F469616

General Info

Members Datasets Scaffolds Average Seq Length
617 250 1234 186

Family's Representative Sequence

Representative Sequence 3300005539|Ga0068853_100082167|Ga0068853_1000821672
Length 213
Sequence MRRAISAVPTGLRSFFSSFPALPRWAKLGRPFGAEFINDLGPRISLNVALLAISIGFIGCGYHTAGHANLLPSDLRTIAIPAFVNQTQTYKIEQTLTSSVVQEFVTRTNYHITQDPKSADAALHGVVLSTYTTPLTYDTKTGRASSVLVIVSMSVSLKDRQGRVLYENPSYTFREQYQVSQELSSFFEEDSPAFQRLSRDFARTLVSNVLEAF

Samples

Sample ID Description Type Environment
1 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
4 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
5 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
31 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
32 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
33 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
34 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
35 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
36 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
37 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
38 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
39 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
40 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
41 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
42 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
43 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
44 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
45 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
46 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
47 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
48 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
49 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
50 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
51 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
52 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
53 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
54 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
55 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
56 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
57 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
58 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
59 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
60 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
61 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
62 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
63 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
64 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
65 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
66 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
67 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
68 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
69 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
70 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
71 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
72 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
73 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
74 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
75 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
76 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
77 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
79 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
80 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
81 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
82 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
84 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
85 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
86 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
87 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
88 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
89 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
90 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
91 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
92 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
93 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
94 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
95 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
96 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
97 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
98 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
99 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
100 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
101 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
102 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
103 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
104 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
105 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
106 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
107 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
108 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
109 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
110 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
111 3300022732 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU1 Metagenome Rhizosphere
112 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
113 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
114 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
175 3300028036 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 Metagenome Rhizosphere
176 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
179 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
180 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
181 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
182 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
183 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
184 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
185 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
186 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
187 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
188 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
189 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
190 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
191 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
192 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
193 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
194 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
195 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
196 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
197 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
198 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
199 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
200 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
201 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
202 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
203 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
204 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
205 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
206 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
207 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
208 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
209 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
210 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
211 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
212 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
213 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
214 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
215 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
216 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
217 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
218 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
219 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
220 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
221 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
222 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
223 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
224 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
225 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
226 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
227 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
228 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
229 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
230 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
231 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
232 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
233 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
234 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
235 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
236 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
237 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
238 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
239 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
240 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
241 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
242 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
243 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
244 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
245 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
246 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
247 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
248 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
249 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
250 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.35
Metatranscriptomes 0.65
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 5.19
Rhizosphere 94.33
Stem 0
Stem Tuber 0
Unclassified 30.15

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068853_100082167 3300005539 Unclassified 2822
2 JGI24737J22298_10026801 3300001990 Bacteria 1819
3 JGI24743J22301_10005677 3300001991 Bacteria 2093
4 JGI24034J26672_10004111 3300002239 Bacteria 2052
5 JGI24751J29686_10004013 3300002459 Bacteria 2978
6 Ga0065712_10083440 3300005290 Bacteria 2837
7 Ga0065715_10097655 3300005293 Unclassified 3670
8 Ga0070676_10076097 3300005328 Bacteria 2025
9 Ga0070676_10585662 3300005328 Unclassified 803
10 Ga0070683_100004621 3300005329 Bacteria 11370
11 Ga0070683_100030596 3300005329 Unclassified 4889
12 Ga0070683_100033402 3300005329 Unclassified 4691
13 Ga0070683_100035148 3300005329 Unclassified 4581
14 Ga0070683_100541129 3300005329 Bacteria 1113
15 Ga0070690_100600168 3300005330 Unclassified 836
16 Ga0070670_100021813 3300005331 Bacteria 5507
17 Ga0070670_100160622 3300005331 Bacteria 1947
18 Ga0070670_100461689 3300005331 Archaea 1126
19 Ga0070677_10029087 3300005333 Bacteria 2093
20 Ga0068869_100029673 3300005334 Bacteria 3835
21 Ga0068869_100175491 3300005334 Bacteria 1677
22 Ga0070666_10093676 3300005335 Bacteria 2065
23 Ga0070666_10574237 3300005335 Unclassified 821
24 Ga0070680_100046372 3300005336 Unclassified 3535
25 Ga0070680_100176394 3300005336 Bacteria 1799
26 Ga0070680_100333078 3300005336 Bacteria 1289
27 Ga0068868_100006913 3300005338 Bacteria 8060
28 Ga0068868_100014935 3300005338 Bacteria 5733
29 Ga0068868_100021307 3300005338 Unclassified 4881
30 Ga0068868_100173583 3300005338 Bacteria 1785
31 Ga0068868_100516392 3300005338 Bacteria 1048
32 Ga0070660_100221912 3300005339 Unclassified 1536
33 Ga0070660_100257143 3300005339 Bacteria 1425
34 Ga0070660_100539263 3300005339 Unclassified 973
35 Ga0070689_100034323 3300005340 Bacteria 3870
36 Ga0070689_100040779 3300005340 Bacteria 3560
37 Ga0070687_100014876 3300005343 Bacteria 3505
38 Ga0070687_100035473 3300005343 Bacteria 2477
39 Ga0070661_100012703 3300005344 Bacteria 5893
40 Ga0070661_100075457 3300005344 Bacteria 2484
41 Ga0070692_10159222 3300005345 Bacteria 1292
42 Ga0070668_100043649 3300005347 Unclassified 3438
43 Ga0070668_100220127 3300005347 Bacteria 1565
44 Ga0070669_100024622 3300005353 Bacteria 4317
45 Ga0070669_100204116 3300005353 Unclassified 1557
46 Ga0070669_100349247 3300005353 Bacteria 1200
47 Ga0070675_100243604 3300005354 Bacteria 1571
48 Ga0070675_100545298 3300005354 Bacteria 1048
49 Ga0070674_100954816 3300005356 Unclassified 750
50 Ga0070673_100110050 3300005364 Bacteria 2283
51 Ga0070673_100455933 3300005364 Bacteria 1151
52 Ga0070673_100516016 3300005364 Bacteria 1082
53 Ga0070688_100029203 3300005365 Bacteria 3300
54 Ga0070688_100195076 3300005365 Bacteria 1413
55 Ga0070659_100121868 3300005366 Bacteria 2113
56 Ga0070667_100483557 3300005367 Unclassified 1134
57 Ga0070709_10000752 3300005434 Bacteria 18313
58 Ga0070709_10021642 3300005434 Bacteria 3748
59 Ga0070709_10199252 3300005434 Bacteria 1417
60 Ga0070714_100000128 3300005435 Bacteria 59542
61 Ga0070714_100002798 3300005435 Bacteria 12869
62 Ga0070714_100063480 3300005435 Bacteria 3177
63 Ga0070714_100094578 3300005435 Unclassified 2623
64 Ga0070714_100471884 3300005435 Bacteria 1194
65 Ga0070713_100000133 3300005436 Bacteria 48970
66 Ga0070713_100002561 3300005436 Bacteria 11894
67 Ga0070713_100032383 3300005436 Unclassified 4175
68 Ga0070713_100301389 3300005436 Bacteria 1475
69 Ga0070713_100335201 3300005436 Bacteria 1400
70 Ga0070713_100506022 3300005436 Unclassified 1140
71 Ga0070710_10009501 3300005437 Bacteria 4758
72 Ga0070710_10053552 3300005437 Unclassified 2273
73 Ga0070710_10067656 3300005437 Unclassified 2050
74 Ga0070701_10104250 3300005438 Bacteria 1575
75 Ga0070711_100000189 3300005439 Bacteria 32578
76 Ga0070711_100205516 3300005439 Bacteria 1522
77 Ga0070711_100373398 3300005439 Unclassified 1151
78 Ga0070711_100470405 3300005439 Bacteria 1032
79 Ga0070711_100527007 3300005439 Unclassified 977
80 Ga0070705_100084789 3300005440 Bacteria 1956
81 Ga0070708_100007566 3300005445 Bacteria 8696
82 Ga0070708_100042364 3300005445 Unclassified 3996
83 Ga0070708_100112290 3300005445 Bacteria 2506
84 Ga0070708_100471602 3300005445 Bacteria 1184
85 Ga0070708_100546861 3300005445 Bacteria 1092
86 Ga0070708_101041424 3300005445 Bacteria 767
87 Ga0070663_100023615 3300005455 Unclassified 4123
88 Ga0070663_100145113 3300005455 Bacteria 1815
89 Ga0070678_100036215 3300005456 Unclassified 3452
90 Ga0070678_100949140 3300005456 Unclassified 788
91 Ga0070662_100003450 3300005457 Bacteria 9856
92 Ga0070662_100132979 3300005457 Bacteria 1920
93 Ga0070662_100412928 3300005457 Bacteria 1115
94 Ga0070681_10000240 3300005458 Bacteria 43292
95 Ga0070681_10013463 3300005458 Bacteria 8128
96 Ga0070681_10028556 3300005458 Bacteria 5609
97 Ga0070681_10086756 3300005458 Bacteria 3083
98 Ga0068867_100055347 3300005459 Bacteria 2933
99 Ga0068867_100126054 3300005459 Unclassified 1984
100 Ga0068867_100281265 3300005459 Bacteria 1364
101 Ga0068867_100881730 3300005459 Unclassified 804
102 Ga0070685_10032198 3300005466 Bacteria 2935
103 Ga0070706_100001511 3300005467 Bacteria 24411
104 Ga0070706_100001770 3300005467 Bacteria 22364
105 Ga0070706_100041324 3300005467 Bacteria 4258
106 Ga0070706_100957565 3300005467 Bacteria 790
107 Ga0070707_100011671 3300005468 Bacteria 8196
108 Ga0070707_100145261 3300005468 Unclassified 2309
109 Ga0070707_100213684 3300005468 Bacteria 1880
110 Ga0070707_100228108 3300005468 Bacteria 1814
111 Ga0070707_100403105 3300005468 Bacteria 1328
112 Ga0070698_100000027 3300005471 Bacteria 98052
113 Ga0070699_100002870 3300005518 Bacteria 15360
114 Ga0070699_100004068 3300005518 Bacteria 12929
115 Ga0070699_100018651 3300005518 Bacteria 5958
116 Ga0070699_100154303 3300005518 Bacteria 2032
117 Ga0070699_100773998 3300005518 Bacteria 878
118 Ga0070679_100038395 3300005530 Unclassified 4761
119 Ga0070684_100029838 3300005535 Bacteria 4626
120 Ga0070684_100057289 3300005535 Unclassified 3402
121 Ga0070684_100066714 3300005535 Unclassified 3159
122 Ga0070684_100119085 3300005535 Bacteria 2374
123 Ga0070684_100153751 3300005535 Bacteria 2085
124 Ga0070684_100179078 3300005535 Unclassified 1927
125 Ga0070684_100227661 3300005535 Bacteria 1702
126 Ga0070697_100000166 3300005536 Bacteria 53539
127 Ga0070697_100000902 3300005536 Bacteria 22350
128 Ga0070697_100001430 3300005536 Bacteria 18151
129 Ga0070697_100020156 3300005536 Bacteria 5271
130 Ga0070697_100150654 3300005536 Bacteria 1960
131 Ga0070697_100312246 3300005536 Bacteria 1353
132 Ga0070697_100356176 3300005536 Bacteria 1264
133 Ga0068853_100056983 3300005539 Bacteria 3371
134 Ga0068853_100062458 3300005539 Unclassified 3224
135 Ga0070672_100038484 3300005543 Bacteria 3655
136 Ga0070686_100023545 3300005544 Bacteria 3681
137 Ga0070686_100046914 3300005544 Unclassified 2729
138 Ga0070695_100026450 3300005545 Unclassified 3589
139 Ga0070695_100317313 3300005545 Bacteria 1157
140 Ga0070696_100727024 3300005546 Unclassified 811
141 Ga0070693_100012621 3300005547 Unclassified 4279
142 Ga0070693_100034200 3300005547 Bacteria 2811
143 Ga0070693_100388230 3300005547 Unclassified 965
144 Ga0070693_100529769 3300005547 Bacteria 840
145 Ga0070665_100013996 3300005548 Bacteria 8068
146 Ga0068855_100000613 3300005563 Bacteria 43854
147 Ga0068855_100029749 3300005563 Bacteria 6530
148 Ga0068855_100030525 3300005563 Bacteria 6446
149 Ga0068855_100061542 3300005563 Bacteria 4386
150 Ga0068855_100068519 3300005563 Bacteria 4131
151 Ga0068855_100207171 3300005563 Bacteria 2205
152 Ga0070664_100010590 3300005564 Bacteria 7474
153 Ga0070664_100120243 3300005564 Unclassified 2299
154 Ga0070664_100145688 3300005564 Bacteria 2088
155 Ga0068857_100018038 3300005577 Bacteria 6192
156 Ga0068857_100029312 3300005577 Bacteria 4856
157 Ga0068857_100039748 3300005577 Bacteria 4168
158 Ga0068857_100040334 3300005577 Unclassified 4139
159 Ga0068857_100096385 3300005577 Bacteria 2651
160 Ga0068857_101266116 3300005577 Bacteria 715
161 Ga0068854_100004142 3300005578 Bacteria 9114
162 Ga0068854_100065541 3300005578 Bacteria 2641
163 Ga0068854_100127559 3300005578 Bacteria 1939
164 Ga0068856_100000301 3300005614 Bacteria 54178
165 Ga0068856_100003148 3300005614 Bacteria 16824
166 Ga0068856_100016483 3300005614 Bacteria 7153
167 Ga0068856_100049821 3300005614 Bacteria 4129
168 Ga0068856_100051815 3300005614 Bacteria 4046
169 Ga0068856_100074394 3300005614 Unclassified 3363
170 Ga0068856_100187247 3300005614 Unclassified 2084
171 Ga0070702_100050817 3300005615 Bacteria 2370
172 Ga0068852_100120830 3300005616 Unclassified 2398
173 Ga0068859_100017990 3300005617 Bacteria 7102
174 Ga0068859_100046446 3300005617 Bacteria 4361
175 Ga0068864_100005702 3300005618 Bacteria 10210
176 Ga0068864_100007951 3300005618 Bacteria 8740
177 Ga0068864_100053331 3300005618 Unclassified 3488
178 Ga0068864_100347381 3300005618 Unclassified 1399
179 Ga0068866_10005212 3300005718 Bacteria 5355
180 Ga0068866_10006158 3300005718 Bacteria 4992
181 Ga0068866_10077975 3300005718 Bacteria 1771
182 Ga0068866_10638090 3300005718 Bacteria 724
183 Ga0068861_100105650 3300005719 Unclassified 2249
184 Ga0068851_10006603 3300005834 Bacteria 5304
185 Ga0068863_100007945 3300005841 Bacteria 10368
186 Ga0068863_100030625 3300005841 Bacteria 5137
187 Ga0068863_100073982 3300005841 Bacteria 3223
188 Ga0068863_100087421 3300005841 Bacteria 2953
189 Ga0068863_100165038 3300005841 Bacteria 2123
190 Ga0068863_100218909 3300005841 Bacteria 1834
191 Ga0068863_100225165 3300005841 Bacteria 1808
192 Ga0068863_101368174 3300005841 Unclassified 715
193 Ga0068858_100002995 3300005842 Bacteria 16941
194 Ga0068858_100034315 3300005842 Unclassified 4706
195 Ga0068858_100038294 3300005842 Unclassified 4448
196 Ga0068858_100104373 3300005842 Bacteria 2644
197 Ga0068858_100231852 3300005842 Unclassified 1750
198 Ga0068858_100412435 3300005842 Unclassified 1298
199 Ga0068860_100157722 3300005843 Bacteria 2187
200 Ga0068860_100487335 3300005843 Bacteria 1229
201 Ga0068860_100736881 3300005843 Unclassified 997
202 Ga0068862_100029977 3300005844 Bacteria 4584
203 Ga0068862_100440755 3300005844 Bacteria 1226
204 Ga0070717_10010329 3300006028 Bacteria 7044
205 Ga0070717_10030906 3300006028 Bacteria 4304
206 Ga0070717_10079499 3300006028 Bacteria 2750
207 Ga0070717_10102869 3300006028 Unclassified 2427
208 Ga0070717_10964842 3300006028 Unclassified 776
209 Ga0070715_10035024 3300006163 Bacteria 2062
210 Ga0070716_100019392 3300006173 Bacteria 3554
211 Ga0070716_100039732 3300006173 Bacteria 2613
212 Ga0070716_100059805 3300006173 Unclassified 2198
213 Ga0070716_100130822 3300006173 Bacteria 1586
214 Ga0070716_100249904 3300006173 Bacteria 1208
215 Ga0070716_100312244 3300006173 Unclassified 1098
216 Ga0070712_100000047 3300006175 Bacteria 65314
217 Ga0070712_100000156 3300006175 Bacteria 36864
218 Ga0070712_100000942 3300006175 Bacteria 17519
219 Ga0070712_100037870 3300006175 Bacteria 3291
220 Ga0097621_100005769 3300006237 Bacteria 8740
221 Ga0097621_100005828 3300006237 Bacteria 8701
222 Ga0097621_100014010 3300006237 Bacteria 5991
223 Ga0097621_100041212 3300006237 Unclassified 3716
224 Ga0097621_100151550 3300006237 Bacteria 1988
225 Ga0097621_100469081 3300006237 Bacteria 1136
226 Ga0097621_100888978 3300006237 Bacteria 829
227 Ga0068871_100002357 3300006358 Bacteria 12881
228 Ga0068871_100005593 3300006358 Bacteria 8813
229 Ga0068871_100038820 3300006358 Unclassified 3806
230 Ga0068871_100046972 3300006358 Bacteria 3480
231 Ga0068871_100091194 3300006358 Unclassified 2539
232 Ga0075433_10009826 3300006852 Bacteria 7669
233 Ga0075434_100000122 3300006871 Bacteria 45781
234 Ga0075434_100041023 3300006871 Unclassified 4584
235 Ga0068865_100009111 3300006881 Bacteria 6143
236 Ga0068865_100038424 3300006881 Bacteria 3240
237 Ga0068865_100099963 3300006881 Unclassified 2122
238 Ga0068865_100278221 3300006881 Bacteria 1331
239 Ga0097620_100017990 3300006931 Bacteria 7102
240 Ga0097620_100046446 3300006931 Bacteria 4361
241 Ga0075435_100000038 3300007076 Bacteria 67821
242 Ga0099794_10060714 3300007265 Bacteria 1836
243 Ga0099794_10160397 3300007265 Bacteria 1144
244 Ga0099795_10266694 3300007788 Unclassified 743
245 Ga0105240_10031108 3300009093 Bacteria 6925
246 Ga0105240_10043559 3300009093 Bacteria 5710
247 Ga0105240_10152671 3300009093 Bacteria 2749
248 Ga0105240_10192258 3300009093 Bacteria 2399
249 Ga0105240_10378687 3300009093 Bacteria 1599
250 Ga0105240_10496242 3300009093 Bacteria 1358
251 Ga0105240_11078897 3300009093 Bacteria 855
252 Ga0105240_11830972 3300009093 Unclassified 632
253 Ga0105245_10121929 3300009098 Unclassified 2436
254 Ga0105247_10011010 3300009101 Bacteria 5459
255 Ga0105243_10008143 3300009148 Bacteria 8049
256 Ga0105241_10044637 3300009174 Unclassified 3359
257 Ga0105241_10073167 3300009174 Bacteria 2665
258 Ga0105241_10150234 3300009174 Unclassified 1905
259 Ga0105241_10192951 3300009174 Unclassified 1696
260 Ga0105241_10344771 3300009174 Bacteria 1292
261 Ga0105242_10070659 3300009176 Unclassified 2895
262 Ga0105248_10339930 3300009177 Bacteria 1690
263 Ga0105248_10378785 3300009177 Bacteria 1593
264 Ga0105248_10403655 3300009177 Unclassified 1539
265 Ga0105237_10276383 3300009545 Unclassified 1682
266 Ga0105238_10004326 3300009551 Bacteria 14087
267 Ga0105238_10160444 3300009551 Unclassified 2224
268 Ga0105238_10261478 3300009551 Unclassified 1710
269 Ga0105238_10642724 3300009551 Bacteria 1071
270 Ga0105249_10021857 3300009553 Bacteria 5729
271 Ga0105239_10140516 3300010375 Bacteria 2690
272 Ga0105239_10478350 3300010375 Bacteria 1415
273 Ga0105246_10158318 3300011119 Unclassified 1723
274 Ga0157373_10036580 3300013100 Unclassified 3522
275 Ga0157373_10082306 3300013100 Unclassified 2269
276 Ga0157373_10208052 3300013100 Bacteria 1379
277 Ga0157371_10007438 3300013102 Bacteria 8868
278 Ga0157371_10299283 3300013102 Bacteria 1164
279 Ga0157370_10013122 3300013104 Bacteria 8548
280 Ga0157370_10773141 3300013104 Unclassified 874
281 Ga0157369_10000062 3300013105 Bacteria 149758
282 Ga0157369_10011758 3300013105 Bacteria 9940
283 Ga0157369_10049493 3300013105 Unclassified 4556
284 Ga0157369_10204288 3300013105 Bacteria 2073
285 Ga0157369_10260623 3300013105 Bacteria 1808
286 Ga0157369_11556323 3300013105 Bacteria 672
287 Ga0157374_10003803 3300013296 Bacteria 12695
288 Ga0157374_10033233 3300013296 Unclassified 4706
289 Ga0157374_10046947 3300013296 Bacteria 4001
290 Ga0157374_10066557 3300013296 Bacteria 3386
291 Ga0157374_10203300 3300013296 Bacteria 1940
292 Ga0157374_10306254 3300013296 Bacteria 1572
293 Ga0157378_10000642 3300013297 Bacteria 32850
294 Ga0157378_10009037 3300013297 Bacteria 8673
295 Ga0157378_10840433 3300013297 Unclassified 946
296 Ga0163162_10013430 3300013306 Bacteria 7994
297 Ga0163162_10133521 3300013306 Unclassified 2592
298 Ga0157372_10002143 3300013307 Bacteria 21453
299 Ga0157372_10013384 3300013307 Bacteria 8758
300 Ga0157372_10015349 3300013307 Bacteria 8209
301 Ga0157372_10021002 3300013307 Bacteria 7049
302 Ga0157372_10305001 3300013307 Bacteria 1852
303 Ga0157372_11198730 3300013307 Bacteria 877
304 Ga0157375_10263771 3300013308 Unclassified 1884
305 Ga0163163_10008310 3300014325 Bacteria 9213
306 Ga0163163_10012687 3300014325 Bacteria 7686
307 Ga0163163_10341486 3300014325 Bacteria 1553
308 Ga0163163_10378458 3300014325 Unclassified 1473
309 Ga0163163_10607303 3300014325 Bacteria 1157
310 Ga0163163_10979918 3300014325 Unclassified 909
311 Ga0157379_10027997 3300014968 Bacteria 5016
312 Ga0157379_10056330 3300014968 Bacteria 3513
313 Ga0157379_10435503 3300014968 Bacteria 1209
314 Ga0157376_10007530 3300014969 Bacteria 7780
315 Ga0157376_10032463 3300014969 Unclassified 4193
316 Ga0157376_10093279 3300014969 Bacteria 2613
317 Ga0163161_10003472 3300017792 Bacteria 11047
318 Ga0163161_10243342 3300017792 Unclassified 1400
319 Ga0224569_100073 3300022732 Bacteria 6582
320 Ga0224572_1040295 3300024225 Bacteria 881
321 Ga0228598_1006356 3300024227 Bacteria 2448
322 Ga0228598_1009603 3300024227 Unclassified 1936
323 Ga0207656_10001681 3300025321 Bacteria 7348
324 Ga0207692_10032113 3300025898 Bacteria 2520
325 Ga0207692_10036548 3300025898 Viruses 2396
326 Ga0207692_10048216 3300025898 Bacteria 2143
327 Ga0207692_10048417 3300025898 Unclassified 2139
328 Ga0207642_10040472 3300025899 Bacteria 2034
329 Ga0207642_10059141 3300025899 Bacteria 1771
330 Ga0207642_10498310 3300025899 Unclassified 745
331 Ga0207642_10512781 3300025899 Unclassified 736
332 Ga0207710_10026218 3300025900 Unclassified 2518
333 Ga0207680_10588897 3300025903 Unclassified 795
334 Ga0207647_10019160 3300025904 Bacteria 4606
335 Ga0207647_10043106 3300025904 Bacteria 2825
336 Ga0207685_10008290 3300025905 Unclassified 2952
337 Ga0207699_10003485 3300025906 Bacteria 7511
338 Ga0207699_10099128 3300025906 Unclassified 1845
339 Ga0207699_10214134 3300025906 Bacteria 1312
340 Ga0207645_10004345 3300025907 Bacteria 10499
341 Ga0207645_10318924 3300025907 Bacteria 1036
342 Ga0207684_10002047 3300025910 Bacteria 20752
343 Ga0207654_10021567 3300025911 Unclassified 3427
344 Ga0207654_10135201 3300025911 Unclassified 1565
345 Ga0207654_10184037 3300025911 Bacteria 1365
346 Ga0207707_10001726 3300025912 Bacteria 20073
347 Ga0207707_10006889 3300025912 Bacteria 9913
348 Ga0207707_10008133 3300025912 Bacteria 9107
349 Ga0207707_10065257 3300025912 Bacteria 3171
350 Ga0207707_10130042 3300025912 Unclassified 2202
351 Ga0207695_10007368 3300025913 Bacteria 14040
352 Ga0207695_10016928 3300025913 Bacteria 8506
353 Ga0207695_10053134 3300025913 Unclassified 4239
354 Ga0207695_10274621 3300025913 Bacteria 1580
355 Ga0207695_10441653 3300025913 Bacteria 1184
356 Ga0207695_10635253 3300025913 Bacteria 949
357 Ga0207695_10929688 3300025913 Unclassified 749
358 Ga0207671_10011352 3300025914 Bacteria 7258
359 Ga0207671_10270352 3300025914 Bacteria 1339
360 Ga0207671_10586464 3300025914 Unclassified 889
361 Ga0207693_10000044 3300025915 Bacteria 103362
362 Ga0207693_10000546 3300025915 Bacteria 34039
363 Ga0207693_10008427 3300025915 Bacteria 8433
364 Ga0207693_10039483 3300025915 Unclassified 3717
365 Ga0207693_10807933 3300025915 Unclassified 723
366 Ga0207693_10872991 3300025915 Unclassified 691
367 Ga0207663_10000276 3300025916 Bacteria 22338
368 Ga0207663_10003346 3300025916 Bacteria 7829
369 Ga0207663_10074974 3300025916 Bacteria 2194
370 Ga0207663_10219389 3300025916 Bacteria 1383
371 Ga0207663_10252452 3300025916 Bacteria 1299
372 Ga0207660_10075879 3300025917 Unclassified 2457
373 Ga0207660_10194624 3300025917 Unclassified 1581
374 Ga0207662_10023955 3300025918 Bacteria 3511
375 Ga0207657_10004787 3300025919 Bacteria 14280
376 Ga0207649_10027558 3300025920 Unclassified 3335
377 Ga0207649_10186450 3300025920 Bacteria 1456
378 Ga0207652_10039834 3300025921 Bacteria 3989
379 Ga0207652_10197185 3300025921 Bacteria 1812
380 Ga0207646_10139214 3300025922 Unclassified 2185
381 Ga0207646_10153397 3300025922 Bacteria 2077
382 Ga0207646_10182819 3300025922 Bacteria 1894
383 Ga0207681_10033271 3300025923 Bacteria 3378
384 Ga0207681_10093861 3300025923 Unclassified 2149
385 Ga0207694_10002803 3300025924 Bacteria 14072
386 Ga0207694_10241151 3300025924 Bacteria 1477
387 Ga0207694_10752406 3300025924 Unclassified 823
388 Ga0207650_10069413 3300025925 Bacteria 2648
389 Ga0207650_10105049 3300025925 Bacteria 2180
390 Ga0207659_10026119 3300025926 Bacteria 3937
391 Ga0207687_10016503 3300025927 Unclassified 4850
392 Ga0207687_10018851 3300025927 Unclassified 4562
393 Ga0207687_10196841 3300025927 Bacteria 1572
394 Ga0207700_10000227 3300025928 Bacteria 33670
395 Ga0207700_10013275 3300025928 Bacteria 5352
396 Ga0207700_10782273 3300025928 Unclassified 853
397 Ga0207664_10000033 3300025929 Bacteria 176549
398 Ga0207664_10001882 3300025929 Bacteria 13797
399 Ga0207664_10068731 3300025929 Bacteria 2847
400 Ga0207664_10081525 3300025929 Unclassified 2633
401 Ga0207664_10083518 3300025929 Unclassified 2604
402 Ga0207664_10510341 3300025929 Unclassified 1077
403 Ga0207664_10632710 3300025929 Unclassified 961
404 Ga0207664_10780700 3300025929 Bacteria 859
405 Ga0207644_10061471 3300025931 Bacteria 2720
406 Ga0207690_10007025 3300025932 Bacteria 6676
407 Ga0207690_10083627 3300025932 Bacteria 2235
408 Ga0207690_10887275 3300025932 Unclassified 739
409 Ga0207706_10000048 3300025933 Bacteria 117454
410 Ga0207706_10004287 3300025933 Bacteria 13405
411 Ga0207686_10020997 3300025934 Bacteria 3740
412 Ga0207709_10014364 3300025935 Bacteria 4371
413 Ga0207709_10528515 3300025935 Unclassified 924
414 Ga0207670_10018499 3300025936 Bacteria 4236
415 Ga0207669_10062980 3300025937 Bacteria 2287
416 Ga0207704_10025162 3300025938 Bacteria 3244
417 Ga0207704_10235961 3300025938 Bacteria 1363
418 Ga0207704_10249357 3300025938 Bacteria 1332
419 Ga0207704_10474730 3300025938 Unclassified 1003
420 Ga0207665_10007003 3300025939 Bacteria 7464
421 Ga0207665_10027020 3300025939 Bacteria 3791
422 Ga0207665_10030897 3300025939 Unclassified 3542
423 Ga0207665_10056654 3300025939 Unclassified 2646
424 Ga0207665_10063047 3300025939 Bacteria 2516
425 Ga0207665_10073299 3300025939 Bacteria 2341
426 Ga0207665_10239544 3300025939 Bacteria 1336
427 Ga0207711_10002079 3300025941 Bacteria 18085
428 Ga0207711_10064465 3300025941 Bacteria 3165
429 Ga0207711_10286743 3300025941 Bacteria 1517
430 Ga0207711_10420984 3300025941 Bacteria 1242
431 Ga0207711_10933647 3300025941 Unclassified 806
432 Ga0207689_10024566 3300025942 Bacteria 5055
433 Ga0207689_10411521 3300025942 Bacteria 1128
434 Ga0207661_10014514 3300025944 Bacteria 5777
435 Ga0207661_10116844 3300025944 Unclassified 2265
436 Ga0207661_10248842 3300025944 Unclassified 1579
437 Ga0207661_10267084 3300025944 Unclassified 1526
438 Ga0207661_10466460 3300025944 Bacteria 1151
439 Ga0207679_10025891 3300025945 Bacteria 4040
440 Ga0207667_10004050 3300025949 Bacteria 18001
441 Ga0207667_10015367 3300025949 Bacteria 8700
442 Ga0207667_10038731 3300025949 Bacteria 5086
443 Ga0207667_10045760 3300025949 Bacteria 4634
444 Ga0207667_10045832 3300025949 Bacteria 4630
445 Ga0207667_10473559 3300025949 Bacteria 1271
446 Ga0207651_10502299 3300025960 Bacteria 1048
447 Ga0207712_10025325 3300025961 Bacteria 3941
448 Ga0207668_10089715 3300025972 Unclassified 2254
449 Ga0207640_10002588 3300025981 Bacteria 9689
450 Ga0207640_10016043 3300025981 Bacteria 4348
451 Ga0207640_10100856 3300025981 Bacteria 2024
452 Ga0207640_10496584 3300025981 Bacteria 1015
453 Ga0207677_10006906 3300026023 Bacteria 6240
454 Ga0207677_10006966 3300026023 Bacteria 6216
455 Ga0207677_10008286 3300026023 Bacteria 5794
456 Ga0207677_10066432 3300026023 Bacteria 2521
457 Ga0207677_10481520 3300026023 Bacteria 1069
458 Ga0207703_10019172 3300026035 Bacteria 5343
459 Ga0207703_10049286 3300026035 Bacteria 3404
460 Ga0207703_10599126 3300026035 Bacteria 1042
461 Ga0207703_10661853 3300026035 Unclassified 991
462 Ga0207639_10057070 3300026041 Unclassified 2996
463 Ga0207639_10120900 3300026041 Bacteria 2151
464 Ga0207639_10983221 3300026041 Unclassified 790
465 Ga0207678_10000388 3300026067 Bacteria 40020
466 Ga0207702_10000103 3300026078 Bacteria 99037
467 Ga0207702_10010459 3300026078 Bacteria 7761
468 Ga0207702_10011091 3300026078 Bacteria 7523
469 Ga0207702_10016045 3300026078 Bacteria 6202
470 Ga0207702_10037549 3300026078 Bacteria 4055
471 Ga0207641_10026330 3300026088 Bacteria 4799
472 Ga0207641_10170914 3300026088 Unclassified 1984
473 Ga0207641_10171411 3300026088 Bacteria 1981
474 Ga0207641_10198265 3300026088 Bacteria 1849
475 Ga0207641_11025329 3300026088 Bacteria 822
476 Ga0207648_10193083 3300026089 Unclassified 1805
477 Ga0207648_11043539 3300026089 Bacteria 766
478 Ga0207676_10003135 3300026095 Bacteria 11803
479 Ga0207676_10008304 3300026095 Bacteria 7381
480 Ga0207676_10110346 3300026095 Unclassified 2301
481 Ga0207674_10026149 3300026116 Bacteria 6209
482 Ga0207674_10030769 3300026116 Bacteria 5642
483 Ga0207674_10101313 3300026116 Unclassified 2861
484 Ga0207674_10352100 3300026116 Bacteria 1424
485 Ga0207675_100746632 3300026118 Unclassified 990
486 Ga0207683_10156451 3300026121 Bacteria 2059
487 Ga0207683_10169468 3300026121 Unclassified 1977
488 Ga0207683_10425894 3300026121 Bacteria 1223
489 Ga0207698_10036793 3300026142 Bacteria 3598
490 Ga0207698_10158456 3300026142 Unclassified 1976
491 Ga0207698_10410216 3300026142 Unclassified 1297
492 Ga0209588_1063959 3300027671 Unclassified 1189
493 Ga0265356_1004331 3300028017 Unclassified 1739
494 Ga0265355_1007244 3300028036 Unclassified 876
495 Ga0268265_10438501 3300028380 Bacteria 1217
496 Ga0268265_11420130 3300028380 Unclassified 696
497 Ga0268264_10062769 3300028381 Bacteria 3121
498 Ga0268264_10120092 3300028381 Bacteria 2315
499 Ga0268264_10849818 3300028381 Bacteria 914
500 Ga0265324_10029057 3300029957 Unclassified 1947
501 Ga0265762_1000722 3300030760 Bacteria 5854
502 Ga0265760_10000974 3300031090 Bacteria 8273
503 Ga0265760_10010066 3300031090 Unclassified 2697
504 Ga0265760_10029761 3300031090 Unclassified 1606
505 Ga0265325_10229761 3300031241 Bacteria 846
506 Ga0265339_10004141 3300031249 Bacteria 9984
507 Ga0265339_10007071 3300031249 Bacteria 7287
508 Ga0265339_10118926 3300031249 Bacteria 1360
509 Ga0265316_10027894 3300031344 Unclassified 4667
510 Ga0265314_10121664 3300031711 Bacteria 1642
511 Ga0265342_10171789 3300031712 Bacteria 1192
512 Ga0307507_10444039 3300033179 Unclassified 719
513 Ga0316212_1023521 3300033547 Unclassified 863
514 Ga0373934_0054997 3300035086 Bacteria 1581
515 Ga0373934_0090121 3300035086 Bacteria 1236
516 Ga0373944_0115319 3300035089 Bacteria 921
517 Ga0373923_0066597 3300035111 Bacteria 1539
518 Ga0373923_0559155 3300035111 Unclassified 561
519 Ga0373932_0131755 3300035112 Unclassified 843
520 Ga0373936_0075443 3300035113 Unclassified 1396
521 Ga0373936_0197991 3300035113 Unclassified 886
522 Ga0373939_0069983 3300035114 Unclassified 1140
523 Ga0373941_0144293 3300035115 Unclassified 868
524 Ga0373945_0028180 3300035116 Bacteria 1966
525 Ga0373953_0010722 3300035117 Bacteria 3198
526 Ga0373957_0035344 3300035120 Bacteria 1856
527 Ga0373943_0000285 3300035170 Bacteria 20949
528 Ga0373955_0075406 3300035172 Bacteria 1895
529 Ga0373961_0029016 3300035241 Unclassified 1530
530 Ga0373924_0142330 3300035410 Bacteria 1047
531 Ga0373931_0031833 3300035691 Unclassified 2725
532 Ga0373935_0013492 3300035692 Bacteria 4930
533 Ga0373927_0000123 3300035695 Bacteria 58803
534 Ga0373927_0231852 3300035695 Unclassified 1213
535 Ga0373927_0314110 3300035695 Bacteria 1032
536 Ga0373933_0300925 3300035724 Bacteria 1038
537 Ga0373933_0326900 3300035724 Unclassified 995
538 Ga0373933_0340629 3300035724 Bacteria 973
539 Ga0373933_0546124 3300035724 Bacteria 760
540 Ga0373947_0000757 3300035725 Bacteria 19372
541 Ga0373947_0432838 3300035725 Bacteria 890
542 Ga0373937_0081875 3300036401 Bacteria 2986
543 Ga0373937_0302611 3300036401 Bacteria 1511
544 Ga0373925_0000589 3300037068 Bacteria 35013
545 Ga0373925_0044633 3300037068 Bacteria 3291
546 Ga0395905_0004541 3300037471 Bacteria 14376
547 Ga0395905_0264854 3300037471 Unclassified 1604
548 Ga0395905_0398990 3300037471 Bacteria 1270
549 Ga0395905_0826696 3300037471 Unclassified 829
550 Ga0395901_0133117 3300038443 Unclassified 2613
551 Ga0436363_0510861 3300039450 Bacteria 903
552 Ga0466966_0299988 3300044684 Unclassified 966
553 Ga0466961_0348145 3300044693 Unclassified 902
554 Ga0466964_0129400 3300044706 Bacteria 1148
555 Ga0466957_0045658 3300044842 Bacteria 2658
556 Ga0451576_0246025 3300045051 Unclassified 1869
557 Ga0451576_0256649 3300045051 Unclassified 1827
558 Ga0451576_0554683 3300045051 Bacteria 1207
559 Ga0466967_0123984 3300045976 Bacteria 2391
560 Ga0495590_0144366 3300046457 Unclassified 860
561 Ga0495651_0648688 3300046462 Bacteria 662
562 Ga0495580_0003591 3300046472 Bacteria 13156
563 Ga0495580_0262148 3300046472 Unclassified 1182
564 Ga0495582_0131049 3300046473 Bacteria 1417
565 Ga0495639_0374040 3300046475 Bacteria 717
566 Ga0495664_0012707 3300046477 Bacteria 4769
567 Ga0495634_0304982 3300046642 Bacteria 962
568 Ga0495635_0175301 3300046663 Bacteria 1458
569 Ga0495635_0211793 3300046663 Bacteria 1312
570 Ga0495658_0404023 3300046683 Bacteria 871
571 Ga0495669_0021567 3300046684 Bacteria 2796
572 Ga0495669_0049218 3300046684 Bacteria 1886
573 Ga0495669_0081356 3300046684 Bacteria 1487
574 Ga0495581_0019317 3300047315 Bacteria 3955
575 Ga0495604_0486483 3300047317 Unclassified 802
576 Ga0495675_0488516 3300047444 Unclassified 708
577 Ga0495677_0217556 3300047445 Bacteria 744
578 Ga0495602_0097078 3300048088 Unclassified 2429
579 Ga0495602_0449164 3300048088 Unclassified 910
580 Ga0496100_0241249 3300048903 Bacteria 1333
581 Ga0496100_0351876 3300048903 Bacteria 1113
582 Ga0496100_0455345 3300048903 Unclassified 981
583 Ga0496101_0399436 3300048904 Unclassified 1082
584 Ga0496101_0690590 3300048904 Bacteria 806
585 Ga0496102_0089133 3300048905 Unclassified 2853
586 Ga0496102_0656628 3300048905 Bacteria 972
587 Ga0496102_1652450 3300048905 Unclassified 559
588 Ga0496103_0023344 3300048906 Unclassified 3729
589 Ga0496103_0499078 3300048906 Bacteria 779
590 Ga0496104_0044769 3300048907 Unclassified 4159
591 Ga0496104_0069315 3300048907 Bacteria 3352
592 Ga0496104_0095580 3300048907 Bacteria 2843
593 Ga0496107_0256285 3300048910 Unclassified 1302
594 Ga0496108_0097456 3300048911 Unclassified 2506
595 Ga0496108_0820695 3300048911 Unclassified 802
596 Ga0496109_0181278 3300048912 Bacteria 1978
597 Ga0496109_0312740 3300048912 Unclassified 1482
598 Ga0496109_0384272 3300048912 Bacteria 1326
599 Ga0496109_0384434 3300048912 Bacteria 1326
600 Ga0496111_0140455 3300048914 Unclassified 1790
601 Ga0496112_0004401 3300048915 Bacteria 11918
602 Ga0496112_0011842 3300048915 Bacteria 7987
603 Ga0496112_0023777 3300048915 Bacteria 5861
604 Ga0496112_0026292 3300048915 Bacteria 5598
605 Ga0496112_0506089 3300048915 Bacteria 1143
606 Ga0496113_0375511 3300048916 Unclassified 1141
607 Ga0496114_0428056 3300048917 Bacteria 1172
608 Ga0496115_0004761 3300048918 Bacteria 9850
609 Ga0496115_0025996 3300048918 Unclassified 4564
610 Ga0496115_0173741 3300048918 Unclassified 1781
611 Ga0496115_0178677 3300048918 Bacteria 1755
612 Ga0501083_0121975 3300049744 Bacteria 1709
613 nmdc:mga0n895_102_c1 3300050512 Bacteria 50003
614 nmdc:mga0rr50_1252_c1 3300050513 Bacteria 13842
615 nmdc:mga0rr50_758039_c1 3300050513 Bacteria 828
616 nmdc:mga0a205_517_c2 3300050515 Bacteria 27716
617 Ga0495619_0113031 3300053085 Unclassified 1857
618 Ga0068853_100082167
619 JGI24737J22298_10026801
620 JGI24743J22301_10005677
621 JGI24034J26672_10004111
622 JGI24751J29686_10004013
623 Ga0065712_10083440
624 Ga0065715_10097655
625 Ga0070676_10076097
626 Ga0070676_10585662
627 Ga0070683_100004621
628 Ga0070683_100030596
629 Ga0070683_100033402
630 Ga0070683_100035148
631 Ga0070683_100541129
632 Ga0070690_100600168
633 Ga0070670_100021813
634 Ga0070670_100160622
635 Ga0070670_100461689
636 Ga0070677_10029087
637 Ga0068869_100029673
638 Ga0068869_100175491
639 Ga0070666_10093676
640 Ga0070666_10574237
641 Ga0070680_100046372
642 Ga0070680_100176394
643 Ga0070680_100333078
644 Ga0068868_100006913
645 Ga0068868_100014935
646 Ga0068868_100021307
647 Ga0068868_100173583
648 Ga0068868_100516392
649 Ga0070660_100221912
650 Ga0070660_100257143
651 Ga0070660_100539263
652 Ga0070689_100034323
653 Ga0070689_100040779
654 Ga0070687_100014876
655 Ga0070687_100035473
656 Ga0070661_100012703
657 Ga0070661_100075457
658 Ga0070692_10159222
659 Ga0070668_100043649
660 Ga0070668_100220127
661 Ga0070669_100024622
662 Ga0070669_100204116
663 Ga0070669_100349247
664 Ga0070675_100243604
665 Ga0070675_100545298
666 Ga0070674_100954816
667 Ga0070673_100110050
668 Ga0070673_100455933
669 Ga0070673_100516016
670 Ga0070688_100029203
671 Ga0070688_100195076
672 Ga0070659_100121868
673 Ga0070667_100483557
674 Ga0070709_10000752
675 Ga0070709_10021642
676 Ga0070709_10199252
677 Ga0070714_100000128
678 Ga0070714_100002798
679 Ga0070714_100063480
680 Ga0070714_100094578
681 Ga0070714_100471884
682 Ga0070713_100000133
683 Ga0070713_100002561
684 Ga0070713_100032383
685 Ga0070713_100301389
686 Ga0070713_100335201
687 Ga0070713_100506022
688 Ga0070710_10009501
689 Ga0070710_10053552
690 Ga0070710_10067656
691 Ga0070701_10104250
692 Ga0070711_100000189
693 Ga0070711_100205516
694 Ga0070711_100373398
695 Ga0070711_100470405
696 Ga0070711_100527007
697 Ga0070705_100084789
698 Ga0070708_100007566
699 Ga0070708_100042364
700 Ga0070708_100112290
701 Ga0070708_100471602
702 Ga0070708_100546861
703 Ga0070708_101041424
704 Ga0070663_100023615
705 Ga0070663_100145113
706 Ga0070678_100036215
707 Ga0070678_100949140
708 Ga0070662_100003450
709 Ga0070662_100132979
710 Ga0070662_100412928
711 Ga0070681_10000240
712 Ga0070681_10013463
713 Ga0070681_10028556
714 Ga0070681_10086756
715 Ga0068867_100055347
716 Ga0068867_100126054
717 Ga0068867_100281265
718 Ga0068867_100881730
719 Ga0070685_10032198
720 Ga0070706_100001511
721 Ga0070706_100001770
722 Ga0070706_100041324
723 Ga0070706_100957565
724 Ga0070707_100011671
725 Ga0070707_100145261
726 Ga0070707_100213684
727 Ga0070707_100228108
728 Ga0070707_100403105
729 Ga0070698_100000027
730 Ga0070699_100002870
731 Ga0070699_100004068
732 Ga0070699_100018651
733 Ga0070699_100154303
734 Ga0070699_100773998
735 Ga0070679_100038395
736 Ga0070684_100029838
737 Ga0070684_100057289
738 Ga0070684_100066714
739 Ga0070684_100119085
740 Ga0070684_100153751
741 Ga0070684_100179078
742 Ga0070684_100227661
743 Ga0070697_100000166
744 Ga0070697_100000902
745 Ga0070697_100001430
746 Ga0070697_100020156
747 Ga0070697_100150654
748 Ga0070697_100312246
749 Ga0070697_100356176
750 Ga0068853_100056983
751 Ga0068853_100062458
752 Ga0070672_100038484
753 Ga0070686_100023545
754 Ga0070686_100046914
755 Ga0070695_100026450
756 Ga0070695_100317313
757 Ga0070696_100727024
758 Ga0070693_100012621
759 Ga0070693_100034200
760 Ga0070693_100388230
761 Ga0070693_100529769
762 Ga0070665_100013996
763 Ga0068855_100000613
764 Ga0068855_100029749
765 Ga0068855_100030525
766 Ga0068855_100061542
767 Ga0068855_100068519
768 Ga0068855_100207171
769 Ga0070664_100010590
770 Ga0070664_100120243
771 Ga0070664_100145688
772 Ga0068857_100018038
773 Ga0068857_100029312
774 Ga0068857_100039748
775 Ga0068857_100040334
776 Ga0068857_100096385
777 Ga0068857_101266116
778 Ga0068854_100004142
779 Ga0068854_100065541
780 Ga0068854_100127559
781 Ga0068856_100000301
782 Ga0068856_100003148
783 Ga0068856_100016483
784 Ga0068856_100049821
785 Ga0068856_100051815
786 Ga0068856_100074394
787 Ga0068856_100187247
788 Ga0070702_100050817
789 Ga0068852_100120830
790 Ga0068859_100017990
791 Ga0068859_100046446
792 Ga0068864_100005702
793 Ga0068864_100007951
794 Ga0068864_100053331
795 Ga0068864_100347381
796 Ga0068866_10005212
797 Ga0068866_10006158
798 Ga0068866_10077975
799 Ga0068866_10638090
800 Ga0068861_100105650
801 Ga0068851_10006603
802 Ga0068863_100007945
803 Ga0068863_100030625
804 Ga0068863_100073982
805 Ga0068863_100087421
806 Ga0068863_100165038
807 Ga0068863_100218909
808 Ga0068863_100225165
809 Ga0068863_101368174
810 Ga0068858_100002995
811 Ga0068858_100034315
812 Ga0068858_100038294
813 Ga0068858_100104373
814 Ga0068858_100231852
815 Ga0068858_100412435
816 Ga0068860_100157722
817 Ga0068860_100487335
818 Ga0068860_100736881
819 Ga0068862_100029977
820 Ga0068862_100440755
821 Ga0070717_10010329
822 Ga0070717_10030906
823 Ga0070717_10079499
824 Ga0070717_10102869
825 Ga0070717_10964842
826 Ga0070715_10035024
827 Ga0070716_100019392
828 Ga0070716_100039732
829 Ga0070716_100059805
830 Ga0070716_100130822
831 Ga0070716_100249904
832 Ga0070716_100312244
833 Ga0070712_100000047
834 Ga0070712_100000156
835 Ga0070712_100000942
836 Ga0070712_100037870
837 Ga0097621_100005769
838 Ga0097621_100005828
839 Ga0097621_100014010
840 Ga0097621_100041212
841 Ga0097621_100151550
842 Ga0097621_100469081
843 Ga0097621_100888978
844 Ga0068871_100002357
845 Ga0068871_100005593
846 Ga0068871_100038820
847 Ga0068871_100046972
848 Ga0068871_100091194
849 Ga0075433_10009826
850 Ga0075434_100000122
851 Ga0075434_100041023
852 Ga0068865_100009111
853 Ga0068865_100038424
854 Ga0068865_100099963
855 Ga0068865_100278221
856 Ga0097620_100017990
857 Ga0097620_100046446
858 Ga0075435_100000038
859 Ga0099794_10060714
860 Ga0099794_10160397
861 Ga0099795_10266694
862 Ga0105240_10031108
863 Ga0105240_10043559
864 Ga0105240_10152671
865 Ga0105240_10192258
866 Ga0105240_10378687
867 Ga0105240_10496242
868 Ga0105240_11078897
869 Ga0105240_11830972
870 Ga0105245_10121929
871 Ga0105247_10011010
872 Ga0105243_10008143
873 Ga0105241_10044637
874 Ga0105241_10073167
875 Ga0105241_10150234
876 Ga0105241_10192951
877 Ga0105241_10344771
878 Ga0105242_10070659
879 Ga0105248_10339930
880 Ga0105248_10378785
881 Ga0105248_10403655
882 Ga0105237_10276383
883 Ga0105238_10004326
884 Ga0105238_10160444
885 Ga0105238_10261478
886 Ga0105238_10642724
887 Ga0105249_10021857
888 Ga0105239_10140516
889 Ga0105239_10478350
890 Ga0105246_10158318
891 Ga0157373_10036580
892 Ga0157373_10082306
893 Ga0157373_10208052
894 Ga0157371_10007438
895 Ga0157371_10299283
896 Ga0157370_10013122
897 Ga0157370_10773141
898 Ga0157369_10000062
899 Ga0157369_10011758
900 Ga0157369_10049493
901 Ga0157369_10204288
902 Ga0157369_10260623
903 Ga0157369_11556323
904 Ga0157374_10003803
905 Ga0157374_10033233
906 Ga0157374_10046947
907 Ga0157374_10066557
908 Ga0157374_10203300
909 Ga0157374_10306254
910 Ga0157378_10000642
911 Ga0157378_10009037
912 Ga0157378_10840433
913 Ga0163162_10013430
914 Ga0163162_10133521
915 Ga0157372_10002143
916 Ga0157372_10013384
917 Ga0157372_10015349
918 Ga0157372_10021002
919 Ga0157372_10305001
920 Ga0157372_11198730
921 Ga0157375_10263771
922 Ga0163163_10008310
923 Ga0163163_10012687
924 Ga0163163_10341486
925 Ga0163163_10378458
926 Ga0163163_10607303
927 Ga0163163_10979918
928 Ga0157379_10027997
929 Ga0157379_10056330
930 Ga0157379_10435503
931 Ga0157376_10007530
932 Ga0157376_10032463
933 Ga0157376_10093279
934 Ga0163161_10003472
935 Ga0163161_10243342
936 Ga0224569_100073
937 Ga0224572_1040295
938 Ga0228598_1006356
939 Ga0228598_1009603
940 Ga0207656_10001681
941 Ga0207692_10032113
942 Ga0207692_10036548
943 Ga0207692_10048216
944 Ga0207692_10048417
945 Ga0207642_10040472
946 Ga0207642_10059141
947 Ga0207642_10498310
948 Ga0207642_10512781
949 Ga0207710_10026218
950 Ga0207680_10588897
951 Ga0207647_10019160
952 Ga0207647_10043106
953 Ga0207685_10008290
954 Ga0207699_10003485
955 Ga0207699_10099128
956 Ga0207699_10214134
957 Ga0207645_10004345
958 Ga0207645_10318924
959 Ga0207684_10002047
960 Ga0207654_10021567
961 Ga0207654_10135201
962 Ga0207654_10184037
963 Ga0207707_10001726
964 Ga0207707_10006889
965 Ga0207707_10008133
966 Ga0207707_10065257
967 Ga0207707_10130042
968 Ga0207695_10007368
969 Ga0207695_10016928
970 Ga0207695_10053134
971 Ga0207695_10274621
972 Ga0207695_10441653
973 Ga0207695_10635253
974 Ga0207695_10929688
975 Ga0207671_10011352
976 Ga0207671_10270352
977 Ga0207671_10586464
978 Ga0207693_10000044
979 Ga0207693_10000546
980 Ga0207693_10008427
981 Ga0207693_10039483
982 Ga0207693_10807933
983 Ga0207693_10872991
984 Ga0207663_10000276
985 Ga0207663_10003346
986 Ga0207663_10074974
987 Ga0207663_10219389
988 Ga0207663_10252452
989 Ga0207660_10075879
990 Ga0207660_10194624
991 Ga0207662_10023955
992 Ga0207657_10004787
993 Ga0207649_10027558
994 Ga0207649_10186450
995 Ga0207652_10039834
996 Ga0207652_10197185
997 Ga0207646_10139214
998 Ga0207646_10153397
999 Ga0207646_10182819
1000 Ga0207681_10033271
1001 Ga0207681_10093861
1002 Ga0207694_10002803
1003 Ga0207694_10241151
1004 Ga0207694_10752406
1005 Ga0207650_10069413
1006 Ga0207650_10105049
1007 Ga0207659_10026119
1008 Ga0207687_10016503
1009 Ga0207687_10018851
1010 Ga0207687_10196841
1011 Ga0207700_10000227
1012 Ga0207700_10013275
1013 Ga0207700_10782273
1014 Ga0207664_10000033
1015 Ga0207664_10001882
1016 Ga0207664_10068731
1017 Ga0207664_10081525
1018 Ga0207664_10083518
1019 Ga0207664_10510341
1020 Ga0207664_10632710
1021 Ga0207664_10780700
1022 Ga0207644_10061471
1023 Ga0207690_10007025
1024 Ga0207690_10083627
1025 Ga0207690_10887275
1026 Ga0207706_10000048
1027 Ga0207706_10004287
1028 Ga0207686_10020997
1029 Ga0207709_10014364
1030 Ga0207709_10528515
1031 Ga0207670_10018499
1032 Ga0207669_10062980
1033 Ga0207704_10025162
1034 Ga0207704_10235961
1035 Ga0207704_10249357
1036 Ga0207704_10474730
1037 Ga0207665_10007003
1038 Ga0207665_10027020
1039 Ga0207665_10030897
1040 Ga0207665_10056654
1041 Ga0207665_10063047
1042 Ga0207665_10073299
1043 Ga0207665_10239544
1044 Ga0207711_10002079
1045 Ga0207711_10064465
1046 Ga0207711_10286743
1047 Ga0207711_10420984
1048 Ga0207711_10933647
1049 Ga0207689_10024566
1050 Ga0207689_10411521
1051 Ga0207661_10014514
1052 Ga0207661_10116844
1053 Ga0207661_10248842
1054 Ga0207661_10267084
1055 Ga0207661_10466460
1056 Ga0207679_10025891
1057 Ga0207667_10004050
1058 Ga0207667_10015367
1059 Ga0207667_10038731
1060 Ga0207667_10045760
1061 Ga0207667_10045832
1062 Ga0207667_10473559
1063 Ga0207651_10502299
1064 Ga0207712_10025325
1065 Ga0207668_10089715
1066 Ga0207640_10002588
1067 Ga0207640_10016043
1068 Ga0207640_10100856
1069 Ga0207640_10496584
1070 Ga0207677_10006906
1071 Ga0207677_10006966
1072 Ga0207677_10008286
1073 Ga0207677_10066432
1074 Ga0207677_10481520
1075 Ga0207703_10019172
1076 Ga0207703_10049286
1077 Ga0207703_10599126
1078 Ga0207703_10661853
1079 Ga0207639_10057070
1080 Ga0207639_10120900
1081 Ga0207639_10983221
1082 Ga0207678_10000388
1083 Ga0207702_10000103
1084 Ga0207702_10010459
1085 Ga0207702_10011091
1086 Ga0207702_10016045
1087 Ga0207702_10037549
1088 Ga0207641_10026330
1089 Ga0207641_10170914
1090 Ga0207641_10171411
1091 Ga0207641_10198265
1092 Ga0207641_11025329
1093 Ga0207648_10193083
1094 Ga0207648_11043539
1095 Ga0207676_10003135
1096 Ga0207676_10008304
1097 Ga0207676_10110346
1098 Ga0207674_10026149
1099 Ga0207674_10030769
1100 Ga0207674_10101313
1101 Ga0207674_10352100
1102 Ga0207675_100746632
1103 Ga0207683_10156451
1104 Ga0207683_10169468
1105 Ga0207683_10425894
1106 Ga0207698_10036793
1107 Ga0207698_10158456
1108 Ga0207698_10410216
1109 Ga0209588_1063959
1110 Ga0265356_1004331
1111 Ga0265355_1007244
1112 Ga0268265_10438501
1113 Ga0268265_11420130
1114 Ga0268264_10062769
1115 Ga0268264_10120092
1116 Ga0268264_10849818
1117 Ga0265324_10029057
1118 Ga0265762_1000722
1119 Ga0265760_10000974
1120 Ga0265760_10010066
1121 Ga0265760_10029761
1122 Ga0265325_10229761
1123 Ga0265339_10004141
1124 Ga0265339_10007071
1125 Ga0265339_10118926
1126 Ga0265316_10027894
1127 Ga0265314_10121664
1128 Ga0265342_10171789
1129 Ga0307507_10444039
1130 Ga0316212_1023521
1131 Ga0373934_0054997
1132 Ga0373934_0090121
1133 Ga0373944_0115319
1134 Ga0373923_0066597
1135 Ga0373923_0559155
1136 Ga0373932_0131755
1137 Ga0373936_0075443
1138 Ga0373936_0197991
1139 Ga0373939_0069983
1140 Ga0373941_0144293
1141 Ga0373945_0028180
1142 Ga0373953_0010722
1143 Ga0373957_0035344
1144 Ga0373943_0000285
1145 Ga0373955_0075406
1146 Ga0373961_0029016
1147 Ga0373924_0142330
1148 Ga0373931_0031833
1149 Ga0373935_0013492
1150 Ga0373927_0000123
1151 Ga0373927_0231852
1152 Ga0373927_0314110
1153 Ga0373933_0300925
1154 Ga0373933_0326900
1155 Ga0373933_0340629
1156 Ga0373933_0546124
1157 Ga0373947_0000757
1158 Ga0373947_0432838
1159 Ga0373937_0081875
1160 Ga0373937_0302611
1161 Ga0373925_0000589
1162 Ga0373925_0044633
1163 Ga0395905_0004541
1164 Ga0395905_0264854
1165 Ga0395905_0398990
1166 Ga0395905_0826696
1167 Ga0395901_0133117
1168 Ga0436363_0510861
1169 Ga0466966_0299988
1170 Ga0466961_0348145
1171 Ga0466964_0129400
1172 Ga0466957_0045658
1173 Ga0451576_0246025
1174 Ga0451576_0256649
1175 Ga0451576_0554683
1176 Ga0466967_0123984
1177 Ga0495590_0144366
1178 Ga0495651_0648688
1179 Ga0495580_0003591
1180 Ga0495580_0262148
1181 Ga0495582_0131049
1182 Ga0495639_0374040
1183 Ga0495664_0012707
1184 Ga0495634_0304982
1185 Ga0495635_0175301
1186 Ga0495635_0211793
1187 Ga0495658_0404023
1188 Ga0495669_0021567
1189 Ga0495669_0049218
1190 Ga0495669_0081356
1191 Ga0495581_0019317
1192 Ga0495604_0486483
1193 Ga0495675_0488516
1194 Ga0495677_0217556
1195 Ga0495602_0097078
1196 Ga0495602_0449164
1197 Ga0496100_0241249
1198 Ga0496100_0351876
1199 Ga0496100_0455345
1200 Ga0496101_0399436
1201 Ga0496101_0690590
1202 Ga0496102_0089133
1203 Ga0496102_0656628
1204 Ga0496102_1652450
1205 Ga0496103_0023344
1206 Ga0496103_0499078
1207 Ga0496104_0044769
1208 Ga0496104_0069315
1209 Ga0496104_0095580
1210 Ga0496107_0256285
1211 Ga0496108_0097456
1212 Ga0496108_0820695
1213 Ga0496109_0181278
1214 Ga0496109_0312740
1215 Ga0496109_0384272
1216 Ga0496109_0384434
1217 Ga0496111_0140455
1218 Ga0496112_0004401
1219 Ga0496112_0011842
1220 Ga0496112_0023777
1221 Ga0496112_0026292
1222 Ga0496112_0506089
1223 Ga0496113_0375511
1224 Ga0496114_0428056
1225 Ga0496115_0004761
1226 Ga0496115_0025996
1227 Ga0496115_0173741
1228 Ga0496115_0178677
1229 Ga0501083_0121975
1230 nmdc:mga0n895_102_c1
1231 nmdc:mga0rr50_1252_c1
1232 nmdc:mga0rr50_758039_c1
1233 nmdc:mga0a205_517_c2
1234 Ga0495619_0113031

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04390

LptE

Lipopolysaccharide-assembly

75

209

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
7rxu-assembly1.cif.gz_A crystal structure of cj1090c 0.7216 34 174
5t0z-assembly1.cif.gz_B pelc from geobacter metallireducens 0.7038 34 177
7rxu-assembly1.cif.gz_A crystal structure of cj1090c 0.7038 34 174
5t0z-assembly1.cif.gz_A pelc from geobacter metallireducens 0.7022 36 177
5lbt-assembly1.cif.gz_B structure of the human quinone reductase 2 (nqo2) in complex with imiquimod 0.6938 40 78
ID Description Score Start End Superfamily
af_Q20075_21_148_3.10.450.50 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.7687 88 146 3.10.450.50
5lbtB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.6938 40 78 3.40.50.360
af_Q75JX1_270_414_3.40.50.10330 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Probable inorganic polyphosphate/atp-NAD kinase; domain 1 0.6673 36 78 3.40.50.10330
3bf2A00 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain;Lipoprotein like domain 0.6609 38 174 3.30.160.150
5dleD00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.6522 39 91 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A2V8XI06-F1-model_v4 LptE family protein 0.8839 20 178 GO:0019867
GO:0043165
AF-A0A7W7ZMK8-F1-model_v4 Outer membrane lipopolysaccharide assembly protein LptE/RlpB 0.8832 5 177 GO:0019867
GO:0043165
AF-A0A831PQ58-F1-model_v4 Uncharacterized protein 0.8804 34 178 GO:0019867
GO:0043165
AF-A0A831PQ58-F1-model_v4 Uncharacterized protein 0.8691 34 178 GO:0019867
GO:0043165
AF-A0A2V9DQ23-F1-model_v4 LptE family protein 0.8663 20 178 GO:0019867
GO:0043165

Map