_0618978 3300048924 Bacteria 665
287 Ga0496121_0710982 3300048924 Bacteria 603
288 Ga0496122_0039586 3300048925 Bacteria 3757
289 Ga0496122_0049541 3300048925 Bacteria 3214
290 Ga0496122_0073230 3300048925 Bacteria 2430
291 Ga0496122_0075663 3300048925 Bacteria 2373
292 Ga0496122_0178985 3300048925 Bacteria 1267
293 Ga0496122_0288178 3300048925 Bacteria 893
294 Ga0496123_0003764 3300048926 Bacteria 16630
295 Ga0496123_0041068 3300048926 Bacteria 3212
296 Ga0496123_0085538 3300048926 Bacteria 1896
297 Ga0496123_0151662 3300048926 Bacteria 1249
298 Ga0496124_0000080 3300048927 Bacteria 210439
299 Ga0496124_0002814 3300048927 Bacteria 22034
300 Ga0496124_0046840 3300048927 Bacteria 3701
301 Ga0496124_0047156 3300048927 Bacteria 3687
302 Ga0496124_0070860 3300048927 Bacteria 2890
303 Ga0496125_0064358 3300048928 Bacteria 2914
304 Ga0496125_0086944 3300048928 Bacteria 2362
305 Ga0496125_0416959 3300048928 Bacteria 779
306 Ga0496126_0000397 3300048929 Bacteria 89305
307 Ga0496126_0027499 3300048929 Bacteria 5432
308 Ga0496126_0148276 3300048929 Bacteria 2013
309 Ga0496126_0264790 3300048929 Bacteria 1428
310 Ga0495678_035709 3300049459 Bacteria 2035
311 Ga0495682_0058866 3300049460 Bacteria 1389
312 Ga0501032_0052810 3300049569 Bacteria 2738
313 Ga0501032_0268602 3300049569 Bacteria 1105
314 Ga0501033_0025686 3300049570 Bacteria 4437
315 Ga0501033_0193153 3300049570 Bacteria 1456
316 Ga0501034_0187283 3300049571 Bacteria 2032
317 Ga0501034_0190957 3300049571 Bacteria 2010
318 Ga0501034_0272686 3300049571 Bacteria 1633
319 Ga0501037_0110108 3300049573 Bacteria 1984
320 Ga0501039_0395577 3300049575 Bacteria 1085
321 Ga0501043_0031218 3300049579 Bacteria 4189
322 Ga0501047_0065497 3300049581 Bacteria 3503
323 Ga0501047_0255961 3300049581 Bacteria 1599
324 Ga0501048_0090622 3300049582 Bacteria 2157
325 Ga0501080_0574771 3300049742 Bacteria 1002
326 Ga0501083_0119832 3300049744 Bacteria 1726
327 Ga0501035_0019983 3300049822 Bacteria 6153
328 Ga0501044_0016192 3300049823 Bacteria 8014
329 Ga0501044_1090049 3300049823 Bacteria 668
330 nmdc:mga0yw44_117962_c1 3300050492 Bacteria 1707
331 nmdc:mga0yw44_18665_c1 3300050492 Bacteria 3805
332 nmdc:mga0yw44_65461_c1 3300050492 Bacteria 2240
333 nmdc:mga0yw44_91120_c1 3300050492 Bacteria 1927
334 nmdc:mga0k408_26109_c1 3300050493 Bacteria 3311
335 nmdc:mga06z11_72800_c1 3300050494 Bacteria 1823
336 nmdc:mga07m45_142005_c1 3300050496 Bacteria 1391
337 nmdc:mga07m45_31101_c1 3300050496 Bacteria 2957
338 nmdc:mga0sz30_58525_c1 3300050516 Bacteria 1643
339 Ga0500651_0203373 3300053093 Bacteria 1168
340 Ga0500557_001951 3300053105 Bacteria 3603
341 Ga0500618_006932 3300053125 Bacteria 3277
342 Ga0500658_0002074 3300053134 Bacteria 7797
343 Ga0500658_0023802 3300053134 Bacteria 2341
344 Ga0500559_0016091 3300053136 Bacteria 3158
345 Ga0500568_0000323 3300053139 Bacteria 37840
346 Ga0500568_0000489 3300053139 Bacteria 29208
347 Ga0500568_0005825 3300053139 Bacteria 6283
348 Ga0500573_0367051 3300053140 Unclassified 693
349 Ga0500590_001175 3300053148 Bacteria 10367
350 Ga0500604_0011455 3300053151 Bacteria 2381
351 Ga0500616_0028632 3300053153 Bacteria 3068
352 Ga0500616_0245422 3300053153 Bacteria 767
353 Ga0500624_020823 3300053157 Unclassified 1054
354 Ga0500627_0093484 3300053158 Bacteria 1346
355 Ga0500627_0155717 3300053158 Bacteria 1032
356 Ga0500633_0001242 3300053160 Bacteria 4685
357 Ga0500634_0002883 3300053161 Bacteria 7454
358 Ga0500636_0000001 3300053177 Bacteria 324086
359 Ga0500645_014839 3300053730 Bacteria 2478
360 Ga0466962_0029026 3300061719 Bacteria 2648

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300006914 Ga0075436_100192215 Ga0075436_1001922152 170
2 3300053140 Ga0500573_0367051 Ga0500573_0367051_121_645 173
3 3300003790 Ga0055528_1013654 Ga0055528_10136543 175
4 3300031242 Ga0265329_10042348 Ga0265329_100423483 184
5 iso_pu_bacteria 2510917030 2511196119 187
6 iso_pu_bacteria 2767802442 2770197774 187
7 iso_pu_bacteria 3005445848 3005446327 187
8 iso_pu_bacteria 2509276033 2509443827 188
9 iso_pu_bacteria 2510065019 2510131642 188
10 iso_pu_bacteria 2510461076 2510897935 188
11 iso_pu_bacteria 2510917028 2511183654 188
12 iso_pu_bacteria 2513237084 2513571220 188
13 iso_pu_bacteria 2513237085 2513579239 188
14 iso_pu_bacteria 2513237088 2513598498 188
15 iso_pu_bacteria 2513237093 2513632315 188
16 iso_pu_bacteria 2513237103 2513711639 188
17 iso_pu_bacteria 2513237144 2513907937 188
18 iso_pu_bacteria 2513237146 2513927595 188
19 iso_pu_bacteria 2513237162 2514020859 188
20 iso_pu_bacteria 2515075009 2515110569 188
21 iso_pu_bacteria 2515154113 2515639258 188
22 iso_pu_bacteria 2515154114 2515647080 188
23 iso_pu_bacteria 2515154116 2515659454 188
24 iso_pu_bacteria 2515154134 2515742931 188
25 iso_pu_bacteria 2516653077 2517039266 188
26 iso_pu_bacteria 2516653085 2517079509 188
27 iso_pu_bacteria 2517093000 2517093456 188
28 iso_pu_bacteria 2529292951 2530647644 188
29 iso_pu_bacteria 2534681796 2535515247 188
30 iso_pu_bacteria 2582581294 2585204024 188
31 iso_pu_bacteria 2582581298 2585225714 188
32 iso_pu_bacteria 2582581299 2585229137 188
33 iso_pu_bacteria 2582581304 2585257044 188
34 iso_pu_bacteria 2582581867 2585403926 188
35 iso_pu_bacteria 2585427526 2585528461 188
36 iso_pu_bacteria 2585427528 2585539854 188
37 iso_pu_bacteria 2585427529 2585548011 188
38 iso_pu_bacteria 2585427590 2585825250 188
39 iso_pu_bacteria 2585427593 2585837835 188
40 iso_pu_bacteria 2585427594 2585844487 188
41 iso_pu_bacteria 2599185170 2599419026 188
42 iso_pu_bacteria 2615840624 2616295827 188
43 iso_pu_bacteria 2643221568 2643854437 188
44 iso_pu_bacteria 2643221595 2643987703 188
45 iso_pu_bacteria 2643221599 2644007497 188
46 iso_pu_bacteria 2643221627 2644156685 188
47 iso_pu_bacteria 2643221634 2644190751 188
48 iso_pu_bacteria 2687453392 2688598080 188
49 iso_pu_bacteria 2718217882 2719179722 188
50 iso_pu_bacteria 2718217997 2719664073 188
51 iso_pu_bacteria 2718218009 2719730392 188
52 iso_pu_bacteria 2718218199 2720490492 188
53 iso_pu_bacteria 2718218232 2720611872 188
54 iso_pu_bacteria 2718218233 2720618726 188
55 iso_pu_bacteria 2718218235 2720630126 188
56 iso_pu_bacteria 2718218269 2720773821 188
57 iso_pu_bacteria 2718218363 2721145815 188
58 iso_pu_bacteria 2718218365 2721157348 188
59 iso_pu_bacteria 2718218366 2721162694 188
60 iso_pu_bacteria 2721755514 2722838864 188
61 iso_pu_bacteria 2721755556 2723025491 188
62 iso_pu_bacteria 2721755684 2723559074 188
63 iso_pu_bacteria 2721755685 2723565681 188
64 iso_pu_bacteria 2721755810 2724043148 188
65 iso_pu_bacteria 2721755819 2724088428 188
66 iso_pu_bacteria 2721755822 2724102946 188
67 iso_pu_bacteria 2721755823 2724108809 188
68 iso_pu_bacteria 2724679232 2725948316 188
69 iso_pu_bacteria 2728369352 2730106427 188
70 iso_pu_bacteria 2728369365 2730162959 188
71 iso_pu_bacteria 2728369397 2730296980 188
72 iso_pu_bacteria 2738541293 2738803672 188
73 iso_pu_bacteria 2738541333 2739034711 188
74 iso_pu_bacteria 2765235802 2765464727 188
75 iso_pu_bacteria 2765235942 2766062378 188
76 iso_pu_bacteria 2791355123 2792752381 188
77 iso_pu_bacteria 2791355256 2793295060 188
78 iso_pu_bacteria 2791355259 2793315269 188
79 iso_pu_bacteria 2791355260 2793320127 188
80 iso_pu_bacteria 2791355261 2793328245 188
81 iso_pu_bacteria 2791355262 2793332588 188
82 iso_pu_bacteria 2791355263 2793343176 188
83 iso_pu_bacteria 2791355264 2793350738 188
84 iso_pu_bacteria 2791355265 2793353225 188
85 iso_pu_bacteria 2791355266 2793361023 188
86 iso_pu_bacteria 2802429605 2805927425 188
87 iso_pu_bacteria 2802429606 2805936462 188
88 iso_pu_bacteria 2802429633 2806044010 188
89 iso_pu_bacteria 2802429634 2806052172 188
90 iso_pu_bacteria 2802429635 2806058473 188
91 iso_pu_bacteria 2802429636 2806066971 188
92 iso_pu_bacteria 2802429637 2806074714 188
93 iso_pu_bacteria 2838016132 2838022077 188
94 iso_pu_bacteria 2838035591 2838037287 188
95 iso_pu_bacteria 2838042994 2838047254 188
96 iso_pu_bacteria 2838048938 2838053963 188
97 iso_pu_bacteria 2838061910 2838066734 188
98 iso_pu_bacteria 2838068647 2838073791 188
99 iso_pu_bacteria 2838661181 2838663526 188
100 iso_pu_bacteria 2838668709 2838673222 188
101 iso_pu_bacteria 2838680041 2838680753 188
102 iso_pu_bacteria 2838686498 2838692587 188
103 iso_pu_bacteria 2838694306 2838695214 188
104 iso_pu_bacteria 2838701080 2838704024 188
105 iso_pu_bacteria 2838707686 2838708590 188
106 iso_pu_bacteria 2838729681 2838732659 188
107 iso_pu_bacteria 2838742623 2838745554 188
108 iso_pu_bacteria 2841851746 2841855198 188
109 iso_pu_bacteria 2841864319 2841866650 188
110 iso_pu_bacteria 2842077413 2842080175 188
111 iso_pu_bacteria 2842110456 2842112367 188
112 iso_pu_bacteria 2842118031 2842120795 188
113 iso_pu_bacteria 2842146304 2842148184 188
114 iso_pu_bacteria 2842156927 2842161772 188
115 iso_pu_bacteria 2842163707 2842169147 188
116 iso_pu_bacteria 2842180545 2842185389 188
117 iso_pu_bacteria 2842192696 2842193063 188
118 iso_pu_bacteria 2842205361 2842206775 188
119 iso_pu_bacteria 2842217011 2842218632 188
120 iso_pu_bacteria 2842229732 2842233327 188
121 iso_pu_bacteria 2842237096 2842238002 188
122 iso_pu_bacteria 2842243621 2842248669 188
123 iso_pu_bacteria 2842250916 2842253250 188
124 iso_pu_bacteria 2842257432 2842261812 188
125 iso_pu_bacteria 2842264693 2842267286 188
126 iso_pu_bacteria 2842271015 2842277124 188
127 iso_pu_bacteria 2842278818 2842280532 188
128 iso_pu_bacteria 2842285085 2842289484 188
129 iso_pu_bacteria 2842291075 2842293835 188
130 iso_pu_bacteria 2842304105 2842306318 188
131 iso_pu_bacteria 2842311132 2842317455 188
132 iso_pu_bacteria 2842317721 2842322355 188
133 iso_pu_bacteria 2842370503 2842371216 188
134 iso_pu_bacteria 2842377471 2842380231 188
135 iso_pu_bacteria 2842384541 2842387303 188
136 iso_pu_bacteria 2842402390 2842406832 188
137 iso_pu_bacteria 2842409023 2842413671 188
138 iso_pu_bacteria 2842415677 2842420366 188
139 iso_pu_bacteria 2842422224 2842427239 188
140 iso_pu_bacteria 2842428310 2842431462 188
141 iso_pu_bacteria 2842434925 2842437797 188
142 iso_pu_bacteria 2842441272 2842444612 188
143 iso_pu_bacteria 2842447887 2842450365 188
144 iso_pu_bacteria 2842462802 2842465560 188
145 iso_pu_bacteria 2842469257 2842472370 188
146 iso_pu_bacteria 2842489311 2842495060 188
147 iso_pu_bacteria 2842495871 2842500969 188
148 iso_pu_bacteria 2844009547 2844013306 188
149 iso_pu_bacteria 2844454524 2844455813 188
150 iso_pu_bacteria 2856320880 2856326941 188
151 iso_pu_bacteria 2856328259 2856333792 188
152 iso_pu_bacteria 2857516855 2857522251 188
153 iso_pu_bacteria 2869169390 2869169559 188
154 iso_pu_bacteria 2869234852 2869236680 188
155 iso_pu_bacteria 2869242130 2869244012 188
156 iso_pu_bacteria 2869256925 2869263991 188
157 iso_pu_bacteria 2869271264 2869272057 188
158 iso_pu_bacteria 2871435913 2871436840 188
159 iso_pu_bacteria 2871481445 2871483693 188
160 iso_pu_bacteria 2874109183 2874114263 188
161 iso_pu_bacteria 2874116593 2874118108 188
162 iso_pu_bacteria 2874162495 2874165174 188
163 iso_pu_bacteria 2876386047 2876390544 188
164 iso_pu_bacteria 2876399893 2876404885 188
165 iso_pu_bacteria 2876406927 2876408339 188
166 iso_pu_bacteria 2876420981 2876423432 188
167 iso_pu_bacteria 2878730984 2878734723 188
168 iso_pu_bacteria 2878774303 2878775303 188
169 iso_pu_bacteria 2885305155 2885306087 188
170 iso_pu_bacteria 2885334103 2885337917 188
171 iso_pu_bacteria 2889016732 2889021191 188
172 iso_pu_bacteria 2903513507 2903520228 188
173 iso_pu_bacteria 2904578770 2904580716 188
174 iso_pu_bacteria 2906386501 2906387615 188
175 iso_pu_bacteria 2906401398 2906407199 188
176 iso_pu_bacteria 2906408224 2906413561 188
177 iso_pu_bacteria 2906427513 2906434054 188
178 iso_pu_bacteria 2919119836 2919121569 188
179 iso_pu_bacteria 2922172374 2922176742 188
180 iso_pu_bacteria 2923556063 2923557347 188
181 iso_pu_bacteria 2924710171 2924717024 188
182 iso_pu_bacteria 2924733363 2924737233 188
183 iso_pu_bacteria 2924741084 2924741588 188
184 iso_pu_bacteria 2924748358 2924752292 188
185 iso_pu_bacteria 2933016740 2933017292 188
186 iso_pu_bacteria 2933570622 2933573387 188
187 iso_pu_bacteria 2933586486 2933587696 188
188 iso_pu_bacteria 2933599457 2933604220 188
189 iso_pu_bacteria 2935894831 2935895737 188
190 iso_pu_bacteria 2935901341 2935907305 188
191 iso_pu_bacteria 2936367885 2936368759 188
192 iso_pu_bacteria 2936375103 2936377164 188
193 iso_pu_bacteria 2936381700 2936387305 188
194 iso_pu_bacteria 2937861824 2937861867 188
195 iso_pu_bacteria 2937877337 2937884123 188
196 iso_pu_bacteria 2937980651 2937985348 188
197 iso_pu_bacteria 2958084443 2958091434 188
198 iso_pu_bacteria 2958100919 2958101094 188
199 iso_pu_bacteria 2958108152 2958114759 188
200 iso_pu_bacteria 2958137437 2958139424 188
201 iso_pu_bacteria 2958158011 2958158112 188
202 iso_pu_bacteria 2958172287 2958179738 188
203 iso_pu_bacteria 2961136820 2961137013 188
204 iso_pu_bacteria 2961183825 2961187437 188
205 iso_pu_bacteria 2965025482 2965026085 188
206 iso_pu_bacteria 2965047637 2965052673 188
207 iso_pu_bacteria 2965102966 2965104133 188
208 iso_pu_bacteria 2965119406 2965120631 188
209 iso_pu_bacteria 2968138860 2968139185 188
210 iso_pu_bacteria 2970489779 2970493246 188
211 iso_pu_bacteria 2970510686 2970512034 188
212 iso_pu_bacteria 2970532167 2970538039 188
213 iso_pu_bacteria 2970547951 2970551779 188
214 iso_pu_bacteria 2970619444 2970621692 188
215 iso_pu_bacteria 2970627176 2970628560 188
216 iso_pu_bacteria 2977851361 2977857327 188
217 iso_pu_bacteria 2977898635 2977906276 188
218 iso_pu_bacteria 2977907340 2977911017 188
219 iso_pu_bacteria 2977935797 2977936669 188
220 iso_pu_bacteria 2978969890 2978971457 188
221 iso_pu_bacteria 2979710463 2979710987 188
222 iso_pu_bacteria 2979764755 2979770720 188
223 iso_pu_bacteria 2979772303 2979776851 188
224 iso_pu_bacteria 2987645492 2987646711 188
225 iso_pu_bacteria 2996386984 2996388961 188
226 iso_pu_bacteria 2996887358 2996892033 188
227 iso_pu_bacteria 3004167301 3004168397 188
228 iso_pu_bacteria 3004232784 3004234816 188
229 iso_pu_bacteria 3004248173 3004253569 188
230 iso_pu_bacteria 3004268573 3004272997 188
231 iso_pu_bacteria 3005409236 3005411377 188
232 iso_pu_bacteria 3005452660 3005452992 188
233 iso_pu_bacteria 639633055 639646836 188
234 iso_pu_bacteria 8004300914 8004306897 188
235 iso_pu_bacteria 8004312739 8004314896 188
236 iso_pu_bacteria 8004695233 8004702016 188
237 iso_pu_bacteria 8004727605 8004732693 188
238 iso_pu_bacteria 8005258706 8005263642 188
239 iso_pu_bacteria 8005282627 8005283870 188
240 iso_pu_bacteria 8005307578 8005308823 188
241 iso_pu_bacteria 8005321885 8005326560 188
242 iso_pu_bacteria 8005376324 8005377265 188
243 iso_pu_bacteria 8005382845 8005387134 188
244 iso_pu_bacteria 8005395548 8005401894 188
245 iso_pu_bacteria 8005430974 8005433088 188
246 iso_pu_bacteria 8005460587 8005461210 188
247 iso_pu_bacteria 8005497431 8005498817 188
248 iso_pu_bacteria 8005556819 8005559297 188
249 iso_pu_bacteria 8005563573 8005569787 188
250 iso_pu_bacteria 8005570704 8005577087 188
251 iso_pu_bacteria 8005619151 8005620008 188
252 iso_pu_bacteria 8005626139 8005628607 188
253 iso_pu_bacteria 8005668836 8005670228 188
254 iso_pu_bacteria 8018127388 8018133286 188
255 iso_pu_bacteria 8018163183 8018167920 188
256 iso_pu_bacteria 8018176218 8018181711 188
257 iso_pu_bacteria 8023680758 8023684048 188
258 iso_pu_bacteria 8024501048 8024502516 188
259 iso_pu_bacteria 8054460903 8054463952 188
260 iso_pu_bacteria 8056382006 8056386118 188
261 iso_pu_bacteria 8057874678 8057881091 188
262 3300003187 JGI25151J46595_10007513 JGI25151J46595_100075134 190
263 3300003775 Ga0055524_1012047 Ga0055524_10120472 190
264 3300003790 Ga0055528_1000263 Ga0055528_100026314 190
265 3300005367 Ga0070667_100087817 Ga0070667_1000878173 190
266 3300005548 Ga0070665_100085438 Ga0070665_1000854385 190
267 3300005843 Ga0068860_100722668 Ga0068860_1007226682 190
268 3300013297 Ga0157378_10380762 Ga0157378_103807622 190
269 3300025258 Ga0209129_1000299 Ga0209129_100029927 190
270 3300025273 Ga0209673_1000122 Ga0209673_100012284 190
271 3300025292 Ga0209676_1021572 Ga0209676_10215721 190
272 3300025294 Ga0209025_1008001 Ga0209025_10080014 190
273 3300025294 Ga0209025_1010280 Ga0209025_10102804 190
274 3300025295 Ga0209564_1005714 Ga0209564_10057142 190
275 3300025299 Ga0209256_1001197 Ga0209256_100119725 190
276 3300025986 Ga0207658_10032047 Ga0207658_100320474 190
277 3300025986 Ga0207658_10311256 Ga0207658_103112562 190
278 3300026121 Ga0207683_10449883 Ga0207683_104498832 190
279 3300028379 Ga0268266_10069239 Ga0268266_100692392 190
280 3300028381 Ga0268264_10438327 Ga0268264_104383272 190
281 3300041498 Ga0451841_0084931 Ga0451841_0084931_19_600 190
282 3300046684 Ga0495669_0050650 Ga0495669_0050650_524_1102 190
283 3300048911 Ga0496108_0032193 Ga0496108_0032193_2684_3262 190
284 3300048919 Ga0496116_0269265 Ga0496116_0269265_43_618 190
285 3300002773 JGI25152J39213_1004096 JGI25152J39213_10040964 191
286 3300002987 JGI25159J45721_1000600 JGI25159J45721_10006008 191
287 3300003215 JGI25153J46596_10009283 JGI25153J46596_100092834 191
288 3300003354 JGI25160J50197_1002794 JGI25160J50197_10027944 191
289 3300003374 JGI25161J50226_1000340 JGI25161J50226_10003403 191
290 3300003771 Ga0055526_1000847 Ga0055526_100084718 191
291 3300003775 Ga0055524_1002213 Ga0055524_10022135 191
292 3300003790 Ga0055528_1002773 Ga0055528_10027735 191
293 3300003792 Ga0055540_1011649 Ga0055540_10116492 191
294 3300004625 Ga0055543_1000370 Ga0055543_100037018 191
295 3300005262 Ga0065165_1012699 Ga0065165_10126992 191
296 3300005337 Ga0070682_100159178 Ga0070682_1001591781 191
297 3300005548 Ga0070665_100265563 Ga0070665_1002655632 191
298 3300005983 Ga0081540_1005582 Ga0081540_10055825 191
299 3300010375 Ga0105239_10326956 Ga0105239_103269563 191
300 3300025208 Ga0209436_100002 Ga0209436_1000029 191
301 3300025229 Ga0209147_101611 Ga0209147_1016114 191
302 3300025258 Ga0209129_1003133 Ga0209129_10031334 191
303 3300025258 Ga0209129_1006286 Ga0209129_10062862 191
304 3300025273 Ga0209673_1003335 Ga0209673_10033352 191
305 3300025284 Ga0209130_1000015 Ga0209130_1000015317 191
306 3300025294 Ga0209025_1028202 Ga0209025_10282023 191
307 3300025295 Ga0209564_1000988 Ga0209564_10009888 191
308 3300025297 Ga0209758_1011789 Ga0209758_10117893 191
309 3300025299 Ga0209256_1014447 Ga0209256_10144473 191
310 3300025302 Ga0207426_1000144 Ga0207426_100014487 191
311 3300025303 Ga0209051_1003848 Ga0209051_10038486 191
312 3300025304 Ga0209257_1033001 Ga0209257_10330012 191
313 3300031616 Ga0307508_10028066 Ga0307508_100280663 191
314 3300037471 Ga0395905_0009500 Ga0395905_0009500_6281_6859 191
315 3300048925 Ga0496122_0288178 Ga0496122_0288178_216_794 191
316 3300049569 Ga0501032_0052810 Ga0501032_0052810_2120_2698 191
317 3300049571 Ga0501034_0272686 Ga0501034_0272686_922_1500 191
318 3300049579 Ga0501043_0031218 Ga0501043_0031218_1077_1655 191
319 3300049581 Ga0501047_0255961 Ga0501047_0255961_483_1061 191
320 3300049823 Ga0501044_1090049 Ga0501044_1090049_34_612 191
321 3300002773 JGI25152J39213_1000719 JGI25152J39213_10007196 192
322 3300002773 JGI25152J39213_1010296 JGI25152J39213_10102962 192
323 3300002774 JGI25150J39212_1000113 JGI25150J39212_10001136 192
324 3300003187 JGI25151J46595_10000099 JGI25151J46595_1000009983 192
325 3300003187 JGI25151J46595_10000307 JGI25151J46595_1000030744 192
326 3300003187 JGI25151J46595_10000400 JGI25151J46595_1000040049 192
327 3300003203 JGI25406J46586_10006582 JGI25406J46586_100065824 192
328 3300003215 JGI25153J46596_10000896 JGI25153J46596_1000089611 192
329 3300003215 JGI25153J46596_10024752 JGI25153J46596_100247523 192
330 3300003316 rootH1_10009379 rootH1_100093793 192
331 3300003320 rootH2_10050910 rootH2_100509103 192
332 3300003323 rootH1_10023402 rootH1_100234024 192
333 3300003323 rootH1_10023403 rootH1_100234032 192
334 3300003354 JGI25160J50197_1002218 JGI25160J50197_10022183 192
335 3300003354 JGI25160J50197_1006348 JGI25160J50197_10063485 192
336 3300003354 JGI25160J50197_1022131 JGI25160J50197_10221312 192
337 3300003374 JGI25161J50226_1004091 JGI25161J50226_10040913 192
338 3300003771 Ga0055526_1013343 Ga0055526_10133433 192
339 3300003771 Ga0055526_1014187 Ga0055526_10141872 192
340 3300003775 Ga0055524_1001577 Ga0055524_10015773 192
341 3300003775 Ga0055524_1002406 Ga0055524_10024063 192
342 3300003790 Ga0055528_1006250 Ga0055528_10062503 192
343 3300003792 Ga0055540_1022119 Ga0055540_10221192 192
344 3300004625 Ga0055543_1001122 Ga0055543_10011225 192
345 3300005347 Ga0070668_100162757 Ga0070668_1001627572 192
346 3300005844 Ga0068862_100251754 Ga0068862_1002517542 192
347 3300005844 Ga0068862_100861676 Ga0068862_1008616762 192
348 3300005985 Ga0081539_10000646 Ga0081539_1000064635 192
349 3300006038 Ga0075365_10013463 Ga0075365_100134633 192
350 3300006038 Ga0075365_10017919 Ga0075365_100179193 192
351 3300006038 Ga0075365_10145049 Ga0075365_101450492 192
352 3300006042 Ga0075368_10007457 Ga0075368_100074573 192
353 3300006048 Ga0075363_100292441 Ga0075363_1002924411 192
354 3300006177 Ga0075362_10007209 Ga0075362_100072093 192
355 3300006178 Ga0075367_10004881 Ga0075367_100048814 192
356 3300006178 Ga0075367_10369083 Ga0075367_103690831 192
357 3300006186 Ga0075369_10001799 Ga0075369_100017994 192
358 3300006186 Ga0075369_10015860 Ga0075369_100158602 192
359 3300006195 Ga0075366_10006410 Ga0075366_100064103 192
360 3300006353 Ga0075370_10046285 Ga0075370_100462853 192
361 3300006353 Ga0075370_10084529 Ga0075370_100845291 192
362 3300009011 Ga0105251_10014918 Ga0105251_100149182 192
363 3300009148 Ga0105243_10255490 Ga0105243_102554902 192
364 3300009177 Ga0105248_10157189 Ga0105248_101571892 192
365 3300009763 Ga0123340_1033737 Ga0123340_10337372 192
366 3300009765 Ga0123341_1000027 Ga0123341_100002753 192
367 3300009765 Ga0123341_1088946 Ga0123341_10889462 192
368 3300009766 Ga0123342_1004498 Ga0123342_10044984 192
369 3300009766 Ga0123342_1019697 Ga0123342_10196972 192
370 3300011119 Ga0105246_11077372 Ga0105246_110773721 192
371 3300013102 Ga0157371_10009193 Ga0157371_100091936 192
372 3300013105 Ga0157369_10073641 Ga0157369_100736416 192
373 3300025245 Ga0207425_1000012 Ga0207425_1000012504 192
374 3300025245 Ga0207425_1000661 Ga0207425_10006613 192
375 3300025245 Ga0207425_1003147 Ga0207425_10031473 192
376 3300025245 Ga0207425_1017992 Ga0207425_10179922 192
377 3300025258 Ga0209129_1000086 Ga0209129_100008638 192
378 3300025258 Ga0209129_1000428 Ga0209129_100042815 192
379 3300025258 Ga0209129_1005022 Ga0209129_10050222 192
380 3300025258 Ga0209129_1006828 Ga0209129_10068282 192
381 3300025258 Ga0209129_1028708 Ga0209129_10287081 192
382 3300025273 Ga0209673_1000091 Ga0209673_100009181 192
383 3300025273 Ga0209673_1002379 Ga0209673_10023794 192
384 3300025273 Ga0209673_1004550 Ga0209673_10045502 192
385 3300025273 Ga0209673_1074848 Ga0209673_10748481 192
386 3300025284 Ga0209130_1000536 Ga0209130_100053623 192
387 3300025291 Ga0209675_1024774 Ga0209675_10247742 192
388 3300025294 Ga0209025_1000024 Ga0209025_1000024504 192
389 3300025294 Ga0209025_1000486 Ga0209025_100048684 192
390 3300025294 Ga0209025_1000549 Ga0209025_10005497 192
391 3300025294 Ga0209025_1015433 Ga0209025_10154333 192
392 3300025294 Ga0209025_1044118 Ga0209025_10441182 192
393 3300025295 Ga0209564_1000398 Ga0209564_100039829 192
394 3300025295 Ga0209564_1002868 Ga0209564_10028687 192
395 3300025295 Ga0209564_1010230 Ga0209564_10102303 192
396 3300025297 Ga0209758_1000046 Ga0209758_100004638 192
397 3300025297 Ga0209758_1000325 Ga0209758_100032519 192
398 3300025297 Ga0209758_1009106 Ga0209758_10091064 192
399 3300025297 Ga0209758_1019683 Ga0209758_10196832 192
400 3300025297 Ga0209758_1027852 Ga0209758_10278522 192
401 3300025299 Ga0209256_1000870 Ga0209256_100087029 192
402 3300025299 Ga0209256_1004855 Ga0209256_10048554 192
403 3300025299 Ga0209256_1011271 Ga0209256_10112712 192
404 3300025299 Ga0209256_1044046 Ga0209256_10440461 192
405 3300025302 Ga0207426_1000063 Ga0207426_100006355 192
406 3300025302 Ga0207426_1000092 Ga0207426_100009287 192
407 3300025302 Ga0207426_1003637 Ga0207426_10036373 192
408 3300025303 Ga0209051_1010653 Ga0209051_10106533 192
409 3300025303 Ga0209051_1028844 Ga0209051_10288442 192
410 3300025941 Ga0207711_10113871 Ga0207711_101138712 192
411 3300028379 Ga0268266_10410609 Ga0268266_104106092 192
412 3300028794 Ga0307515_10314920 Ga0307515_103149202 192
413 3300028800 Ga0265338_10000158 Ga0265338_100001589 192
414 3300028800 Ga0265338_10010680 Ga0265338_100106805 192
415 3300031250 Ga0265331_10053032 Ga0265331_100530323 192
416 3300031344 Ga0265316_10040547 Ga0265316_100405473 192
417 3300031712 Ga0265342_10021480 Ga0265342_100214802 192
418 3300031731 Ga0307405_10021028 Ga0307405_100210282 192
419 3300031901 Ga0307406_10012742 Ga0307406_100127423 192
420 3300031911 Ga0307412_10000706 Ga0307412_100007063 192
421 3300037471 Ga0395905_0003115 Ga0395905_0003115_15944_16591 192
422 3300037853 Ga0436364_0372666 Ga0436364_0372666_38_634 192
423 3300039437 Ga0436365_0144244 Ga0436365_0144244_1140_1736 192
424 3300041413 Ga0439465_0006613 Ga0439465_0006613_1320_1901 192
425 3300041413 Ga0439465_0007923 Ga0439465_0007923_1897_2484 192
426 3300041491 Ga0451833_0455905 Ga0451833_0455905_685_1266 192
427 3300041492 Ga0451835_0448481 Ga0451835_0448481_971_1552 192
428 3300041494 Ga0451837_0761505 Ga0451837_0761505_14_595 192
429 3300041494 Ga0451837_0925794 Ga0451837_0925794_128_709 192
430 3300041498 Ga0451841_0491014 Ga0451841_0491014_1353_1934 192
431 3300041505 Ga0451849_0681332 Ga0451849_0681332_846_1427 192
432 3300041507 Ga0451851_0363179 Ga0451851_0363179_321_902 192
433 3300041511 Ga0451855_0000203 Ga0451855_0000203_426_1007 192
434 3300041511 Ga0451855_0346123 Ga0451855_0346123_472_1053 192
435 3300042006 Ga0439432_024681 Ga0439432_024681_709_1290 192
436 3300042007 Ga0439449_0081017 Ga0439449_0081017_67_648 192
437 3300044684 Ga0466966_0029705 Ga0466966_0029705_2185_2766 192
438 3300044694 Ga0466963_0020974 Ga0466963_0020974_137_718 192
439 3300044765 Ga0466970_0035800 Ga0466970_0035800_622_1203 192
440 3300044842 Ga0466957_0011840 Ga0466957_0011840_121_702 192
441 3300045836 Ga0466958_0107461 Ga0466958_0107461_534_1115 192
442 3300045976 Ga0466967_0267483 Ga0466967_0267483_540_1121 192
443 3300046452 Ga0495617_023639 Ga0495617_023639_1240_1821 192
444 3300046460 Ga0495638_0000120 Ga0495638_0000120_106649_107260 192
445 3300046460 Ga0495638_0006796 Ga0495638_0006796_4590_5174 192
446 3300046460 Ga0495638_0057324 Ga0495638_0057324_501_1082 192
447 3300046462 Ga0495651_0144434 Ga0495651_0144434_671_1252 192
448 3300046471 Ga0495650_0067192 Ga0495650_0067192_713_1291 192
449 3300046476 Ga0495662_0035918 Ga0495662_0035918_222_803 192
450 3300046492 Ga0495585_0027350 Ga0495585_0027350_658_1248 192
451 3300046492 Ga0495585_0049012 Ga0495585_0049012_1186_1767 192
452 3300046500 Ga0495596_0087568 Ga0495596_0087568_205_786 192
453 3300046501 Ga0495607_0060667 Ga0495607_0060667_741_1322 192
454 3300046501 Ga0495607_0072410 Ga0495607_0072410_121_702 192
455 3300046506 Ga0495583_0027075 Ga0495583_0027075_1374_1955 192
456 3300046506 Ga0495583_0030746 Ga0495583_0030746_1046_1657 192
457 3300046506 Ga0495583_0053867 Ga0495583_0053867_552_1133 192
458 3300046507 Ga0495606_0081274 Ga0495606_0081274_759_1346 192
459 3300046507 Ga0495606_0138065 Ga0495606_0138065_265_843 192
460 3300046507 Ga0495606_0193999 Ga0495606_0193999_272_904 192
461 3300046512 Ga0495610_0013694 Ga0495610_0013694_3000_3578 192
462 3300046512 Ga0495610_0033712 Ga0495610_0033712_1457_2038 192
463 3300046512 Ga0495610_0051056 Ga0495610_0051056_474_1055 192
464 3300046512 Ga0495610_0167306 Ga0495610_0167306_240_851 192
465 3300046515 Ga0495620_0006882 Ga0495620_0006882_5274_5855 192
466 3300046515 Ga0495620_0033010 Ga0495620_0033010_1226_1804 192
467 3300046516 Ga0495628_0633053 Ga0495628_0633053_145_726 192
468 3300046518 Ga0495631_0002712 Ga0495631_0002712_9000_9611 192
469 3300046518 Ga0495631_0021310 Ga0495631_0021310_2196_2777 192
470 3300046518 Ga0495631_0037997 Ga0495631_0037997_1157_1738 192
471 3300046519 Ga0495632_0129638 Ga0495632_0129638_204_785 192
472 3300046522 Ga0495643_0122158 Ga0495643_0122158_224_805 192
473 3300046524 Ga0495648_0065736 Ga0495648_0065736_1326_1907 192
474 3300046524 Ga0495648_0240397 Ga0495648_0240397_144_722 192
475 3300046525 Ga0495663_0194601 Ga0495663_0194601_54_635 192
476 3300046529 Ga0495652_0349528 Ga0495652_0349528_454_1035 192
477 3300046530 Ga0495654_0053752 Ga0495654_0053752_663_1244 192
478 3300046533 Ga0495640_0102816 Ga0495640_0102816_1154_1735 192
479 3300046542 Ga0495597_0230683 Ga0495597_0230683_31_612 192
480 3300046558 Ga0495633_0023116 Ga0495633_0023116_87_668 192
481 3300046558 Ga0495633_0277575 Ga0495633_0277575_31_621 192
482 3300046616 Ga0495668_0055721 Ga0495668_0055721_994_1575 192
483 3300046616 Ga0495668_0097015 Ga0495668_0097015_592_1182 192
484 3300046616 Ga0495668_0108202 Ga0495668_0108202_322_903 192
485 3300046616 Ga0495668_0110924 Ga0495668_0110924_255_866 192
486 3300046648 Ga0495611_0142942 Ga0495611_0142942_123_734 192
487 3300046660 Ga0495625_0027962 Ga0495625_0027962_1168_1749 192
488 3300046660 Ga0495625_0040933 Ga0495625_0040933_1047_1658 192
489 3300046660 Ga0495625_0393847 Ga0495625_0393847_149_730 192
490 3300046663 Ga0495635_0050738 Ga0495635_0050738_439_1020 192
491 3300046665 Ga0495661_0240758 Ga0495661_0240758_177_767 192
492 3300046674 Ga0495588_0027620 Ga0495588_0027620_1290_1871 192
493 3300046675 Ga0495657_0053881 Ga0495657_0053881_543_1124 192
494 3300046683 Ga0495658_0129024 Ga0495658_0129024_244_825 192
495 3300046691 Ga0495670_0098550 Ga0495670_0098550_305_886 192
496 3300046691 Ga0495670_0219455 Ga0495670_0219455_201_779 192
497 3300046692 Ga0495671_0097777 Ga0495671_0097777_800_1381 192
498 3300046809 Ga0495600_0421315 Ga0495600_0421315_175_756 192
499 3300047317 Ga0495604_0044465 Ga0495604_0044465_289_870 192
500 3300047320 Ga0495672_0042075 Ga0495672_0042075_1896_2507 192
501 3300047321 Ga0495676_0284779 Ga0495676_0284779_510_1091 192
502 3300047443 Ga0495687_034805 Ga0495687_034805_809_1390 192
503 3300047443 Ga0495687_065914 Ga0495687_065914_530_1111 192
504 3300047447 Ga0495685_188320 Ga0495685_188320_55_636 192
505 3300047469 Ga0495673_0056689 Ga0495673_0056689_552_1133 192
506 3300047469 Ga0495673_0180110 Ga0495673_0180110_86_667 192
507 3300047470 Ga0495681_0078124 Ga0495681_0078124_261_842 192
508 3300047472 Ga0495686_0000574 Ga0495686_0000574_3210_3791 192
509 3300047472 Ga0495686_0006479 Ga0495686_0006479_4393_4974 192
510 3300047472 Ga0495686_0021442 Ga0495686_0021442_1136_1717 192
511 3300047472 Ga0495686_0027674 Ga0495686_0027674_413_997 192
512 3300047472 Ga0495686_0037989 Ga0495686_0037989_1890_2468 192
513 3300047472 Ga0495686_0182308 Ga0495686_0182308_407_997 192
514 3300047472 Ga0495686_0216338 Ga0495686_0216338_456_1037 192
515 3300048091 Ga0495626_0041063 Ga0495626_0041063_262_843 192
516 3300048904 Ga0496101_0602768 Ga0496101_0602768_192_770 192
517 3300048906 Ga0496103_0114154 Ga0496103_0114154_754_1335 192
518 3300048907 Ga0496104_0144308 Ga0496104_0144308_1275_1856 192
519 3300048908 Ga0496105_0064795 Ga0496105_0064795_2075_2656 192
520 3300048909 Ga0496106_0002429 Ga0496106_0002429_7485_8066 192
521 3300048909 Ga0496106_0076372 Ga0496106_0076372_1905_2486 192
522 3300048910 Ga0496107_0149063 Ga0496107_0149063_1059_1640 192
523 3300048910 Ga0496107_0597807 Ga0496107_0597807_25_606 192
524 3300048913 Ga0496110_0103764 Ga0496110_0103764_1637_2218 192
525 3300048914 Ga0496111_0169268 Ga0496111_0169268_285_866 192
526 3300048917 Ga0496114_0162730 Ga0496114_0162730_928_1515 192
527 3300048917 Ga0496114_0221381 Ga0496114_0221381_763_1344 192
528 3300048919 Ga0496116_0014842 Ga0496116_0014842_5384_5962 192
529 3300048919 Ga0496116_0042587 Ga0496116_0042587_229_807 192
530 3300048919 Ga0496116_0052283 Ga0496116_0052283_359_937 192
531 3300048919 Ga0496116_0070138 Ga0496116_0070138_1617_2198 192
532 3300048919 Ga0496116_0155569 Ga0496116_0155569_326_904 192
533 3300048919 Ga0496116_0255233 Ga0496116_0255233_135_713 192
534 3300048919 Ga0496116_0257811 Ga0496116_0257811_87_668 192
535 3300048920 Ga0496117_0035746 Ga0496117_0035746_2637_3215 192
536 3300048920 Ga0496117_0046214 Ga0496117_0046214_880_1461 192
537 3300048920 Ga0496117_0150448 Ga0496117_0150448_258_836 192
538 3300048921 Ga0496118_0015498 Ga0496118_0015498_4284_4865 192
539 3300048921 Ga0496118_0034033 Ga0496118_0034033_1150_1731 192
540 3300048921 Ga0496118_0158695 Ga0496118_0158695_478_1056 192
541 3300048921 Ga0496118_0258947 Ga0496118_0258947_300_878 192
542 3300048922 Ga0496119_0046438 Ga0496119_0046438_122_703 192
543 3300048922 Ga0496119_0157514 Ga0496119_0157514_359_937 192
544 3300048922 Ga0496119_0346972 Ga0496119_0346972_116_697 192
545 3300048923 Ga0496120_0104105 Ga0496120_0104105_119_700 192
546 3300048924 Ga0496121_0012624 Ga0496121_0012624_2746_3324 192
547 3300048924 Ga0496121_0045578 Ga0496121_0045578_2558_3136 192
548 3300048924 Ga0496121_0255165 Ga0496121_0255165_209_790 192
549 3300048924 Ga0496121_0430953 Ga0496121_0430953_106_687 192
550 3300048924 Ga0496121_0618978 Ga0496121_0618978_37_618 192
551 3300048924 Ga0496121_0710982 Ga0496121_0710982_15_593 192
552 3300048925 Ga0496122_0039586 Ga0496122_0039586_230_808 192
553 3300048925 Ga0496122_0049541 Ga0496122_0049541_205_783 192
554 3300048925 Ga0496122_0073230 Ga0496122_0073230_1573_2154 192
555 3300048925 Ga0496122_0075663 Ga0496122_0075663_1540_2121 192
556 3300048925 Ga0496122_0178985 Ga0496122_0178985_229_807 192
557 3300048926 Ga0496123_0003764 Ga0496123_0003764_11837_12415 192
558 3300048926 Ga0496123_0041068 Ga0496123_0041068_208_786 192
559 3300048926 Ga0496123_0085538 Ga0496123_0085538_122_703 192
560 3300048926 Ga0496123_0151662 Ga0496123_0151662_195_773 192
561 3300048927 Ga0496124_0000080 Ga0496124_0000080_35712_36293 192
562 3300048927 Ga0496124_0002814 Ga0496124_0002814_20401_20979 192
563 3300048927 Ga0496124_0046840 Ga0496124_0046840_2912_3490 192
564 3300048927 Ga0496124_0047156 Ga0496124_0047156_344_922 192
565 3300048927 Ga0496124_0070860 Ga0496124_0070860_2282_2863 192
566 3300048928 Ga0496125_0064358 Ga0496125_0064358_2283_2864 192
567 3300048928 Ga0496125_0086944 Ga0496125_0086944_1204_1782 192
568 3300048928 Ga0496125_0416959 Ga0496125_0416959_121_702 192
569 3300048929 Ga0496126_0000397 Ga0496126_0000397_61695_62273 192
570 3300048929 Ga0496126_0027499 Ga0496126_0027499_439_1017 192
571 3300048929 Ga0496126_0148276 Ga0496126_0148276_1212_1793 192
572 3300048929 Ga0496126_0264790 Ga0496126_0264790_269_850 192
573 3300049459 Ga0495678_035709 Ga0495678_035709_205_816 192
574 3300049460 Ga0495682_0058866 Ga0495682_0058866_186_797 192
575 3300049569 Ga0501032_0268602 Ga0501032_0268602_145_729 192
576 3300049570 Ga0501033_0025686 Ga0501033_0025686_550_1134 192
577 3300049570 Ga0501033_0193153 Ga0501033_0193153_24_605 192
578 3300049571 Ga0501034_0187283 Ga0501034_0187283_1051_1635 192
579 3300049571 Ga0501034_0190957 Ga0501034_0190957_529_1110 192
580 3300049573 Ga0501037_0110108 Ga0501037_0110108_1231_1812 192
581 3300049575 Ga0501039_0395577 Ga0501039_0395577_416_1000 192
582 3300049581 Ga0501047_0065497 Ga0501047_0065497_2141_2725 192
583 3300049582 Ga0501048_0090622 Ga0501048_0090622_349_930 192
584 3300049742 Ga0501080_0574771 Ga0501080_0574771_264_845 192
585 3300049744 Ga0501083_0119832 Ga0501083_0119832_874_1455 192
586 3300049822 Ga0501035_0019983 Ga0501035_0019983_3977_4561 192
587 3300049823 Ga0501044_0016192 Ga0501044_0016192_3924_4508 192
588 3300050492 nmdc:mga0yw44_117962_c1 nmdc:mga0yw44_117962_c1_769_1350 192
589 3300050492 nmdc:mga0yw44_18665_c1 nmdc:mga0yw44_18665_c1_395_976 192
590 3300050492 nmdc:mga0yw44_65461_c1 nmdc:mga0yw44_65461_c1_689_1267 192
591 3300050492 nmdc:mga0yw44_91120_c1 nmdc:mga0yw44_91120_c1_1179_1760 192
592 3300050493 nmdc:mga0k408_26109_c1 nmdc:mga0k408_26109_c1_1889_2470 192
593 3300050494 nmdc:mga06z11_72800_c1 nmdc:mga06z11_72800_c1_764_1345 192
594 3300050496 nmdc:mga07m45_142005_c1 nmdc:mga07m45_142005_c1_534_1115 192
595 3300050496 nmdc:mga07m45_31101_c1 nmdc:mga07m45_31101_c1_1456_2037 192
596 3300050516 nmdc:mga0sz30_58525_c1 nmdc:mga0sz30_58525_c1_288_869 192
597 3300053093 Ga0500651_0203373 Ga0500651_0203373_255_836 192
598 3300053105 Ga0500557_001951 Ga0500557_001951_717_1328 192
599 3300053125 Ga0500618_006932 Ga0500618_006932_80_658 192
600 3300053134 Ga0500658_0002074 Ga0500658_0002074_3103_3684 192
601 3300053134 Ga0500658_0023802 Ga0500658_0023802_633_1214 192
602 3300053136 Ga0500559_0016091 Ga0500559_0016091_549_1127 192
603 3300053139 Ga0500568_0000323 Ga0500568_0000323_8943_9554 192
604 3300053139 Ga0500568_0000489 Ga0500568_0000489_11028_11609 192
605 3300053139 Ga0500568_0005825 Ga0500568_0005825_762_1343 192
606 3300053148 Ga0500590_001175 Ga0500590_001175_7189_7770 192
607 3300053151 Ga0500604_0011455 Ga0500604_0011455_1007_1588 192
608 3300053153 Ga0500616_0028632 Ga0500616_0028632_1769_2380 192
609 3300053153 Ga0500616_0245422 Ga0500616_0245422_42_623 192
610 3300053157 Ga0500624_020823 Ga0500624_020823_452_1033 192
611 3300053158 Ga0500627_0093484 Ga0500627_0093484_486_1067 192
612 3300053158 Ga0500627_0155717 Ga0500627_0155717_301_912 192
613 3300053160 Ga0500633_0001242 Ga0500633_0001242_582_1163 192
614 3300053161 Ga0500634_0002883 Ga0500634_0002883_6110_6691 192
615 3300053177 Ga0500636_0000001 Ga0500636_0000001_162528_163109 192
616 3300053730 Ga0500645_014839 Ga0500645_014839_1798_2409 192
617 3300061719 Ga0466962_0029026 Ga0466962_0029026_431_1012 192

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00300

His_Phos_1

Histidine phosphatase superfamily (branch 1)

30

215

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
2a6p-assembly1.cif.gz_B structure solution to 2.2 angstrom and functional characterisation of the open reading frame rv3214 from mycobacterium tuberculosis 0.945 6 191
4ij5-assembly1.cif.gz_B crystal structure of a novel-type phosphoserine phosphatase from <i>hydrogenobacter thermophilus</i> tk-6 0.9116 7 192
2a6p-assembly1.cif.gz_B structure solution to 2.2 angstrom and functional characterisation of the open reading frame rv3214 from mycobacterium tuberculosis 0.9115 6 191
4ij6-assembly1.cif.gz_B crystal structure of a novel-type phosphoserine phosphatase mutant (h9a) from <i>hydrogenobacter thermophilus</i> tk-6 in complex with l-phosphoserine 0.9088 7 192
3oi7-assembly1.cif.gz_A structure of the structure of the h13a mutant of ykr043c in complex with sedoheptulose-1,7-bisphosphate 0.9066 5 188
ID Description Score Start End Superfamily
af_Q6MWZ7_1_203_3.40.50.1240 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like 0.9396 6 192 3.40.50.1240
af_Q6MWZ7_1_203_3.40.50.1240 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like 0.9112 6 192 3.40.50.1240
4ij6B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like 0.9088 7 192 3.40.50.1240
af_A0A1D8PHW0_6_236_3.40.50.1240 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like 0.8938 6 187 3.40.50.1240
4qihB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like 0.8911 6 192 3.40.50.1240
ID Description Score Start End GO Terms
AF-A0A435BCF2-F1-model_v4 Histidine phosphatase family protein 0.9944 84 191
AF-A0A831TBJ5-F1-model_v4 Histidine phosphatase family protein 0.9942 5 192 GO:0070297
GO:0101006
AF-A0A535NZD4-F1-model_v4 Histidine phosphatase family protein 0.9889 12 96 GO:0070297
GO:0101006
AF-A0A4P2QKM4-F1-model_v4 Beta-phosphoglucomutase (EC 5.4.2.6) 0.9882 2 191 GO:0016853
AF-A0A521RV93-F1-model_v4 Histidine phosphatase family protein 0.9867 5 191 GO:0070297
GO:0101006

Feature Viewer

pLDDT pTM Quality
96.84 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map