F469616
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 617 | 250 | 1234 | 186 |
Family's Representative Sequence
| Representative Sequence | 3300005539|Ga0068853_100082167|Ga0068853_1000821672 |
| Length | 213 |
| Sequence | MRRAISAVPTGLRSFFSSFPALPRWAKLGRPFGAEFINDLGPRISLNVALLAISIGFIGCGYHTAGHANLLPSDLRTIAIPAFVNQTQTYKIEQTLTSSVVQEFVTRTNYHITQDPKSADAALHGVVLSTYTTPLTYDTKTGRASSVLVIVSMSVSLKDRQGRVLYENPSYTFREQYQVSQELSSFFEEDSPAFQRLSRDFARTLVSNVLEAF |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 2 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 3 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 4 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 5 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 6 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 7 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 8 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 11 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 14 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 16 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 17 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 19 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 20 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 28 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 42 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 43 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 49 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 50 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 51 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 53 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 58 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 60 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 61 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 62 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 64 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 65 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 66 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 67 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 68 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 69 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 70 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 71 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 72 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 73 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 75 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 76 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 77 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 79 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 80 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 81 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 82 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 84 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 85 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 86 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300022732 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU1 | Metagenome | Rhizosphere |
| 112 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 113 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 114 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300028017 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 | Metagenome | Rhizosphere |
| 175 | 3300028036 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 | Metagenome | Rhizosphere |
| 176 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 179 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 180 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 181 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 182 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 183 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 184 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 185 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 186 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 187 | 3300033547 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 | Metagenome | Unclassified |
| 188 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 189 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 190 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 191 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 192 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 193 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 194 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 195 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 196 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 197 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 198 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 199 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 200 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 201 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 202 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 203 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 204 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 205 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 206 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 207 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 208 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 209 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 210 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 211 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 212 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 213 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 214 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 215 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 216 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 217 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 218 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 234 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 235 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 236 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 237 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 238 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 239 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 240 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 241 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 242 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 243 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 244 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 245 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 246 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 247 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 248 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 249 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 250 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.35 |
| Metatranscriptomes | 0.65 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 5.19 |
| Rhizosphere | 94.33 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 30.15 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0068853_100082167 | 3300005539 | Unclassified | 2822 |
| 2 | JGI24737J22298_10026801 | 3300001990 | Bacteria | 1819 |
| 3 | JGI24743J22301_10005677 | 3300001991 | Bacteria | 2093 |
| 4 | JGI24034J26672_10004111 | 3300002239 | Bacteria | 2052 |
| 5 | JGI24751J29686_10004013 | 3300002459 | Bacteria | 2978 |
| 6 | Ga0065712_10083440 | 3300005290 | Bacteria | 2837 |
| 7 | Ga0065715_10097655 | 3300005293 | Unclassified | 3670 |
| 8 | Ga0070676_10076097 | 3300005328 | Bacteria | 2025 |
| 9 | Ga0070676_10585662 | 3300005328 | Unclassified | 803 |
| 10 | Ga0070683_100004621 | 3300005329 | Bacteria | 11370 |
| 11 | Ga0070683_100030596 | 3300005329 | Unclassified | 4889 |
| 12 | Ga0070683_100033402 | 3300005329 | Unclassified | 4691 |
| 13 | Ga0070683_100035148 | 3300005329 | Unclassified | 4581 |
| 14 | Ga0070683_100541129 | 3300005329 | Bacteria | 1113 |
| 15 | Ga0070690_100600168 | 3300005330 | Unclassified | 836 |
| 16 | Ga0070670_100021813 | 3300005331 | Bacteria | 5507 |
| 17 | Ga0070670_100160622 | 3300005331 | Bacteria | 1947 |
| 18 | Ga0070670_100461689 | 3300005331 | Archaea | 1126 |
| 19 | Ga0070677_10029087 | 3300005333 | Bacteria | 2093 |
| 20 | Ga0068869_100029673 | 3300005334 | Bacteria | 3835 |
| 21 | Ga0068869_100175491 | 3300005334 | Bacteria | 1677 |
| 22 | Ga0070666_10093676 | 3300005335 | Bacteria | 2065 |
| 23 | Ga0070666_10574237 | 3300005335 | Unclassified | 821 |
| 24 | Ga0070680_100046372 | 3300005336 | Unclassified | 3535 |
| 25 | Ga0070680_100176394 | 3300005336 | Bacteria | 1799 |
| 26 | Ga0070680_100333078 | 3300005336 | Bacteria | 1289 |
| 27 | Ga0068868_100006913 | 3300005338 | Bacteria | 8060 |
| 28 | Ga0068868_100014935 | 3300005338 | Bacteria | 5733 |
| 29 | Ga0068868_100021307 | 3300005338 | Unclassified | 4881 |
| 30 | Ga0068868_100173583 | 3300005338 | Bacteria | 1785 |
| 31 | Ga0068868_100516392 | 3300005338 | Bacteria | 1048 |
| 32 | Ga0070660_100221912 | 3300005339 | Unclassified | 1536 |
| 33 | Ga0070660_100257143 | 3300005339 | Bacteria | 1425 |
| 34 | Ga0070660_100539263 | 3300005339 | Unclassified | 973 |
| 35 | Ga0070689_100034323 | 3300005340 | Bacteria | 3870 |
| 36 | Ga0070689_100040779 | 3300005340 | Bacteria | 3560 |
| 37 | Ga0070687_100014876 | 3300005343 | Bacteria | 3505 |
| 38 | Ga0070687_100035473 | 3300005343 | Bacteria | 2477 |
| 39 | Ga0070661_100012703 | 3300005344 | Bacteria | 5893 |
| 40 | Ga0070661_100075457 | 3300005344 | Bacteria | 2484 |
| 41 | Ga0070692_10159222 | 3300005345 | Bacteria | 1292 |
| 42 | Ga0070668_100043649 | 3300005347 | Unclassified | 3438 |
| 43 | Ga0070668_100220127 | 3300005347 | Bacteria | 1565 |
| 44 | Ga0070669_100024622 | 3300005353 | Bacteria | 4317 |
| 45 | Ga0070669_100204116 | 3300005353 | Unclassified | 1557 |
| 46 | Ga0070669_100349247 | 3300005353 | Bacteria | 1200 |
| 47 | Ga0070675_100243604 | 3300005354 | Bacteria | 1571 |
| 48 | Ga0070675_100545298 | 3300005354 | Bacteria | 1048 |
| 49 | Ga0070674_100954816 | 3300005356 | Unclassified | 750 |
| 50 | Ga0070673_100110050 | 3300005364 | Bacteria | 2283 |
| 51 | Ga0070673_100455933 | 3300005364 | Bacteria | 1151 |
| 52 | Ga0070673_100516016 | 3300005364 | Bacteria | 1082 |
| 53 | Ga0070688_100029203 | 3300005365 | Bacteria | 3300 |
| 54 | Ga0070688_100195076 | 3300005365 | Bacteria | 1413 |
| 55 | Ga0070659_100121868 | 3300005366 | Bacteria | 2113 |
| 56 | Ga0070667_100483557 | 3300005367 | Unclassified | 1134 |
| 57 | Ga0070709_10000752 | 3300005434 | Bacteria | 18313 |
| 58 | Ga0070709_10021642 | 3300005434 | Bacteria | 3748 |
| 59 | Ga0070709_10199252 | 3300005434 | Bacteria | 1417 |
| 60 | Ga0070714_100000128 | 3300005435 | Bacteria | 59542 |
| 61 | Ga0070714_100002798 | 3300005435 | Bacteria | 12869 |
| 62 | Ga0070714_100063480 | 3300005435 | Bacteria | 3177 |
| 63 | Ga0070714_100094578 | 3300005435 | Unclassified | 2623 |
| 64 | Ga0070714_100471884 | 3300005435 | Bacteria | 1194 |
| 65 | Ga0070713_100000133 | 3300005436 | Bacteria | 48970 |
| 66 | Ga0070713_100002561 | 3300005436 | Bacteria | 11894 |
| 67 | Ga0070713_100032383 | 3300005436 | Unclassified | 4175 |
| 68 | Ga0070713_100301389 | 3300005436 | Bacteria | 1475 |
| 69 | Ga0070713_100335201 | 3300005436 | Bacteria | 1400 |
| 70 | Ga0070713_100506022 | 3300005436 | Unclassified | 1140 |
| 71 | Ga0070710_10009501 | 3300005437 | Bacteria | 4758 |
| 72 | Ga0070710_10053552 | 3300005437 | Unclassified | 2273 |
| 73 | Ga0070710_10067656 | 3300005437 | Unclassified | 2050 |
| 74 | Ga0070701_10104250 | 3300005438 | Bacteria | 1575 |
| 75 | Ga0070711_100000189 | 3300005439 | Bacteria | 32578 |
| 76 | Ga0070711_100205516 | 3300005439 | Bacteria | 1522 |
| 77 | Ga0070711_100373398 | 3300005439 | Unclassified | 1151 |
| 78 | Ga0070711_100470405 | 3300005439 | Bacteria | 1032 |
| 79 | Ga0070711_100527007 | 3300005439 | Unclassified | 977 |
| 80 | Ga0070705_100084789 | 3300005440 | Bacteria | 1956 |
| 81 | Ga0070708_100007566 | 3300005445 | Bacteria | 8696 |
| 82 | Ga0070708_100042364 | 3300005445 | Unclassified | 3996 |
| 83 | Ga0070708_100112290 | 3300005445 | Bacteria | 2506 |
| 84 | Ga0070708_100471602 | 3300005445 | Bacteria | 1184 |
| 85 | Ga0070708_100546861 | 3300005445 | Bacteria | 1092 |
| 86 | Ga0070708_101041424 | 3300005445 | Bacteria | 767 |
| 87 | Ga0070663_100023615 | 3300005455 | Unclassified | 4123 |
| 88 | Ga0070663_100145113 | 3300005455 | Bacteria | 1815 |
| 89 | Ga0070678_100036215 | 3300005456 | Unclassified | 3452 |
| 90 | Ga0070678_100949140 | 3300005456 | Unclassified | 788 |
| 91 | Ga0070662_100003450 | 3300005457 | Bacteria | 9856 |
| 92 | Ga0070662_100132979 | 3300005457 | Bacteria | 1920 |
| 93 | Ga0070662_100412928 | 3300005457 | Bacteria | 1115 |
| 94 | Ga0070681_10000240 | 3300005458 | Bacteria | 43292 |
| 95 | Ga0070681_10013463 | 3300005458 | Bacteria | 8128 |
| 96 | Ga0070681_10028556 | 3300005458 | Bacteria | 5609 |
| 97 | Ga0070681_10086756 | 3300005458 | Bacteria | 3083 |
| 98 | Ga0068867_100055347 | 3300005459 | Bacteria | 2933 |
| 99 | Ga0068867_100126054 | 3300005459 | Unclassified | 1984 |
| 100 | Ga0068867_100281265 | 3300005459 | Bacteria | 1364 |
| 101 | Ga0068867_100881730 | 3300005459 | Unclassified | 804 |
| 102 | Ga0070685_10032198 | 3300005466 | Bacteria | 2935 |
| 103 | Ga0070706_100001511 | 3300005467 | Bacteria | 24411 |
| 104 | Ga0070706_100001770 | 3300005467 | Bacteria | 22364 |
| 105 | Ga0070706_100041324 | 3300005467 | Bacteria | 4258 |
| 106 | Ga0070706_100957565 | 3300005467 | Bacteria | 790 |
| 107 | Ga0070707_100011671 | 3300005468 | Bacteria | 8196 |
| 108 | Ga0070707_100145261 | 3300005468 | Unclassified | 2309 |
| 109 | Ga0070707_100213684 | 3300005468 | Bacteria | 1880 |
| 110 | Ga0070707_100228108 | 3300005468 | Bacteria | 1814 |
| 111 | Ga0070707_100403105 | 3300005468 | Bacteria | 1328 |
| 112 | Ga0070698_100000027 | 3300005471 | Bacteria | 98052 |
| 113 | Ga0070699_100002870 | 3300005518 | Bacteria | 15360 |
| 114 | Ga0070699_100004068 | 3300005518 | Bacteria | 12929 |
| 115 | Ga0070699_100018651 | 3300005518 | Bacteria | 5958 |
| 116 | Ga0070699_100154303 | 3300005518 | Bacteria | 2032 |
| 117 | Ga0070699_100773998 | 3300005518 | Bacteria | 878 |
| 118 | Ga0070679_100038395 | 3300005530 | Unclassified | 4761 |
| 119 | Ga0070684_100029838 | 3300005535 | Bacteria | 4626 |
| 120 | Ga0070684_100057289 | 3300005535 | Unclassified | 3402 |
| 121 | Ga0070684_100066714 | 3300005535 | Unclassified | 3159 |
| 122 | Ga0070684_100119085 | 3300005535 | Bacteria | 2374 |
| 123 | Ga0070684_100153751 | 3300005535 | Bacteria | 2085 |
| 124 | Ga0070684_100179078 | 3300005535 | Unclassified | 1927 |
| 125 | Ga0070684_100227661 | 3300005535 | Bacteria | 1702 |
| 126 | Ga0070697_100000166 | 3300005536 | Bacteria | 53539 |
| 127 | Ga0070697_100000902 | 3300005536 | Bacteria | 22350 |
| 128 | Ga0070697_100001430 | 3300005536 | Bacteria | 18151 |
| 129 | Ga0070697_100020156 | 3300005536 | Bacteria | 5271 |
| 130 | Ga0070697_100150654 | 3300005536 | Bacteria | 1960 |
| 131 | Ga0070697_100312246 | 3300005536 | Bacteria | 1353 |
| 132 | Ga0070697_100356176 | 3300005536 | Bacteria | 1264 |
| 133 | Ga0068853_100056983 | 3300005539 | Bacteria | 3371 |
| 134 | Ga0068853_100062458 | 3300005539 | Unclassified | 3224 |
| 135 | Ga0070672_100038484 | 3300005543 | Bacteria | 3655 |
| 136 | Ga0070686_100023545 | 3300005544 | Bacteria | 3681 |
| 137 | Ga0070686_100046914 | 3300005544 | Unclassified | 2729 |
| 138 | Ga0070695_100026450 | 3300005545 | Unclassified | 3589 |
| 139 | Ga0070695_100317313 | 3300005545 | Bacteria | 1157 |
| 140 | Ga0070696_100727024 | 3300005546 | Unclassified | 811 |
| 141 | Ga0070693_100012621 | 3300005547 | Unclassified | 4279 |
| 142 | Ga0070693_100034200 | 3300005547 | Bacteria | 2811 |
| 143 | Ga0070693_100388230 | 3300005547 | Unclassified | 965 |
| 144 | Ga0070693_100529769 | 3300005547 | Bacteria | 840 |
| 145 | Ga0070665_100013996 | 3300005548 | Bacteria | 8068 |
| 146 | Ga0068855_100000613 | 3300005563 | Bacteria | 43854 |
| 147 | Ga0068855_100029749 | 3300005563 | Bacteria | 6530 |
| 148 | Ga0068855_100030525 | 3300005563 | Bacteria | 6446 |
| 149 | Ga0068855_100061542 | 3300005563 | Bacteria | 4386 |
| 150 | Ga0068855_100068519 | 3300005563 | Bacteria | 4131 |
| 151 | Ga0068855_100207171 | 3300005563 | Bacteria | 2205 |
| 152 | Ga0070664_100010590 | 3300005564 | Bacteria | 7474 |
| 153 | Ga0070664_100120243 | 3300005564 | Unclassified | 2299 |
| 154 | Ga0070664_100145688 | 3300005564 | Bacteria | 2088 |
| 155 | Ga0068857_100018038 | 3300005577 | Bacteria | 6192 |
| 156 | Ga0068857_100029312 | 3300005577 | Bacteria | 4856 |
| 157 | Ga0068857_100039748 | 3300005577 | Bacteria | 4168 |
| 158 | Ga0068857_100040334 | 3300005577 | Unclassified | 4139 |
| 159 | Ga0068857_100096385 | 3300005577 | Bacteria | 2651 |
| 160 | Ga0068857_101266116 | 3300005577 | Bacteria | 715 |
| 161 | Ga0068854_100004142 | 3300005578 | Bacteria | 9114 |
| 162 | Ga0068854_100065541 | 3300005578 | Bacteria | 2641 |
| 163 | Ga0068854_100127559 | 3300005578 | Bacteria | 1939 |
| 164 | Ga0068856_100000301 | 3300005614 | Bacteria | 54178 |
| 165 | Ga0068856_100003148 | 3300005614 | Bacteria | 16824 |
| 166 | Ga0068856_100016483 | 3300005614 | Bacteria | 7153 |
| 167 | Ga0068856_100049821 | 3300005614 | Bacteria | 4129 |
| 168 | Ga0068856_100051815 | 3300005614 | Bacteria | 4046 |
| 169 | Ga0068856_100074394 | 3300005614 | Unclassified | 3363 |
| 170 | Ga0068856_100187247 | 3300005614 | Unclassified | 2084 |
| 171 | Ga0070702_100050817 | 3300005615 | Bacteria | 2370 |
| 172 | Ga0068852_100120830 | 3300005616 | Unclassified | 2398 |
| 173 | Ga0068859_100017990 | 3300005617 | Bacteria | 7102 |
| 174 | Ga0068859_100046446 | 3300005617 | Bacteria | 4361 |
| 175 | Ga0068864_100005702 | 3300005618 | Bacteria | 10210 |
| 176 | Ga0068864_100007951 | 3300005618 | Bacteria | 8740 |
| 177 | Ga0068864_100053331 | 3300005618 | Unclassified | 3488 |
| 178 | Ga0068864_100347381 | 3300005618 | Unclassified | 1399 |
| 179 | Ga0068866_10005212 | 3300005718 | Bacteria | 5355 |
| 180 | Ga0068866_10006158 | 3300005718 | Bacteria | 4992 |
| 181 | Ga0068866_10077975 | 3300005718 | Bacteria | 1771 |
| 182 | Ga0068866_10638090 | 3300005718 | Bacteria | 724 |
| 183 | Ga0068861_100105650 | 3300005719 | Unclassified | 2249 |
| 184 | Ga0068851_10006603 | 3300005834 | Bacteria | 5304 |
| 185 | Ga0068863_100007945 | 3300005841 | Bacteria | 10368 |
| 186 | Ga0068863_100030625 | 3300005841 | Bacteria | 5137 |
| 187 | Ga0068863_100073982 | 3300005841 | Bacteria | 3223 |
| 188 | Ga0068863_100087421 | 3300005841 | Bacteria | 2953 |
| 189 | Ga0068863_100165038 | 3300005841 | Bacteria | 2123 |
| 190 | Ga0068863_100218909 | 3300005841 | Bacteria | 1834 |
| 191 | Ga0068863_100225165 | 3300005841 | Bacteria | 1808 |
| 192 | Ga0068863_101368174 | 3300005841 | Unclassified | 715 |
| 193 | Ga0068858_100002995 | 3300005842 | Bacteria | 16941 |
| 194 | Ga0068858_100034315 | 3300005842 | Unclassified | 4706 |
| 195 | Ga0068858_100038294 | 3300005842 | Unclassified | 4448 |
| 196 | Ga0068858_100104373 | 3300005842 | Bacteria | 2644 |
| 197 | Ga0068858_100231852 | 3300005842 | Unclassified | 1750 |
| 198 | Ga0068858_100412435 | 3300005842 | Unclassified | 1298 |
| 199 | Ga0068860_100157722 | 3300005843 | Bacteria | 2187 |
| 200 | Ga0068860_100487335 | 3300005843 | Bacteria | 1229 |
| 201 | Ga0068860_100736881 | 3300005843 | Unclassified | 997 |
| 202 | Ga0068862_100029977 | 3300005844 | Bacteria | 4584 |
| 203 | Ga0068862_100440755 | 3300005844 | Bacteria | 1226 |
| 204 | Ga0070717_10010329 | 3300006028 | Bacteria | 7044 |
| 205 | Ga0070717_10030906 | 3300006028 | Bacteria | 4304 |
| 206 | Ga0070717_10079499 | 3300006028 | Bacteria | 2750 |
| 207 | Ga0070717_10102869 | 3300006028 | Unclassified | 2427 |
| 208 | Ga0070717_10964842 | 3300006028 | Unclassified | 776 |
| 209 | Ga0070715_10035024 | 3300006163 | Bacteria | 2062 |
| 210 | Ga0070716_100019392 | 3300006173 | Bacteria | 3554 |
| 211 | Ga0070716_100039732 | 3300006173 | Bacteria | 2613 |
| 212 | Ga0070716_100059805 | 3300006173 | Unclassified | 2198 |
| 213 | Ga0070716_100130822 | 3300006173 | Bacteria | 1586 |
| 214 | Ga0070716_100249904 | 3300006173 | Bacteria | 1208 |
| 215 | Ga0070716_100312244 | 3300006173 | Unclassified | 1098 |
| 216 | Ga0070712_100000047 | 3300006175 | Bacteria | 65314 |
| 217 | Ga0070712_100000156 | 3300006175 | Bacteria | 36864 |
| 218 | Ga0070712_100000942 | 3300006175 | Bacteria | 17519 |
| 219 | Ga0070712_100037870 | 3300006175 | Bacteria | 3291 |
| 220 | Ga0097621_100005769 | 3300006237 | Bacteria | 8740 |
| 221 | Ga0097621_100005828 | 3300006237 | Bacteria | 8701 |
| 222 | Ga0097621_100014010 | 3300006237 | Bacteria | 5991 |
| 223 | Ga0097621_100041212 | 3300006237 | Unclassified | 3716 |
| 224 | Ga0097621_100151550 | 3300006237 | Bacteria | 1988 |
| 225 | Ga0097621_100469081 | 3300006237 | Bacteria | 1136 |
| 226 | Ga0097621_100888978 | 3300006237 | Bacteria | 829 |
| 227 | Ga0068871_100002357 | 3300006358 | Bacteria | 12881 |
| 228 | Ga0068871_100005593 | 3300006358 | Bacteria | 8813 |
| 229 | Ga0068871_100038820 | 3300006358 | Unclassified | 3806 |
| 230 | Ga0068871_100046972 | 3300006358 | Bacteria | 3480 |
| 231 | Ga0068871_100091194 | 3300006358 | Unclassified | 2539 |
| 232 | Ga0075433_10009826 | 3300006852 | Bacteria | 7669 |
| 233 | Ga0075434_100000122 | 3300006871 | Bacteria | 45781 |
| 234 | Ga0075434_100041023 | 3300006871 | Unclassified | 4584 |
| 235 | Ga0068865_100009111 | 3300006881 | Bacteria | 6143 |
| 236 | Ga0068865_100038424 | 3300006881 | Bacteria | 3240 |
| 237 | Ga0068865_100099963 | 3300006881 | Unclassified | 2122 |
| 238 | Ga0068865_100278221 | 3300006881 | Bacteria | 1331 |
| 239 | Ga0097620_100017990 | 3300006931 | Bacteria | 7102 |
| 240 | Ga0097620_100046446 | 3300006931 | Bacteria | 4361 |
| 241 | Ga0075435_100000038 | 3300007076 | Bacteria | 67821 |
| 242 | Ga0099794_10060714 | 3300007265 | Bacteria | 1836 |
| 243 | Ga0099794_10160397 | 3300007265 | Bacteria | 1144 |
| 244 | Ga0099795_10266694 | 3300007788 | Unclassified | 743 |
| 245 | Ga0105240_10031108 | 3300009093 | Bacteria | 6925 |
| 246 | Ga0105240_10043559 | 3300009093 | Bacteria | 5710 |
| 247 | Ga0105240_10152671 | 3300009093 | Bacteria | 2749 |
| 248 | Ga0105240_10192258 | 3300009093 | Bacteria | 2399 |
| 249 | Ga0105240_10378687 | 3300009093 | Bacteria | 1599 |
| 250 | Ga0105240_10496242 | 3300009093 | Bacteria | 1358 |
| 251 | Ga0105240_11078897 | 3300009093 | Bacteria | 855 |
| 252 | Ga0105240_11830972 | 3300009093 | Unclassified | 632 |
| 253 | Ga0105245_10121929 | 3300009098 | Unclassified | 2436 |
| 254 | Ga0105247_10011010 | 3300009101 | Bacteria | 5459 |
| 255 | Ga0105243_10008143 | 3300009148 | Bacteria | 8049 |
| 256 | Ga0105241_10044637 | 3300009174 | Unclassified | 3359 |
| 257 | Ga0105241_10073167 | 3300009174 | Bacteria | 2665 |
| 258 | Ga0105241_10150234 | 3300009174 | Unclassified | 1905 |
| 259 | Ga0105241_10192951 | 3300009174 | Unclassified | 1696 |
| 260 | Ga0105241_10344771 | 3300009174 | Bacteria | 1292 |
| 261 | Ga0105242_10070659 | 3300009176 | Unclassified | 2895 |
| 262 | Ga0105248_10339930 | 3300009177 | Bacteria | 1690 |
| 263 | Ga0105248_10378785 | 3300009177 | Bacteria | 1593 |
| 264 | Ga0105248_10403655 | 3300009177 | Unclassified | 1539 |
| 265 | Ga0105237_10276383 | 3300009545 | Unclassified | 1682 |
| 266 | Ga0105238_10004326 | 3300009551 | Bacteria | 14087 |
| 267 | Ga0105238_10160444 | 3300009551 | Unclassified | 2224 |
| 268 | Ga0105238_10261478 | 3300009551 | Unclassified | 1710 |
| 269 | Ga0105238_10642724 | 3300009551 | Bacteria | 1071 |
| 270 | Ga0105249_10021857 | 3300009553 | Bacteria | 5729 |
| 271 | Ga0105239_10140516 | 3300010375 | Bacteria | 2690 |
| 272 | Ga0105239_10478350 | 3300010375 | Bacteria | 1415 |
| 273 | Ga0105246_10158318 | 3300011119 | Unclassified | 1723 |
| 274 | Ga0157373_10036580 | 3300013100 | Unclassified | 3522 |
| 275 | Ga0157373_10082306 | 3300013100 | Unclassified | 2269 |
| 276 | Ga0157373_10208052 | 3300013100 | Bacteria | 1379 |
| 277 | Ga0157371_10007438 | 3300013102 | Bacteria | 8868 |
| 278 | Ga0157371_10299283 | 3300013102 | Bacteria | 1164 |
| 279 | Ga0157370_10013122 | 3300013104 | Bacteria | 8548 |
| 280 | Ga0157370_10773141 | 3300013104 | Unclassified | 874 |
| 281 | Ga0157369_10000062 | 3300013105 | Bacteria | 149758 |
| 282 | Ga0157369_10011758 | 3300013105 | Bacteria | 9940 |
| 283 | Ga0157369_10049493 | 3300013105 | Unclassified | 4556 |
| 284 | Ga0157369_10204288 | 3300013105 | Bacteria | 2073 |
| 285 | Ga0157369_10260623 | 3300013105 | Bacteria | 1808 |
| 286 | Ga0157369_11556323 | 3300013105 | Bacteria | 672 |
| 287 | Ga0157374_10003803 | 3300013296 | Bacteria | 12695 |
| 288 | Ga0157374_10033233 | 3300013296 | Unclassified | 4706 |
| 289 | Ga0157374_10046947 | 3300013296 | Bacteria | 4001 |
| 290 | Ga0157374_10066557 | 3300013296 | Bacteria | 3386 |
| 291 | Ga0157374_10203300 | 3300013296 | Bacteria | 1940 |
| 292 | Ga0157374_10306254 | 3300013296 | Bacteria | 1572 |
| 293 | Ga0157378_10000642 | 3300013297 | Bacteria | 32850 |
| 294 | Ga0157378_10009037 | 3300013297 | Bacteria | 8673 |
| 295 | Ga0157378_10840433 | 3300013297 | Unclassified | 946 |
| 296 | Ga0163162_10013430 | 3300013306 | Bacteria | 7994 |
| 297 | Ga0163162_10133521 | 3300013306 | Unclassified | 2592 |
| 298 | Ga0157372_10002143 | 3300013307 | Bacteria | 21453 |
| 299 | Ga0157372_10013384 | 3300013307 | Bacteria | 8758 |
| 300 | Ga0157372_10015349 | 3300013307 | Bacteria | 8209 |
| 301 | Ga0157372_10021002 | 3300013307 | Bacteria | 7049 |
| 302 | Ga0157372_10305001 | 3300013307 | Bacteria | 1852 |
| 303 | Ga0157372_11198730 | 3300013307 | Bacteria | 877 |
| 304 | Ga0157375_10263771 | 3300013308 | Unclassified | 1884 |
| 305 | Ga0163163_10008310 | 3300014325 | Bacteria | 9213 |
| 306 | Ga0163163_10012687 | 3300014325 | Bacteria | 7686 |
| 307 | Ga0163163_10341486 | 3300014325 | Bacteria | 1553 |
| 308 | Ga0163163_10378458 | 3300014325 | Unclassified | 1473 |
| 309 | Ga0163163_10607303 | 3300014325 | Bacteria | 1157 |
| 310 | Ga0163163_10979918 | 3300014325 | Unclassified | 909 |
| 311 | Ga0157379_10027997 | 3300014968 | Bacteria | 5016 |
| 312 | Ga0157379_10056330 | 3300014968 | Bacteria | 3513 |
| 313 | Ga0157379_10435503 | 3300014968 | Bacteria | 1209 |
| 314 | Ga0157376_10007530 | 3300014969 | Bacteria | 7780 |
| 315 | Ga0157376_10032463 | 3300014969 | Unclassified | 4193 |
| 316 | Ga0157376_10093279 | 3300014969 | Bacteria | 2613 |
| 317 | Ga0163161_10003472 | 3300017792 | Bacteria | 11047 |
| 318 | Ga0163161_10243342 | 3300017792 | Unclassified | 1400 |
| 319 | Ga0224569_100073 | 3300022732 | Bacteria | 6582 |
| 320 | Ga0224572_1040295 | 3300024225 | Bacteria | 881 |
| 321 | Ga0228598_1006356 | 3300024227 | Bacteria | 2448 |
| 322 | Ga0228598_1009603 | 3300024227 | Unclassified | 1936 |
| 323 | Ga0207656_10001681 | 3300025321 | Bacteria | 7348 |
| 324 | Ga0207692_10032113 | 3300025898 | Bacteria | 2520 |
| 325 | Ga0207692_10036548 | 3300025898 | Viruses | 2396 |
| 326 | Ga0207692_10048216 | 3300025898 | Bacteria | 2143 |
| 327 | Ga0207692_10048417 | 3300025898 | Unclassified | 2139 |
| 328 | Ga0207642_10040472 | 3300025899 | Bacteria | 2034 |
| 329 | Ga0207642_10059141 | 3300025899 | Bacteria | 1771 |
| 330 | Ga0207642_10498310 | 3300025899 | Unclassified | 745 |
| 331 | Ga0207642_10512781 | 3300025899 | Unclassified | 736 |
| 332 | Ga0207710_10026218 | 3300025900 | Unclassified | 2518 |
| 333 | Ga0207680_10588897 | 3300025903 | Unclassified | 795 |
| 334 | Ga0207647_10019160 | 3300025904 | Bacteria | 4606 |
| 335 | Ga0207647_10043106 | 3300025904 | Bacteria | 2825 |
| 336 | Ga0207685_10008290 | 3300025905 | Unclassified | 2952 |
| 337 | Ga0207699_10003485 | 3300025906 | Bacteria | 7511 |
| 338 | Ga0207699_10099128 | 3300025906 | Unclassified | 1845 |
| 339 | Ga0207699_10214134 | 3300025906 | Bacteria | 1312 |
| 340 | Ga0207645_10004345 | 3300025907 | Bacteria | 10499 |
| 341 | Ga0207645_10318924 | 3300025907 | Bacteria | 1036 |
| 342 | Ga0207684_10002047 | 3300025910 | Bacteria | 20752 |
| 343 | Ga0207654_10021567 | 3300025911 | Unclassified | 3427 |
| 344 | Ga0207654_10135201 | 3300025911 | Unclassified | 1565 |
| 345 | Ga0207654_10184037 | 3300025911 | Bacteria | 1365 |
| 346 | Ga0207707_10001726 | 3300025912 | Bacteria | 20073 |
| 347 | Ga0207707_10006889 | 3300025912 | Bacteria | 9913 |
| 348 | Ga0207707_10008133 | 3300025912 | Bacteria | 9107 |
| 349 | Ga0207707_10065257 | 3300025912 | Bacteria | 3171 |
| 350 | Ga0207707_10130042 | 3300025912 | Unclassified | 2202 |
| 351 | Ga0207695_10007368 | 3300025913 | Bacteria | 14040 |
| 352 | Ga0207695_10016928 | 3300025913 | Bacteria | 8506 |
| 353 | Ga0207695_10053134 | 3300025913 | Unclassified | 4239 |
| 354 | Ga0207695_10274621 | 3300025913 | Bacteria | 1580 |
| 355 | Ga0207695_10441653 | 3300025913 | Bacteria | 1184 |
| 356 | Ga0207695_10635253 | 3300025913 | Bacteria | 949 |
| 357 | Ga0207695_10929688 | 3300025913 | Unclassified | 749 |
| 358 | Ga0207671_10011352 | 3300025914 | Bacteria | 7258 |
| 359 | Ga0207671_10270352 | 3300025914 | Bacteria | 1339 |
| 360 | Ga0207671_10586464 | 3300025914 | Unclassified | 889 |
| 361 | Ga0207693_10000044 | 3300025915 | Bacteria | 103362 |
| 362 | Ga0207693_10000546 | 3300025915 | Bacteria | 34039 |
| 363 | Ga0207693_10008427 | 3300025915 | Bacteria | 8433 |
| 364 | Ga0207693_10039483 | 3300025915 | Unclassified | 3717 |
| 365 | Ga0207693_10807933 | 3300025915 | Unclassified | 723 |
| 366 | Ga0207693_10872991 | 3300025915 | Unclassified | 691 |
| 367 | Ga0207663_10000276 | 3300025916 | Bacteria | 22338 |
| 368 | Ga0207663_10003346 | 3300025916 | Bacteria | 7829 |
| 369 | Ga0207663_10074974 | 3300025916 | Bacteria | 2194 |
| 370 | Ga0207663_10219389 | 3300025916 | Bacteria | 1383 |
| 371 | Ga0207663_10252452 | 3300025916 | Bacteria | 1299 |
| 372 | Ga0207660_10075879 | 3300025917 | Unclassified | 2457 |
| 373 | Ga0207660_10194624 | 3300025917 | Unclassified | 1581 |
| 374 | Ga0207662_10023955 | 3300025918 | Bacteria | 3511 |
| 375 | Ga0207657_10004787 | 3300025919 | Bacteria | 14280 |
| 376 | Ga0207649_10027558 | 3300025920 | Unclassified | 3335 |
| 377 | Ga0207649_10186450 | 3300025920 | Bacteria | 1456 |
| 378 | Ga0207652_10039834 | 3300025921 | Bacteria | 3989 |
| 379 | Ga0207652_10197185 | 3300025921 | Bacteria | 1812 |
| 380 | Ga0207646_10139214 | 3300025922 | Unclassified | 2185 |
| 381 | Ga0207646_10153397 | 3300025922 | Bacteria | 2077 |
| 382 | Ga0207646_10182819 | 3300025922 | Bacteria | 1894 |
| 383 | Ga0207681_10033271 | 3300025923 | Bacteria | 3378 |
| 384 | Ga0207681_10093861 | 3300025923 | Unclassified | 2149 |
| 385 | Ga0207694_10002803 | 3300025924 | Bacteria | 14072 |
| 386 | Ga0207694_10241151 | 3300025924 | Bacteria | 1477 |
| 387 | Ga0207694_10752406 | 3300025924 | Unclassified | 823 |
| 388 | Ga0207650_10069413 | 3300025925 | Bacteria | 2648 |
| 389 | Ga0207650_10105049 | 3300025925 | Bacteria | 2180 |
| 390 | Ga0207659_10026119 | 3300025926 | Bacteria | 3937 |
| 391 | Ga0207687_10016503 | 3300025927 | Unclassified | 4850 |
| 392 | Ga0207687_10018851 | 3300025927 | Unclassified | 4562 |
| 393 | Ga0207687_10196841 | 3300025927 | Bacteria | 1572 |
| 394 | Ga0207700_10000227 | 3300025928 | Bacteria | 33670 |
| 395 | Ga0207700_10013275 | 3300025928 | Bacteria | 5352 |
| 396 | Ga0207700_10782273 | 3300025928 | Unclassified | 853 |
| 397 | Ga0207664_10000033 | 3300025929 | Bacteria | 176549 |
| 398 | Ga0207664_10001882 | 3300025929 | Bacteria | 13797 |
| 399 | Ga0207664_10068731 | 3300025929 | Bacteria | 2847 |
| 400 | Ga0207664_10081525 | 3300025929 | Unclassified | 2633 |
| 401 | Ga0207664_10083518 | 3300025929 | Unclassified | 2604 |
| 402 | Ga0207664_10510341 | 3300025929 | Unclassified | 1077 |
| 403 | Ga0207664_10632710 | 3300025929 | Unclassified | 961 |
| 404 | Ga0207664_10780700 | 3300025929 | Bacteria | 859 |
| 405 | Ga0207644_10061471 | 3300025931 | Bacteria | 2720 |
| 406 | Ga0207690_10007025 | 3300025932 | Bacteria | 6676 |
| 407 | Ga0207690_10083627 | 3300025932 | Bacteria | 2235 |
| 408 | Ga0207690_10887275 | 3300025932 | Unclassified | 739 |
| 409 | Ga0207706_10000048 | 3300025933 | Bacteria | 117454 |
| 410 | Ga0207706_10004287 | 3300025933 | Bacteria | 13405 |
| 411 | Ga0207686_10020997 | 3300025934 | Bacteria | 3740 |
| 412 | Ga0207709_10014364 | 3300025935 | Bacteria | 4371 |
| 413 | Ga0207709_10528515 | 3300025935 | Unclassified | 924 |
| 414 | Ga0207670_10018499 | 3300025936 | Bacteria | 4236 |
| 415 | Ga0207669_10062980 | 3300025937 | Bacteria | 2287 |
| 416 | Ga0207704_10025162 | 3300025938 | Bacteria | 3244 |
| 417 | Ga0207704_10235961 | 3300025938 | Bacteria | 1363 |
| 418 | Ga0207704_10249357 | 3300025938 | Bacteria | 1332 |
| 419 | Ga0207704_10474730 | 3300025938 | Unclassified | 1003 |
| 420 | Ga0207665_10007003 | 3300025939 | Bacteria | 7464 |
| 421 | Ga0207665_10027020 | 3300025939 | Bacteria | 3791 |
| 422 | Ga0207665_10030897 | 3300025939 | Unclassified | 3542 |
| 423 | Ga0207665_10056654 | 3300025939 | Unclassified | 2646 |
| 424 | Ga0207665_10063047 | 3300025939 | Bacteria | 2516 |
| 425 | Ga0207665_10073299 | 3300025939 | Bacteria | 2341 |
| 426 | Ga0207665_10239544 | 3300025939 | Bacteria | 1336 |
| 427 | Ga0207711_10002079 | 3300025941 | Bacteria | 18085 |
| 428 | Ga0207711_10064465 | 3300025941 | Bacteria | 3165 |
| 429 | Ga0207711_10286743 | 3300025941 | Bacteria | 1517 |
| 430 | Ga0207711_10420984 | 3300025941 | Bacteria | 1242 |
| 431 | Ga0207711_10933647 | 3300025941 | Unclassified | 806 |
| 432 | Ga0207689_10024566 | 3300025942 | Bacteria | 5055 |
| 433 | Ga0207689_10411521 | 3300025942 | Bacteria | 1128 |
| 434 | Ga0207661_10014514 | 3300025944 | Bacteria | 5777 |
| 435 | Ga0207661_10116844 | 3300025944 | Unclassified | 2265 |
| 436 | Ga0207661_10248842 | 3300025944 | Unclassified | 1579 |
| 437 | Ga0207661_10267084 | 3300025944 | Unclassified | 1526 |
| 438 | Ga0207661_10466460 | 3300025944 | Bacteria | 1151 |
| 439 | Ga0207679_10025891 | 3300025945 | Bacteria | 4040 |
| 440 | Ga0207667_10004050 | 3300025949 | Bacteria | 18001 |
| 441 | Ga0207667_10015367 | 3300025949 | Bacteria | 8700 |
| 442 | Ga0207667_10038731 | 3300025949 | Bacteria | 5086 |
| 443 | Ga0207667_10045760 | 3300025949 | Bacteria | 4634 |
| 444 | Ga0207667_10045832 | 3300025949 | Bacteria | 4630 |
| 445 | Ga0207667_10473559 | 3300025949 | Bacteria | 1271 |
| 446 | Ga0207651_10502299 | 3300025960 | Bacteria | 1048 |
| 447 | Ga0207712_10025325 | 3300025961 | Bacteria | 3941 |
| 448 | Ga0207668_10089715 | 3300025972 | Unclassified | 2254 |
| 449 | Ga0207640_10002588 | 3300025981 | Bacteria | 9689 |
| 450 | Ga0207640_10016043 | 3300025981 | Bacteria | 4348 |
| 451 | Ga0207640_10100856 | 3300025981 | Bacteria | 2024 |
| 452 | Ga0207640_10496584 | 3300025981 | Bacteria | 1015 |
| 453 | Ga0207677_10006906 | 3300026023 | Bacteria | 6240 |
| 454 | Ga0207677_10006966 | 3300026023 | Bacteria | 6216 |
| 455 | Ga0207677_10008286 | 3300026023 | Bacteria | 5794 |
| 456 | Ga0207677_10066432 | 3300026023 | Bacteria | 2521 |
| 457 | Ga0207677_10481520 | 3300026023 | Bacteria | 1069 |
| 458 | Ga0207703_10019172 | 3300026035 | Bacteria | 5343 |
| 459 | Ga0207703_10049286 | 3300026035 | Bacteria | 3404 |
| 460 | Ga0207703_10599126 | 3300026035 | Bacteria | 1042 |
| 461 | Ga0207703_10661853 | 3300026035 | Unclassified | 991 |
| 462 | Ga0207639_10057070 | 3300026041 | Unclassified | 2996 |
| 463 | Ga0207639_10120900 | 3300026041 | Bacteria | 2151 |
| 464 | Ga0207639_10983221 | 3300026041 | Unclassified | 790 |
| 465 | Ga0207678_10000388 | 3300026067 | Bacteria | 40020 |
| 466 | Ga0207702_10000103 | 3300026078 | Bacteria | 99037 |
| 467 | Ga0207702_10010459 | 3300026078 | Bacteria | 7761 |
| 468 | Ga0207702_10011091 | 3300026078 | Bacteria | 7523 |
| 469 | Ga0207702_10016045 | 3300026078 | Bacteria | 6202 |
| 470 | Ga0207702_10037549 | 3300026078 | Bacteria | 4055 |
| 471 | Ga0207641_10026330 | 3300026088 | Bacteria | 4799 |
| 472 | Ga0207641_10170914 | 3300026088 | Unclassified | 1984 |
| 473 | Ga0207641_10171411 | 3300026088 | Bacteria | 1981 |
| 474 | Ga0207641_10198265 | 3300026088 | Bacteria | 1849 |
| 475 | Ga0207641_11025329 | 3300026088 | Bacteria | 822 |
| 476 | Ga0207648_10193083 | 3300026089 | Unclassified | 1805 |
| 477 | Ga0207648_11043539 | 3300026089 | Bacteria | 766 |
| 478 | Ga0207676_10003135 | 3300026095 | Bacteria | 11803 |
| 479 | Ga0207676_10008304 | 3300026095 | Bacteria | 7381 |
| 480 | Ga0207676_10110346 | 3300026095 | Unclassified | 2301 |
| 481 | Ga0207674_10026149 | 3300026116 | Bacteria | 6209 |
| 482 | Ga0207674_10030769 | 3300026116 | Bacteria | 5642 |
| 483 | Ga0207674_10101313 | 3300026116 | Unclassified | 2861 |
| 484 | Ga0207674_10352100 | 3300026116 | Bacteria | 1424 |
| 485 | Ga0207675_100746632 | 3300026118 | Unclassified | 990 |
| 486 | Ga0207683_10156451 | 3300026121 | Bacteria | 2059 |
| 487 | Ga0207683_10169468 | 3300026121 | Unclassified | 1977 |
| 488 | Ga0207683_10425894 | 3300026121 | Bacteria | 1223 |
| 489 | Ga0207698_10036793 | 3300026142 | Bacteria | 3598 |
| 490 | Ga0207698_10158456 | 3300026142 | Unclassified | 1976 |
| 491 | Ga0207698_10410216 | 3300026142 | Unclassified | 1297 |
| 492 | Ga0209588_1063959 | 3300027671 | Unclassified | 1189 |
| 493 | Ga0265356_1004331 | 3300028017 | Unclassified | 1739 |
| 494 | Ga0265355_1007244 | 3300028036 | Unclassified | 876 |
| 495 | Ga0268265_10438501 | 3300028380 | Bacteria | 1217 |
| 496 | Ga0268265_11420130 | 3300028380 | Unclassified | 696 |
| 497 | Ga0268264_10062769 | 3300028381 | Bacteria | 3121 |
| 498 | Ga0268264_10120092 | 3300028381 | Bacteria | 2315 |
| 499 | Ga0268264_10849818 | 3300028381 | Bacteria | 914 |
| 500 | Ga0265324_10029057 | 3300029957 | Unclassified | 1947 |
| 501 | Ga0265762_1000722 | 3300030760 | Bacteria | 5854 |
| 502 | Ga0265760_10000974 | 3300031090 | Bacteria | 8273 |
| 503 | Ga0265760_10010066 | 3300031090 | Unclassified | 2697 |
| 504 | Ga0265760_10029761 | 3300031090 | Unclassified | 1606 |
| 505 | Ga0265325_10229761 | 3300031241 | Bacteria | 846 |
| 506 | Ga0265339_10004141 | 3300031249 | Bacteria | 9984 |
| 507 | Ga0265339_10007071 | 3300031249 | Bacteria | 7287 |
| 508 | Ga0265339_10118926 | 3300031249 | Bacteria | 1360 |
| 509 | Ga0265316_10027894 | 3300031344 | Unclassified | 4667 |
| 510 | Ga0265314_10121664 | 3300031711 | Bacteria | 1642 |
| 511 | Ga0265342_10171789 | 3300031712 | Bacteria | 1192 |
| 512 | Ga0307507_10444039 | 3300033179 | Unclassified | 719 |
| 513 | Ga0316212_1023521 | 3300033547 | Unclassified | 863 |
| 514 | Ga0373934_0054997 | 3300035086 | Bacteria | 1581 |
| 515 | Ga0373934_0090121 | 3300035086 | Bacteria | 1236 |
| 516 | Ga0373944_0115319 | 3300035089 | Bacteria | 921 |
| 517 | Ga0373923_0066597 | 3300035111 | Bacteria | 1539 |
| 518 | Ga0373923_0559155 | 3300035111 | Unclassified | 561 |
| 519 | Ga0373932_0131755 | 3300035112 | Unclassified | 843 |
| 520 | Ga0373936_0075443 | 3300035113 | Unclassified | 1396 |
| 521 | Ga0373936_0197991 | 3300035113 | Unclassified | 886 |
| 522 | Ga0373939_0069983 | 3300035114 | Unclassified | 1140 |
| 523 | Ga0373941_0144293 | 3300035115 | Unclassified | 868 |
| 524 | Ga0373945_0028180 | 3300035116 | Bacteria | 1966 |
| 525 | Ga0373953_0010722 | 3300035117 | Bacteria | 3198 |
| 526 | Ga0373957_0035344 | 3300035120 | Bacteria | 1856 |
| 527 | Ga0373943_0000285 | 3300035170 | Bacteria | 20949 |
| 528 | Ga0373955_0075406 | 3300035172 | Bacteria | 1895 |
| 529 | Ga0373961_0029016 | 3300035241 | Unclassified | 1530 |
| 530 | Ga0373924_0142330 | 3300035410 | Bacteria | 1047 |
| 531 | Ga0373931_0031833 | 3300035691 | Unclassified | 2725 |
| 532 | Ga0373935_0013492 | 3300035692 | Bacteria | 4930 |
| 533 | Ga0373927_0000123 | 3300035695 | Bacteria | 58803 |
| 534 | Ga0373927_0231852 | 3300035695 | Unclassified | 1213 |
| 535 | Ga0373927_0314110 | 3300035695 | Bacteria | 1032 |
| 536 | Ga0373933_0300925 | 3300035724 | Bacteria | 1038 |
| 537 | Ga0373933_0326900 | 3300035724 | Unclassified | 995 |
| 538 | Ga0373933_0340629 | 3300035724 | Bacteria | 973 |
| 539 | Ga0373933_0546124 | 3300035724 | Bacteria | 760 |
| 540 | Ga0373947_0000757 | 3300035725 | Bacteria | 19372 |
| 541 | Ga0373947_0432838 | 3300035725 | Bacteria | 890 |
| 542 | Ga0373937_0081875 | 3300036401 | Bacteria | 2986 |
| 543 | Ga0373937_0302611 | 3300036401 | Bacteria | 1511 |
| 544 | Ga0373925_0000589 | 3300037068 | Bacteria | 35013 |
| 545 | Ga0373925_0044633 | 3300037068 | Bacteria | 3291 |
| 546 | Ga0395905_0004541 | 3300037471 | Bacteria | 14376 |
| 547 | Ga0395905_0264854 | 3300037471 | Unclassified | 1604 |
| 548 | Ga0395905_0398990 | 3300037471 | Bacteria | 1270 |
| 549 | Ga0395905_0826696 | 3300037471 | Unclassified | 829 |
| 550 | Ga0395901_0133117 | 3300038443 | Unclassified | 2613 |
| 551 | Ga0436363_0510861 | 3300039450 | Bacteria | 903 |
| 552 | Ga0466966_0299988 | 3300044684 | Unclassified | 966 |
| 553 | Ga0466961_0348145 | 3300044693 | Unclassified | 902 |
| 554 | Ga0466964_0129400 | 3300044706 | Bacteria | 1148 |
| 555 | Ga0466957_0045658 | 3300044842 | Bacteria | 2658 |
| 556 | Ga0451576_0246025 | 3300045051 | Unclassified | 1869 |
| 557 | Ga0451576_0256649 | 3300045051 | Unclassified | 1827 |
| 558 | Ga0451576_0554683 | 3300045051 | Bacteria | 1207 |
| 559 | Ga0466967_0123984 | 3300045976 | Bacteria | 2391 |
| 560 | Ga0495590_0144366 | 3300046457 | Unclassified | 860 |
| 561 | Ga0495651_0648688 | 3300046462 | Bacteria | 662 |
| 562 | Ga0495580_0003591 | 3300046472 | Bacteria | 13156 |
| 563 | Ga0495580_0262148 | 3300046472 | Unclassified | 1182 |
| 564 | Ga0495582_0131049 | 3300046473 | Bacteria | 1417 |
| 565 | Ga0495639_0374040 | 3300046475 | Bacteria | 717 |
| 566 | Ga0495664_0012707 | 3300046477 | Bacteria | 4769 |
| 567 | Ga0495634_0304982 | 3300046642 | Bacteria | 962 |
| 568 | Ga0495635_0175301 | 3300046663 | Bacteria | 1458 |
| 569 | Ga0495635_0211793 | 3300046663 | Bacteria | 1312 |
| 570 | Ga0495658_0404023 | 3300046683 | Bacteria | 871 |
| 571 | Ga0495669_0021567 | 3300046684 | Bacteria | 2796 |
| 572 | Ga0495669_0049218 | 3300046684 | Bacteria | 1886 |
| 573 | Ga0495669_0081356 | 3300046684 | Bacteria | 1487 |
| 574 | Ga0495581_0019317 | 3300047315 | Bacteria | 3955 |
| 575 | Ga0495604_0486483 | 3300047317 | Unclassified | 802 |
| 576 | Ga0495675_0488516 | 3300047444 | Unclassified | 708 |
| 577 | Ga0495677_0217556 | 3300047445 | Bacteria | 744 |
| 578 | Ga0495602_0097078 | 3300048088 | Unclassified | 2429 |
| 579 | Ga0495602_0449164 | 3300048088 | Unclassified | 910 |
| 580 | Ga0496100_0241249 | 3300048903 | Bacteria | 1333 |
| 581 | Ga0496100_0351876 | 3300048903 | Bacteria | 1113 |
| 582 | Ga0496100_0455345 | 3300048903 | Unclassified | 981 |
| 583 | Ga0496101_0399436 | 3300048904 | Unclassified | 1082 |
| 584 | Ga0496101_0690590 | 3300048904 | Bacteria | 806 |
| 585 | Ga0496102_0089133 | 3300048905 | Unclassified | 2853 |
| 586 | Ga0496102_0656628 | 3300048905 | Bacteria | 972 |
| 587 | Ga0496102_1652450 | 3300048905 | Unclassified | 559 |
| 588 | Ga0496103_0023344 | 3300048906 | Unclassified | 3729 |
| 589 | Ga0496103_0499078 | 3300048906 | Bacteria | 779 |
| 590 | Ga0496104_0044769 | 3300048907 | Unclassified | 4159 |
| 591 | Ga0496104_0069315 | 3300048907 | Bacteria | 3352 |
| 592 | Ga0496104_0095580 | 3300048907 | Bacteria | 2843 |
| 593 | Ga0496107_0256285 | 3300048910 | Unclassified | 1302 |
| 594 | Ga0496108_0097456 | 3300048911 | Unclassified | 2506 |
| 595 | Ga0496108_0820695 | 3300048911 | Unclassified | 802 |
| 596 | Ga0496109_0181278 | 3300048912 | Bacteria | 1978 |
| 597 | Ga0496109_0312740 | 3300048912 | Unclassified | 1482 |
| 598 | Ga0496109_0384272 | 3300048912 | Bacteria | 1326 |
| 599 | Ga0496109_0384434 | 3300048912 | Bacteria | 1326 |
| 600 | Ga0496111_0140455 | 3300048914 | Unclassified | 1790 |
| 601 | Ga0496112_0004401 | 3300048915 | Bacteria | 11918 |
| 602 | Ga0496112_0011842 | 3300048915 | Bacteria | 7987 |
| 603 | Ga0496112_0023777 | 3300048915 | Bacteria | 5861 |
| 604 | Ga0496112_0026292 | 3300048915 | Bacteria | 5598 |
| 605 | Ga0496112_0506089 | 3300048915 | Bacteria | 1143 |
| 606 | Ga0496113_0375511 | 3300048916 | Unclassified | 1141 |
| 607 | Ga0496114_0428056 | 3300048917 | Bacteria | 1172 |
| 608 | Ga0496115_0004761 | 3300048918 | Bacteria | 9850 |
| 609 | Ga0496115_0025996 | 3300048918 | Unclassified | 4564 |
| 610 | Ga0496115_0173741 | 3300048918 | Unclassified | 1781 |
| 611 | Ga0496115_0178677 | 3300048918 | Bacteria | 1755 |
| 612 | Ga0501083_0121975 | 3300049744 | Bacteria | 1709 |
| 613 | nmdc:mga0n895_102_c1 | 3300050512 | Bacteria | 50003 |
| 614 | nmdc:mga0rr50_1252_c1 | 3300050513 | Bacteria | 13842 |
| 615 | nmdc:mga0rr50_758039_c1 | 3300050513 | Bacteria | 828 |
| 616 | nmdc:mga0a205_517_c2 | 3300050515 | Bacteria | 27716 |
| 617 | Ga0495619_0113031 | 3300053085 | Unclassified | 1857 |
| 618 | Ga0068853_100082167 | |||
| 619 | JGI24737J22298_10026801 | |||
| 620 | JGI24743J22301_10005677 | |||
| 621 | JGI24034J26672_10004111 | |||
| 622 | JGI24751J29686_10004013 | |||
| 623 | Ga0065712_10083440 | |||
| 624 | Ga0065715_10097655 | |||
| 625 | Ga0070676_10076097 | |||
| 626 | Ga0070676_10585662 | |||
| 627 | Ga0070683_100004621 | |||
| 628 | Ga0070683_100030596 | |||
| 629 | Ga0070683_100033402 | |||
| 630 | Ga0070683_100035148 | |||
| 631 | Ga0070683_100541129 | |||
| 632 | Ga0070690_100600168 | |||
| 633 | Ga0070670_100021813 | |||
| 634 | Ga0070670_100160622 | |||
| 635 | Ga0070670_100461689 | |||
| 636 | Ga0070677_10029087 | |||
| 637 | Ga0068869_100029673 | |||
| 638 | Ga0068869_100175491 | |||
| 639 | Ga0070666_10093676 | |||
| 640 | Ga0070666_10574237 | |||
| 641 | Ga0070680_100046372 | |||
| 642 | Ga0070680_100176394 | |||
| 643 | Ga0070680_100333078 | |||
| 644 | Ga0068868_100006913 | |||
| 645 | Ga0068868_100014935 | |||
| 646 | Ga0068868_100021307 | |||
| 647 | Ga0068868_100173583 | |||
| 648 | Ga0068868_100516392 | |||
| 649 | Ga0070660_100221912 | |||
| 650 | Ga0070660_100257143 | |||
| 651 | Ga0070660_100539263 | |||
| 652 | Ga0070689_100034323 | |||
| 653 | Ga0070689_100040779 | |||
| 654 | Ga0070687_100014876 | |||
| 655 | Ga0070687_100035473 | |||
| 656 | Ga0070661_100012703 | |||
| 657 | Ga0070661_100075457 | |||
| 658 | Ga0070692_10159222 | |||
| 659 | Ga0070668_100043649 | |||
| 660 | Ga0070668_100220127 | |||
| 661 | Ga0070669_100024622 | |||
| 662 | Ga0070669_100204116 | |||
| 663 | Ga0070669_100349247 | |||
| 664 | Ga0070675_100243604 | |||
| 665 | Ga0070675_100545298 | |||
| 666 | Ga0070674_100954816 | |||
| 667 | Ga0070673_100110050 | |||
| 668 | Ga0070673_100455933 | |||
| 669 | Ga0070673_100516016 | |||
| 670 | Ga0070688_100029203 | |||
| 671 | Ga0070688_100195076 | |||
| 672 | Ga0070659_100121868 | |||
| 673 | Ga0070667_100483557 | |||
| 674 | Ga0070709_10000752 | |||
| 675 | Ga0070709_10021642 | |||
| 676 | Ga0070709_10199252 | |||
| 677 | Ga0070714_100000128 | |||
| 678 | Ga0070714_100002798 | |||
| 679 | Ga0070714_100063480 | |||
| 680 | Ga0070714_100094578 | |||
| 681 | Ga0070714_100471884 | |||
| 682 | Ga0070713_100000133 | |||
| 683 | Ga0070713_100002561 | |||
| 684 | Ga0070713_100032383 | |||
| 685 | Ga0070713_100301389 | |||
| 686 | Ga0070713_100335201 | |||
| 687 | Ga0070713_100506022 | |||
| 688 | Ga0070710_10009501 | |||
| 689 | Ga0070710_10053552 | |||
| 690 | Ga0070710_10067656 | |||
| 691 | Ga0070701_10104250 | |||
| 692 | Ga0070711_100000189 | |||
| 693 | Ga0070711_100205516 | |||
| 694 | Ga0070711_100373398 | |||
| 695 | Ga0070711_100470405 | |||
| 696 | Ga0070711_100527007 | |||
| 697 | Ga0070705_100084789 | |||
| 698 | Ga0070708_100007566 | |||
| 699 | Ga0070708_100042364 | |||
| 700 | Ga0070708_100112290 | |||
| 701 | Ga0070708_100471602 | |||
| 702 | Ga0070708_100546861 | |||
| 703 | Ga0070708_101041424 | |||
| 704 | Ga0070663_100023615 | |||
| 705 | Ga0070663_100145113 | |||
| 706 | Ga0070678_100036215 | |||
| 707 | Ga0070678_100949140 | |||
| 708 | Ga0070662_100003450 | |||
| 709 | Ga0070662_100132979 | |||
| 710 | Ga0070662_100412928 | |||
| 711 | Ga0070681_10000240 | |||
| 712 | Ga0070681_10013463 | |||
| 713 | Ga0070681_10028556 | |||
| 714 | Ga0070681_10086756 | |||
| 715 | Ga0068867_100055347 | |||
| 716 | Ga0068867_100126054 | |||
| 717 | Ga0068867_100281265 | |||
| 718 | Ga0068867_100881730 | |||
| 719 | Ga0070685_10032198 | |||
| 720 | Ga0070706_100001511 | |||
| 721 | Ga0070706_100001770 | |||
| 722 | Ga0070706_100041324 | |||
| 723 | Ga0070706_100957565 | |||
| 724 | Ga0070707_100011671 | |||
| 725 | Ga0070707_100145261 | |||
| 726 | Ga0070707_100213684 | |||
| 727 | Ga0070707_100228108 | |||
| 728 | Ga0070707_100403105 | |||
| 729 | Ga0070698_100000027 | |||
| 730 | Ga0070699_100002870 | |||
| 731 | Ga0070699_100004068 | |||
| 732 | Ga0070699_100018651 | |||
| 733 | Ga0070699_100154303 | |||
| 734 | Ga0070699_100773998 | |||
| 735 | Ga0070679_100038395 | |||
| 736 | Ga0070684_100029838 | |||
| 737 | Ga0070684_100057289 | |||
| 738 | Ga0070684_100066714 | |||
| 739 | Ga0070684_100119085 | |||
| 740 | Ga0070684_100153751 | |||
| 741 | Ga0070684_100179078 | |||
| 742 | Ga0070684_100227661 | |||
| 743 | Ga0070697_100000166 | |||
| 744 | Ga0070697_100000902 | |||
| 745 | Ga0070697_100001430 | |||
| 746 | Ga0070697_100020156 | |||
| 747 | Ga0070697_100150654 | |||
| 748 | Ga0070697_100312246 | |||
| 749 | Ga0070697_100356176 | |||
| 750 | Ga0068853_100056983 | |||
| 751 | Ga0068853_100062458 | |||
| 752 | Ga0070672_100038484 | |||
| 753 | Ga0070686_100023545 | |||
| 754 | Ga0070686_100046914 | |||
| 755 | Ga0070695_100026450 | |||
| 756 | Ga0070695_100317313 | |||
| 757 | Ga0070696_100727024 | |||
| 758 | Ga0070693_100012621 | |||
| 759 | Ga0070693_100034200 | |||
| 760 | Ga0070693_100388230 | |||
| 761 | Ga0070693_100529769 | |||
| 762 | Ga0070665_100013996 | |||
| 763 | Ga0068855_100000613 | |||
| 764 | Ga0068855_100029749 | |||
| 765 | Ga0068855_100030525 | |||
| 766 | Ga0068855_100061542 | |||
| 767 | Ga0068855_100068519 | |||
| 768 | Ga0068855_100207171 | |||
| 769 | Ga0070664_100010590 | |||
| 770 | Ga0070664_100120243 | |||
| 771 | Ga0070664_100145688 | |||
| 772 | Ga0068857_100018038 | |||
| 773 | Ga0068857_100029312 | |||
| 774 | Ga0068857_100039748 | |||
| 775 | Ga0068857_100040334 | |||
| 776 | Ga0068857_100096385 | |||
| 777 | Ga0068857_101266116 | |||
| 778 | Ga0068854_100004142 | |||
| 779 | Ga0068854_100065541 | |||
| 780 | Ga0068854_100127559 | |||
| 781 | Ga0068856_100000301 | |||
| 782 | Ga0068856_100003148 | |||
| 783 | Ga0068856_100016483 | |||
| 784 | Ga0068856_100049821 | |||
| 785 | Ga0068856_100051815 | |||
| 786 | Ga0068856_100074394 | |||
| 787 | Ga0068856_100187247 | |||
| 788 | Ga0070702_100050817 | |||
| 789 | Ga0068852_100120830 | |||
| 790 | Ga0068859_100017990 | |||
| 791 | Ga0068859_100046446 | |||
| 792 | Ga0068864_100005702 | |||
| 793 | Ga0068864_100007951 | |||
| 794 | Ga0068864_100053331 | |||
| 795 | Ga0068864_100347381 | |||
| 796 | Ga0068866_10005212 | |||
| 797 | Ga0068866_10006158 | |||
| 798 | Ga0068866_10077975 | |||
| 799 | Ga0068866_10638090 | |||
| 800 | Ga0068861_100105650 | |||
| 801 | Ga0068851_10006603 | |||
| 802 | Ga0068863_100007945 | |||
| 803 | Ga0068863_100030625 | |||
| 804 | Ga0068863_100073982 | |||
| 805 | Ga0068863_100087421 | |||
| 806 | Ga0068863_100165038 | |||
| 807 | Ga0068863_100218909 | |||
| 808 | Ga0068863_100225165 | |||
| 809 | Ga0068863_101368174 | |||
| 810 | Ga0068858_100002995 | |||
| 811 | Ga0068858_100034315 | |||
| 812 | Ga0068858_100038294 | |||
| 813 | Ga0068858_100104373 | |||
| 814 | Ga0068858_100231852 | |||
| 815 | Ga0068858_100412435 | |||
| 816 | Ga0068860_100157722 | |||
| 817 | Ga0068860_100487335 | |||
| 818 | Ga0068860_100736881 | |||
| 819 | Ga0068862_100029977 | |||
| 820 | Ga0068862_100440755 | |||
| 821 | Ga0070717_10010329 | |||
| 822 | Ga0070717_10030906 | |||
| 823 | Ga0070717_10079499 | |||
| 824 | Ga0070717_10102869 | |||
| 825 | Ga0070717_10964842 | |||
| 826 | Ga0070715_10035024 | |||
| 827 | Ga0070716_100019392 | |||
| 828 | Ga0070716_100039732 | |||
| 829 | Ga0070716_100059805 | |||
| 830 | Ga0070716_100130822 | |||
| 831 | Ga0070716_100249904 | |||
| 832 | Ga0070716_100312244 | |||
| 833 | Ga0070712_100000047 | |||
| 834 | Ga0070712_100000156 | |||
| 835 | Ga0070712_100000942 | |||
| 836 | Ga0070712_100037870 | |||
| 837 | Ga0097621_100005769 | |||
| 838 | Ga0097621_100005828 | |||
| 839 | Ga0097621_100014010 | |||
| 840 | Ga0097621_100041212 | |||
| 841 | Ga0097621_100151550 | |||
| 842 | Ga0097621_100469081 | |||
| 843 | Ga0097621_100888978 | |||
| 844 | Ga0068871_100002357 | |||
| 845 | Ga0068871_100005593 | |||
| 846 | Ga0068871_100038820 | |||
| 847 | Ga0068871_100046972 | |||
| 848 | Ga0068871_100091194 | |||
| 849 | Ga0075433_10009826 | |||
| 850 | Ga0075434_100000122 | |||
| 851 | Ga0075434_100041023 | |||
| 852 | Ga0068865_100009111 | |||
| 853 | Ga0068865_100038424 | |||
| 854 | Ga0068865_100099963 | |||
| 855 | Ga0068865_100278221 | |||
| 856 | Ga0097620_100017990 | |||
| 857 | Ga0097620_100046446 | |||
| 858 | Ga0075435_100000038 | |||
| 859 | Ga0099794_10060714 | |||
| 860 | Ga0099794_10160397 | |||
| 861 | Ga0099795_10266694 | |||
| 862 | Ga0105240_10031108 | |||
| 863 | Ga0105240_10043559 | |||
| 864 | Ga0105240_10152671 | |||
| 865 | Ga0105240_10192258 | |||
| 866 | Ga0105240_10378687 | |||
| 867 | Ga0105240_10496242 | |||
| 868 | Ga0105240_11078897 | |||
| 869 | Ga0105240_11830972 | |||
| 870 | Ga0105245_10121929 | |||
| 871 | Ga0105247_10011010 | |||
| 872 | Ga0105243_10008143 | |||
| 873 | Ga0105241_10044637 | |||
| 874 | Ga0105241_10073167 | |||
| 875 | Ga0105241_10150234 | |||
| 876 | Ga0105241_10192951 | |||
| 877 | Ga0105241_10344771 | |||
| 878 | Ga0105242_10070659 | |||
| 879 | Ga0105248_10339930 | |||
| 880 | Ga0105248_10378785 | |||
| 881 | Ga0105248_10403655 | |||
| 882 | Ga0105237_10276383 | |||
| 883 | Ga0105238_10004326 | |||
| 884 | Ga0105238_10160444 | |||
| 885 | Ga0105238_10261478 | |||
| 886 | Ga0105238_10642724 | |||
| 887 | Ga0105249_10021857 | |||
| 888 | Ga0105239_10140516 | |||
| 889 | Ga0105239_10478350 | |||
| 890 | Ga0105246_10158318 | |||
| 891 | Ga0157373_10036580 | |||
| 892 | Ga0157373_10082306 | |||
| 893 | Ga0157373_10208052 | |||
| 894 | Ga0157371_10007438 | |||
| 895 | Ga0157371_10299283 | |||
| 896 | Ga0157370_10013122 | |||
| 897 | Ga0157370_10773141 | |||
| 898 | Ga0157369_10000062 | |||
| 899 | Ga0157369_10011758 | |||
| 900 | Ga0157369_10049493 | |||
| 901 | Ga0157369_10204288 | |||
| 902 | Ga0157369_10260623 | |||
| 903 | Ga0157369_11556323 | |||
| 904 | Ga0157374_10003803 | |||
| 905 | Ga0157374_10033233 | |||
| 906 | Ga0157374_10046947 | |||
| 907 | Ga0157374_10066557 | |||
| 908 | Ga0157374_10203300 | |||
| 909 | Ga0157374_10306254 | |||
| 910 | Ga0157378_10000642 | |||
| 911 | Ga0157378_10009037 | |||
| 912 | Ga0157378_10840433 | |||
| 913 | Ga0163162_10013430 | |||
| 914 | Ga0163162_10133521 | |||
| 915 | Ga0157372_10002143 | |||
| 916 | Ga0157372_10013384 | |||
| 917 | Ga0157372_10015349 | |||
| 918 | Ga0157372_10021002 | |||
| 919 | Ga0157372_10305001 | |||
| 920 | Ga0157372_11198730 | |||
| 921 | Ga0157375_10263771 | |||
| 922 | Ga0163163_10008310 | |||
| 923 | Ga0163163_10012687 | |||
| 924 | Ga0163163_10341486 | |||
| 925 | Ga0163163_10378458 | |||
| 926 | Ga0163163_10607303 | |||
| 927 | Ga0163163_10979918 | |||
| 928 | Ga0157379_10027997 | |||
| 929 | Ga0157379_10056330 | |||
| 930 | Ga0157379_10435503 | |||
| 931 | Ga0157376_10007530 | |||
| 932 | Ga0157376_10032463 | |||
| 933 | Ga0157376_10093279 | |||
| 934 | Ga0163161_10003472 | |||
| 935 | Ga0163161_10243342 | |||
| 936 | Ga0224569_100073 | |||
| 937 | Ga0224572_1040295 | |||
| 938 | Ga0228598_1006356 | |||
| 939 | Ga0228598_1009603 | |||
| 940 | Ga0207656_10001681 | |||
| 941 | Ga0207692_10032113 | |||
| 942 | Ga0207692_10036548 | |||
| 943 | Ga0207692_10048216 | |||
| 944 | Ga0207692_10048417 | |||
| 945 | Ga0207642_10040472 | |||
| 946 | Ga0207642_10059141 | |||
| 947 | Ga0207642_10498310 | |||
| 948 | Ga0207642_10512781 | |||
| 949 | Ga0207710_10026218 | |||
| 950 | Ga0207680_10588897 | |||
| 951 | Ga0207647_10019160 | |||
| 952 | Ga0207647_10043106 | |||
| 953 | Ga0207685_10008290 | |||
| 954 | Ga0207699_10003485 | |||
| 955 | Ga0207699_10099128 | |||
| 956 | Ga0207699_10214134 | |||
| 957 | Ga0207645_10004345 | |||
| 958 | Ga0207645_10318924 | |||
| 959 | Ga0207684_10002047 | |||
| 960 | Ga0207654_10021567 | |||
| 961 | Ga0207654_10135201 | |||
| 962 | Ga0207654_10184037 | |||
| 963 | Ga0207707_10001726 | |||
| 964 | Ga0207707_10006889 | |||
| 965 | Ga0207707_10008133 | |||
| 966 | Ga0207707_10065257 | |||
| 967 | Ga0207707_10130042 | |||
| 968 | Ga0207695_10007368 | |||
| 969 | Ga0207695_10016928 | |||
| 970 | Ga0207695_10053134 | |||
| 971 | Ga0207695_10274621 | |||
| 972 | Ga0207695_10441653 | |||
| 973 | Ga0207695_10635253 | |||
| 974 | Ga0207695_10929688 | |||
| 975 | Ga0207671_10011352 | |||
| 976 | Ga0207671_10270352 | |||
| 977 | Ga0207671_10586464 | |||
| 978 | Ga0207693_10000044 | |||
| 979 | Ga0207693_10000546 | |||
| 980 | Ga0207693_10008427 | |||
| 981 | Ga0207693_10039483 | |||
| 982 | Ga0207693_10807933 | |||
| 983 | Ga0207693_10872991 | |||
| 984 | Ga0207663_10000276 | |||
| 985 | Ga0207663_10003346 | |||
| 986 | Ga0207663_10074974 | |||
| 987 | Ga0207663_10219389 | |||
| 988 | Ga0207663_10252452 | |||
| 989 | Ga0207660_10075879 | |||
| 990 | Ga0207660_10194624 | |||
| 991 | Ga0207662_10023955 | |||
| 992 | Ga0207657_10004787 | |||
| 993 | Ga0207649_10027558 | |||
| 994 | Ga0207649_10186450 | |||
| 995 | Ga0207652_10039834 | |||
| 996 | Ga0207652_10197185 | |||
| 997 | Ga0207646_10139214 | |||
| 998 | Ga0207646_10153397 | |||
| 999 | Ga0207646_10182819 | |||
| 1000 | Ga0207681_10033271 | |||
| 1001 | Ga0207681_10093861 | |||
| 1002 | Ga0207694_10002803 | |||
| 1003 | Ga0207694_10241151 | |||
| 1004 | Ga0207694_10752406 | |||
| 1005 | Ga0207650_10069413 | |||
| 1006 | Ga0207650_10105049 | |||
| 1007 | Ga0207659_10026119 | |||
| 1008 | Ga0207687_10016503 | |||
| 1009 | Ga0207687_10018851 | |||
| 1010 | Ga0207687_10196841 | |||
| 1011 | Ga0207700_10000227 | |||
| 1012 | Ga0207700_10013275 | |||
| 1013 | Ga0207700_10782273 | |||
| 1014 | Ga0207664_10000033 | |||
| 1015 | Ga0207664_10001882 | |||
| 1016 | Ga0207664_10068731 | |||
| 1017 | Ga0207664_10081525 | |||
| 1018 | Ga0207664_10083518 | |||
| 1019 | Ga0207664_10510341 | |||
| 1020 | Ga0207664_10632710 | |||
| 1021 | Ga0207664_10780700 | |||
| 1022 | Ga0207644_10061471 | |||
| 1023 | Ga0207690_10007025 | |||
| 1024 | Ga0207690_10083627 | |||
| 1025 | Ga0207690_10887275 | |||
| 1026 | Ga0207706_10000048 | |||
| 1027 | Ga0207706_10004287 | |||
| 1028 | Ga0207686_10020997 | |||
| 1029 | Ga0207709_10014364 | |||
| 1030 | Ga0207709_10528515 | |||
| 1031 | Ga0207670_10018499 | |||
| 1032 | Ga0207669_10062980 | |||
| 1033 | Ga0207704_10025162 | |||
| 1034 | Ga0207704_10235961 | |||
| 1035 | Ga0207704_10249357 | |||
| 1036 | Ga0207704_10474730 | |||
| 1037 | Ga0207665_10007003 | |||
| 1038 | Ga0207665_10027020 | |||
| 1039 | Ga0207665_10030897 | |||
| 1040 | Ga0207665_10056654 | |||
| 1041 | Ga0207665_10063047 | |||
| 1042 | Ga0207665_10073299 | |||
| 1043 | Ga0207665_10239544 | |||
| 1044 | Ga0207711_10002079 | |||
| 1045 | Ga0207711_10064465 | |||
| 1046 | Ga0207711_10286743 | |||
| 1047 | Ga0207711_10420984 | |||
| 1048 | Ga0207711_10933647 | |||
| 1049 | Ga0207689_10024566 | |||
| 1050 | Ga0207689_10411521 | |||
| 1051 | Ga0207661_10014514 | |||
| 1052 | Ga0207661_10116844 | |||
| 1053 | Ga0207661_10248842 | |||
| 1054 | Ga0207661_10267084 | |||
| 1055 | Ga0207661_10466460 | |||
| 1056 | Ga0207679_10025891 | |||
| 1057 | Ga0207667_10004050 | |||
| 1058 | Ga0207667_10015367 | |||
| 1059 | Ga0207667_10038731 | |||
| 1060 | Ga0207667_10045760 | |||
| 1061 | Ga0207667_10045832 | |||
| 1062 | Ga0207667_10473559 | |||
| 1063 | Ga0207651_10502299 | |||
| 1064 | Ga0207712_10025325 | |||
| 1065 | Ga0207668_10089715 | |||
| 1066 | Ga0207640_10002588 | |||
| 1067 | Ga0207640_10016043 | |||
| 1068 | Ga0207640_10100856 | |||
| 1069 | Ga0207640_10496584 | |||
| 1070 | Ga0207677_10006906 | |||
| 1071 | Ga0207677_10006966 | |||
| 1072 | Ga0207677_10008286 | |||
| 1073 | Ga0207677_10066432 | |||
| 1074 | Ga0207677_10481520 | |||
| 1075 | Ga0207703_10019172 | |||
| 1076 | Ga0207703_10049286 | |||
| 1077 | Ga0207703_10599126 | |||
| 1078 | Ga0207703_10661853 | |||
| 1079 | Ga0207639_10057070 | |||
| 1080 | Ga0207639_10120900 | |||
| 1081 | Ga0207639_10983221 | |||
| 1082 | Ga0207678_10000388 | |||
| 1083 | Ga0207702_10000103 | |||
| 1084 | Ga0207702_10010459 | |||
| 1085 | Ga0207702_10011091 | |||
| 1086 | Ga0207702_10016045 | |||
| 1087 | Ga0207702_10037549 | |||
| 1088 | Ga0207641_10026330 | |||
| 1089 | Ga0207641_10170914 | |||
| 1090 | Ga0207641_10171411 | |||
| 1091 | Ga0207641_10198265 | |||
| 1092 | Ga0207641_11025329 | |||
| 1093 | Ga0207648_10193083 | |||
| 1094 | Ga0207648_11043539 | |||
| 1095 | Ga0207676_10003135 | |||
| 1096 | Ga0207676_10008304 | |||
| 1097 | Ga0207676_10110346 | |||
| 1098 | Ga0207674_10026149 | |||
| 1099 | Ga0207674_10030769 | |||
| 1100 | Ga0207674_10101313 | |||
| 1101 | Ga0207674_10352100 | |||
| 1102 | Ga0207675_100746632 | |||
| 1103 | Ga0207683_10156451 | |||
| 1104 | Ga0207683_10169468 | |||
| 1105 | Ga0207683_10425894 | |||
| 1106 | Ga0207698_10036793 | |||
| 1107 | Ga0207698_10158456 | |||
| 1108 | Ga0207698_10410216 | |||
| 1109 | Ga0209588_1063959 | |||
| 1110 | Ga0265356_1004331 | |||
| 1111 | Ga0265355_1007244 | |||
| 1112 | Ga0268265_10438501 | |||
| 1113 | Ga0268265_11420130 | |||
| 1114 | Ga0268264_10062769 | |||
| 1115 | Ga0268264_10120092 | |||
| 1116 | Ga0268264_10849818 | |||
| 1117 | Ga0265324_10029057 | |||
| 1118 | Ga0265762_1000722 | |||
| 1119 | Ga0265760_10000974 | |||
| 1120 | Ga0265760_10010066 | |||
| 1121 | Ga0265760_10029761 | |||
| 1122 | Ga0265325_10229761 | |||
| 1123 | Ga0265339_10004141 | |||
| 1124 | Ga0265339_10007071 | |||
| 1125 | Ga0265339_10118926 | |||
| 1126 | Ga0265316_10027894 | |||
| 1127 | Ga0265314_10121664 | |||
| 1128 | Ga0265342_10171789 | |||
| 1129 | Ga0307507_10444039 | |||
| 1130 | Ga0316212_1023521 | |||
| 1131 | Ga0373934_0054997 | |||
| 1132 | Ga0373934_0090121 | |||
| 1133 | Ga0373944_0115319 | |||
| 1134 | Ga0373923_0066597 | |||
| 1135 | Ga0373923_0559155 | |||
| 1136 | Ga0373932_0131755 | |||
| 1137 | Ga0373936_0075443 | |||
| 1138 | Ga0373936_0197991 | |||
| 1139 | Ga0373939_0069983 | |||
| 1140 | Ga0373941_0144293 | |||
| 1141 | Ga0373945_0028180 | |||
| 1142 | Ga0373953_0010722 | |||
| 1143 | Ga0373957_0035344 | |||
| 1144 | Ga0373943_0000285 | |||
| 1145 | Ga0373955_0075406 | |||
| 1146 | Ga0373961_0029016 | |||
| 1147 | Ga0373924_0142330 | |||
| 1148 | Ga0373931_0031833 | |||
| 1149 | Ga0373935_0013492 | |||
| 1150 | Ga0373927_0000123 | |||
| 1151 | Ga0373927_0231852 | |||
| 1152 | Ga0373927_0314110 | |||
| 1153 | Ga0373933_0300925 | |||
| 1154 | Ga0373933_0326900 | |||
| 1155 | Ga0373933_0340629 | |||
| 1156 | Ga0373933_0546124 | |||
| 1157 | Ga0373947_0000757 | |||
| 1158 | Ga0373947_0432838 | |||
| 1159 | Ga0373937_0081875 | |||
| 1160 | Ga0373937_0302611 | |||
| 1161 | Ga0373925_0000589 | |||
| 1162 | Ga0373925_0044633 | |||
| 1163 | Ga0395905_0004541 | |||
| 1164 | Ga0395905_0264854 | |||
| 1165 | Ga0395905_0398990 | |||
| 1166 | Ga0395905_0826696 | |||
| 1167 | Ga0395901_0133117 | |||
| 1168 | Ga0436363_0510861 | |||
| 1169 | Ga0466966_0299988 | |||
| 1170 | Ga0466961_0348145 | |||
| 1171 | Ga0466964_0129400 | |||
| 1172 | Ga0466957_0045658 | |||
| 1173 | Ga0451576_0246025 | |||
| 1174 | Ga0451576_0256649 | |||
| 1175 | Ga0451576_0554683 | |||
| 1176 | Ga0466967_0123984 | |||
| 1177 | Ga0495590_0144366 | |||
| 1178 | Ga0495651_0648688 | |||
| 1179 | Ga0495580_0003591 | |||
| 1180 | Ga0495580_0262148 | |||
| 1181 | Ga0495582_0131049 | |||
| 1182 | Ga0495639_0374040 | |||
| 1183 | Ga0495664_0012707 | |||
| 1184 | Ga0495634_0304982 | |||
| 1185 | Ga0495635_0175301 | |||
| 1186 | Ga0495635_0211793 | |||
| 1187 | Ga0495658_0404023 | |||
| 1188 | Ga0495669_0021567 | |||
| 1189 | Ga0495669_0049218 | |||
| 1190 | Ga0495669_0081356 | |||
| 1191 | Ga0495581_0019317 | |||
| 1192 | Ga0495604_0486483 | |||
| 1193 | Ga0495675_0488516 | |||
| 1194 | Ga0495677_0217556 | |||
| 1195 | Ga0495602_0097078 | |||
| 1196 | Ga0495602_0449164 | |||
| 1197 | Ga0496100_0241249 | |||
| 1198 | Ga0496100_0351876 | |||
| 1199 | Ga0496100_0455345 | |||
| 1200 | Ga0496101_0399436 | |||
| 1201 | Ga0496101_0690590 | |||
| 1202 | Ga0496102_0089133 | |||
| 1203 | Ga0496102_0656628 | |||
| 1204 | Ga0496102_1652450 | |||
| 1205 | Ga0496103_0023344 | |||
| 1206 | Ga0496103_0499078 | |||
| 1207 | Ga0496104_0044769 | |||
| 1208 | Ga0496104_0069315 | |||
| 1209 | Ga0496104_0095580 | |||
| 1210 | Ga0496107_0256285 | |||
| 1211 | Ga0496108_0097456 | |||
| 1212 | Ga0496108_0820695 | |||
| 1213 | Ga0496109_0181278 | |||
| 1214 | Ga0496109_0312740 | |||
| 1215 | Ga0496109_0384272 | |||
| 1216 | Ga0496109_0384434 | |||
| 1217 | Ga0496111_0140455 | |||
| 1218 | Ga0496112_0004401 | |||
| 1219 | Ga0496112_0011842 | |||
| 1220 | Ga0496112_0023777 | |||
| 1221 | Ga0496112_0026292 | |||
| 1222 | Ga0496112_0506089 | |||
| 1223 | Ga0496113_0375511 | |||
| 1224 | Ga0496114_0428056 | |||
| 1225 | Ga0496115_0004761 | |||
| 1226 | Ga0496115_0025996 | |||
| 1227 | Ga0496115_0173741 | |||
| 1228 | Ga0496115_0178677 | |||
| 1229 | Ga0501083_0121975 | |||
| 1230 | nmdc:mga0n895_102_c1 | |||
| 1231 | nmdc:mga0rr50_1252_c1 | |||
| 1232 | nmdc:mga0rr50_758039_c1 | |||
| 1233 | nmdc:mga0a205_517_c2 | |||
| 1234 | Ga0495619_0113031 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7rxu-assembly1.cif.gz_A | crystal structure of cj1090c | 0.7216 | 34 | 174 |
| 5t0z-assembly1.cif.gz_B | pelc from geobacter metallireducens | 0.7038 | 34 | 177 |
| 7rxu-assembly1.cif.gz_A | crystal structure of cj1090c | 0.7038 | 34 | 174 |
| 5t0z-assembly1.cif.gz_A | pelc from geobacter metallireducens | 0.7022 | 36 | 177 |
| 5lbt-assembly1.cif.gz_B | structure of the human quinone reductase 2 (nqo2) in complex with imiquimod | 0.6938 | 40 | 78 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q20075_21_148_3.10.450.50 | Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; | 0.7687 | 88 | 146 | 3.10.450.50 |
| 5lbtB00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain | 0.6938 | 40 | 78 | 3.40.50.360 |
| af_Q75JX1_270_414_3.40.50.10330 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Probable inorganic polyphosphate/atp-NAD kinase; domain 1 | 0.6673 | 36 | 78 | 3.40.50.10330 |
| 3bf2A00 | Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain;Lipoprotein like domain | 0.6609 | 38 | 174 | 3.30.160.150 |
| 5dleD00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.6522 | 39 | 91 | 3.40.50.2300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2V8XI06-F1-model_v4 | LptE family protein | 0.8839 | 20 | 178 |
GO:0019867
GO:0043165 |
| AF-A0A7W7ZMK8-F1-model_v4 | Outer membrane lipopolysaccharide assembly protein LptE/RlpB | 0.8832 | 5 | 177 |
GO:0019867
GO:0043165 |
| AF-A0A831PQ58-F1-model_v4 | Uncharacterized protein | 0.8804 | 34 | 178 |
GO:0019867
GO:0043165 |
| AF-A0A831PQ58-F1-model_v4 | Uncharacterized protein | 0.8691 | 34 | 178 |
GO:0019867
GO:0043165 |
| AF-A0A2V9DQ23-F1-model_v4 | LptE family protein | 0.8663 | 20 | 178 |
GO:0019867
GO:0043165 |