F469510

General Info

Members Datasets Scaffolds Average Seq Length
616 223 615 131

Family's Representative Sequence

Representative Sequence 3300005331|Ga0070670_101725755|Ga0070670_1017257551
Length 150
Sequence VRPAFRRPRRYGRSEYASGTTEPRSIADARVARLATVAADGRPHVVPICFVLDGDTLYTAVDEKPKRTRLMKRLANIEANPRVEVLIDHYEDDWSRLWWVRLRGTARIVEDPRAVDLLVAKYPQYAERRPEGPVIAVDVEERSEWTSSPS

Samples

Sample ID Description Type Environment
1 2902799365 Mycolicibacterium sp. P1-5 Isolate Unclassified
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
12 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
13 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
14 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
15 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
16 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
17 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
18 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
19 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
20 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
23 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
24 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
25 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
26 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
29 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
30 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
31 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
32 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
37 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
38 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
39 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
40 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
41 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
42 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
43 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
44 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
45 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
46 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
47 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
48 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
49 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
50 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
52 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
53 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
54 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
55 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
56 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
58 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
59 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
60 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
62 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
64 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
65 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
66 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
67 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
68 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
69 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
70 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
71 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
72 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
73 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
74 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
75 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
76 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
77 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
78 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
79 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
80 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
117 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
118 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
119 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
120 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
121 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
122 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
123 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
124 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
125 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
126 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
127 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
128 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
129 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
130 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
131 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
132 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
133 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
134 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
135 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
136 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
137 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
138 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
139 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
140 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
141 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
142 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
143 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
144 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
145 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
146 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
147 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
148 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
149 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
150 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
151 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
152 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
153 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
154 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
155 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
156 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
157 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
158 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
159 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
160 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
161 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
162 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
163 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
164 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
165 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
166 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
167 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
168 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
169 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
170 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
171 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
172 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
173 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
174 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
175 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
176 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
177 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
178 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
179 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
180 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
181 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
182 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
183 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
184 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
185 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
186 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
187 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
188 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
189 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
190 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
191 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
192 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
193 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
194 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
195 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
196 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
197 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
198 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
199 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
200 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
201 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
202 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
203 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
204 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
205 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
206 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
207 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
208 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
209 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
210 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
211 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
212 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
213 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
214 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
215 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
216 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
217 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
218 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
219 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
220 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
221 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
222 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
223 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.84
Metatranscriptomes 0
Isolates 0.16

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.27
Nodule 0
Rhizoplane 11.36
Rhizosphere 85.39
Stem 0
Stem Tuber 0
Unclassified 0.97

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25407J50210_10001985 3300003373 Bacteria 4767
2 Ga0070658_11112606 3300005327 Bacteria 687
3 Ga0070683_100008497 3300005329 Bacteria 8722
4 Ga0070683_101442496 3300005329 Bacteria 661
5 Ga0070670_101725755 3300005331 Bacteria 576
6 Ga0070680_100011675 3300005336 Bacteria 6807
7 Ga0070682_100254855 3300005337 Bacteria 1267
8 Ga0070682_100570017 3300005337 Bacteria 889
9 Ga0068868_100077331 3300005338 Bacteria 2662
10 Ga0068868_101107151 3300005338 Bacteria 729
11 Ga0070668_100249507 3300005347 Bacteria 1473
12 Ga0070675_101293008 3300005354 Bacteria 672
13 Ga0070674_100111687 3300005356 Bacteria 2008
14 Ga0070674_100361628 3300005356 Bacteria 1175
15 Ga0070659_101533103 3300005366 Bacteria 594
16 Ga0070709_10007340 3300005434 Bacteria 6039
17 Ga0070714_100183331 3300005435 Unclassified 1906
18 Ga0070714_100525760 3300005435 Bacteria 1130
19 Ga0070713_100045663 3300005436 Bacteria 3591
20 Ga0070711_100053930 3300005439 Bacteria 2773
21 Ga0070711_100739330 3300005439 Bacteria 831
22 Ga0070708_100005486 3300005445 Bacteria 10056
23 Ga0070708_100066590 3300005445 Unclassified 3234
24 Ga0070708_100593569 3300005445 Bacteria 1044
25 Ga0070708_100653502 3300005445 Bacteria 991
26 Ga0070708_101272905 3300005445 Unclassified 687
27 Ga0070708_101619049 3300005445 Bacteria 602
28 Ga0070663_100344530 3300005455 Bacteria 1205
29 Ga0070678_100063957 3300005456 Bacteria 2725
30 Ga0070662_101304322 3300005457 Bacteria 625
31 Ga0070681_10006745 3300005458 Bacteria 11176
32 Ga0068867_100454006 3300005459 Bacteria 1093
33 Ga0070706_100007740 3300005467 Bacteria 10046
34 Ga0070706_100017626 3300005467 Bacteria 6589
35 Ga0070706_100066019 3300005467 Unclassified 3346
36 Ga0070706_100233012 3300005467 Bacteria 1719
37 Ga0070706_100872519 3300005467 Unclassified 832
38 Ga0070707_100001420 3300005468 Bacteria 23483
39 Ga0070707_100007630 3300005468 Bacteria 10046
40 Ga0070707_100008086 3300005468 Bacteria 9756
41 Ga0070707_100123086 3300005468 Bacteria 2519
42 Ga0070707_100183236 3300005468 Bacteria 2042
43 Ga0070707_101609606 3300005468 Unclassified 616
44 Ga0070698_100023335 3300005471 Bacteria 6467
45 Ga0070698_100039043 3300005471 Bacteria 4889
46 Ga0070698_100061106 3300005471 Bacteria 3801
47 Ga0070698_100108883 3300005471 Bacteria 2737
48 Ga0070698_100110565 3300005471 Bacteria 2713
49 Ga0070698_100312088 3300005471 Unclassified 1503
50 Ga0070698_100313163 3300005471 Unclassified 1500
51 Ga0070698_100765308 3300005471 Bacteria 909
52 Ga0070699_100000030 3300005518 Bacteria 149101
53 Ga0070699_100006698 3300005518 Bacteria 10020
54 Ga0070699_100029119 3300005518 Bacteria 4762
55 Ga0070699_100135928 3300005518 Bacteria 2169
56 Ga0070699_100583775 3300005518 Bacteria 1018
57 Ga0070699_100697453 3300005518 Bacteria 927
58 Ga0070699_100788322 3300005518 Unclassified 869
59 Ga0070679_100013131 3300005530 Bacteria 7929
60 Ga0070684_100013337 3300005535 Bacteria 6623
61 Ga0070684_100901067 3300005535 Bacteria 828
62 Ga0070697_100000540 3300005536 Bacteria 28451
63 Ga0070697_100018829 3300005536 Bacteria 5448
64 Ga0070697_100203075 3300005536 Bacteria 1685
65 Ga0070697_100253350 3300005536 Bacteria 1506
66 Ga0070697_102131662 3300005536 Unclassified 502
67 Ga0070686_100254137 3300005544 Bacteria 1285
68 Ga0070696_100793527 3300005546 Bacteria 779
69 Ga0070693_100058253 3300005547 Bacteria 2235
70 Ga0070693_101298232 3300005547 Unclassified 562
71 Ga0070665_101938862 3300005548 Bacteria 595
72 Ga0070704_100065221 3300005549 Bacteria 2621
73 Ga0070704_100274264 3300005549 Bacteria 1395
74 Ga0070704_100511059 3300005549 Bacteria 1044
75 Ga0070704_100543961 3300005549 Bacteria 1014
76 Ga0070704_101268473 3300005549 Unclassified 673
77 Ga0068855_100943830 3300005563 Bacteria 909
78 Ga0068856_100238272 3300005614 Bacteria 1835
79 Ga0068856_100271357 3300005614 Bacteria 1712
80 Ga0068859_101148003 3300005617 Bacteria 855
81 Ga0068866_10279760 3300005718 Bacteria 1033
82 Ga0068861_100126222 3300005719 Bacteria 2070
83 Ga0068861_100399755 3300005719 Bacteria 1219
84 Ga0068858_100575119 3300005842 Bacteria 1092
85 Ga0081455_10024369 3300005937 Bacteria 5605
86 Ga0081455_10087289 3300005937 Bacteria 2538
87 Ga0081455_10423775 3300005937 Bacteria 917
88 Ga0081455_10854526 3300005937 Bacteria 568
89 Ga0081538_10000786 3300005981 Bacteria 34645
90 Ga0081538_10004487 3300005981 Bacteria 12854
91 Ga0081538_10016522 3300005981 Bacteria 5653
92 Ga0081538_10084356 3300005981 Bacteria 1674
93 Ga0075365_10046103 3300006038 Bacteria 2862
94 Ga0075364_10474975 3300006051 Bacteria 855
95 Ga0075432_10047954 3300006058 Bacteria 1502
96 Ga0075432_10325513 3300006058 Bacteria 645
97 Ga0070716_100113178 3300006173 Bacteria 1685
98 Ga0070712_100003758 3300006175 Bacteria 9352
99 Ga0070712_100460810 3300006175 Unclassified 1060
100 Ga0075367_10177959 3300006178 Bacteria 1326
101 Ga0075367_10385098 3300006178 Bacteria 886
102 Ga0075369_10213609 3300006186 Bacteria 892
103 Ga0097621_100896532 3300006237 Bacteria 826
104 Ga0068871_100273836 3300006358 Bacteria 1475
105 Ga0075431_100213396 3300006847 Bacteria 1971
106 Ga0075431_100233821 3300006847 Bacteria 1872
107 Ga0075433_10007980 3300006852 Bacteria 8427
108 Ga0075433_10009573 3300006852 Bacteria 7749
109 Ga0075433_10216985 3300006852 Bacteria 1700
110 Ga0075433_11201278 3300006852 Bacteria 658
111 Ga0075434_100016059 3300006871 Bacteria 7194
112 Ga0075434_100116143 3300006871 Bacteria 2689
113 Ga0075434_100203185 3300006871 Bacteria 2002
114 Ga0075434_100439022 3300006871 Bacteria 1326
115 Ga0075434_101433482 3300006871 Bacteria 700
116 Ga0075436_100028526 3300006914 Bacteria 3839
117 Ga0075436_100117604 3300006914 Bacteria 1858
118 Ga0075436_100182281 3300006914 Bacteria 1484
119 Ga0075436_100410510 3300006914 Bacteria 982
120 Ga0097620_101148305 3300006931 Bacteria 855
121 Ga0075435_100005251 3300007076 Bacteria 9017
122 Ga0075435_100460144 3300007076 Bacteria 1097
123 Ga0105251_10543264 3300009011 Bacteria 547
124 Ga0105240_11245970 3300009093 Bacteria 786
125 Ga0111539_10776258 3300009094 Bacteria 1115
126 Ga0105245_10019665 3300009098 Bacteria 5917
127 Ga0105245_10115924 3300009098 Bacteria 2497
128 Ga0105245_10154175 3300009098 Bacteria 2175
129 Ga0105245_10241089 3300009098 Unclassified 1752
130 Ga0105245_10538950 3300009098 Bacteria 1188
131 Ga0105245_10940287 3300009098 Bacteria 907
132 Ga0114129_10025667 3300009147 Bacteria 8347
133 Ga0114129_10271497 3300009147 Bacteria 2269
134 Ga0114129_10929191 3300009147 Bacteria 1100
135 Ga0114129_11285842 3300009147 Bacteria 907
136 Ga0105243_10190359 3300009148 Bacteria 1792
137 Ga0105243_10347919 3300009148 Bacteria 1360
138 Ga0105243_10409581 3300009148 Bacteria 1262
139 Ga0105241_10620542 3300009174 Bacteria 979
140 Ga0105241_11225220 3300009174 Bacteria 712
141 Ga0105242_10160284 3300009176 Bacteria 1969
142 Ga0105242_10166682 3300009176 Bacteria 1933
143 Ga0105242_12256613 3300009176 Bacteria 590
144 Ga0105248_10884931 3300009177 Bacteria 1008
145 Ga0105248_11173232 3300009177 Bacteria 868
146 Ga0105238_10563570 3300009551 Bacteria 1144
147 Ga0105249_11918200 3300009553 Bacteria 665
148 Ga0105239_10287556 3300010375 Bacteria 1851
149 Ga0105239_10352677 3300010375 Bacteria 1661
150 Ga0105239_10539597 3300010375 Bacteria 1328
151 Ga0105246_10647642 3300011119 Bacteria 919
152 Ga0157374_10309855 3300013296 Unclassified 1563
153 Ga0157374_10644914 3300013296 Bacteria 1071
154 Ga0157378_10738146 3300013297 Bacteria 1007
155 Ga0157378_12246463 3300013297 Bacteria 597
156 Ga0157375_10253374 3300013308 Bacteria 1921
157 Ga0157375_10421305 3300013308 Bacteria 1501
158 Ga0157375_10706899 3300013308 Bacteria 1161
159 Ga0157375_10906428 3300013308 Bacteria 1025
160 Ga0157375_11743653 3300013308 Bacteria 738
161 Ga0163163_10183180 3300014325 Bacteria 2142
162 Ga0163163_10631268 3300014325 Bacteria 1135
163 Ga0163163_11281158 3300014325 Bacteria 795
164 Ga0157380_10948784 3300014326 Bacteria 890
165 Ga0157377_10176112 3300014745 Bacteria 1341
166 Ga0157379_10091950 3300014968 Bacteria 2721
167 Ga0157376_10346609 3300014969 Bacteria 1420
168 Ga0157376_10600532 3300014969 Bacteria 1095
169 Ga0157376_10713374 3300014969 Bacteria 1009
170 Ga0209051_1017236 3300025303 Bacteria 3233
171 Ga0207642_10336481 3300025899 Bacteria 886
172 Ga0207688_10428741 3300025901 Bacteria 822
173 Ga0207685_10153253 3300025905 Bacteria 1045
174 Ga0207699_10020452 3300025906 Bacteria 3549
175 Ga0207684_10007179 3300025910 Bacteria 10070
176 Ga0207684_10008659 3300025910 Bacteria 9036
177 Ga0207684_10009374 3300025910 Bacteria 8650
178 Ga0207684_10071502 3300025910 Bacteria 2948
179 Ga0207684_10562624 3300025910 Bacteria 975
180 Ga0207684_10911023 3300025910 Unclassified 739
181 Ga0207707_10006426 3300025912 Bacteria 10267
182 Ga0207693_10191989 3300025915 Bacteria 1607
183 Ga0207693_10489486 3300025915 Unclassified 960
184 Ga0207663_10138084 3300025916 Bacteria 1694
185 Ga0207662_10277755 3300025918 Bacteria 1107
186 Ga0207657_11072882 3300025919 Bacteria 616
187 Ga0207649_10087959 3300025920 Bacteria 2028
188 Ga0207652_10025019 3300025921 Bacteria 4959
189 Ga0207646_10000051 3300025922 Bacteria 170502
190 Ga0207646_10001612 3300025922 Bacteria 27515
191 Ga0207646_10005217 3300025922 Bacteria 13731
192 Ga0207646_10008806 3300025922 Bacteria 10070
193 Ga0207646_10012288 3300025922 Bacteria 8235
194 Ga0207646_10293117 3300025922 Bacteria 1470
195 Ga0207646_10879966 3300025922 Bacteria 795
196 Ga0207694_10258242 3300025924 Bacteria 1427
197 Ga0207659_10694738 3300025926 Bacteria 871
198 Ga0207687_10133266 3300025927 Bacteria 1876
199 Ga0207687_10311098 3300025927 Bacteria 1272
200 Ga0207687_10387934 3300025927 Bacteria 1146
201 Ga0207700_10000001 3300025928 Bacteria 1122509
202 Ga0207700_10813325 3300025928 Bacteria 836
203 Ga0207664_10292351 3300025929 Unclassified 1432
204 Ga0207664_10640552 3300025929 Bacteria 955
205 Ga0207644_11071254 3300025931 Unclassified 677
206 Ga0207690_11064725 3300025932 Bacteria 674
207 Ga0207706_10123498 3300025933 Bacteria 2277
208 Ga0207706_11098312 3300025933 Unclassified 665
209 Ga0207686_11018187 3300025934 Bacteria 673
210 Ga0207709_10072214 3300025935 Bacteria 2194
211 Ga0207709_11826483 3300025935 Bacteria 506
212 Ga0207669_10472144 3300025937 Bacteria 998
213 Ga0207669_10586553 3300025937 Bacteria 904
214 Ga0207704_10114813 3300025938 Bacteria 1829
215 Ga0207704_10775575 3300025938 Bacteria 799
216 Ga0207665_10006018 3300025939 Bacteria 8057
217 Ga0207691_10231380 3300025940 Bacteria 1600
218 Ga0207668_10322328 3300025972 Bacteria 1283
219 Ga0207668_10579899 3300025972 Unclassified 975
220 Ga0207640_11008463 3300025981 Bacteria 733
221 Ga0207640_11510985 3300025981 Bacteria 604
222 Ga0207658_11078028 3300025986 Bacteria 734
223 Ga0207677_10060871 3300026023 Bacteria 2612
224 Ga0207678_10311883 3300026067 Bacteria 1352
225 Ga0207702_10019057 3300026078 Bacteria 5679
226 Ga0207702_10071568 3300026078 Bacteria 2986
227 Ga0207648_10311532 3300026089 Bacteria 1413
228 Ga0207648_10584385 3300026089 Bacteria 1028
229 Ga0207675_100207947 3300026118 Bacteria 1881
230 Ga0207683_10012927 3300026121 Bacteria 7128
231 Ga0207428_10398412 3300027907 Bacteria 1008
232 Ga0265316_10742115 3300031344 Bacteria 690
233 Ga0307408_100472405 3300031548 Bacteria 1092
234 Ga0307410_10400158 3300031852 Bacteria 1109
235 Ga0307406_10026388 3300031901 Bacteria 3488
236 Ga0307409_100064867 3300031995 Bacteria 2871
237 Ga0307409_100363901 3300031995 Bacteria 1369
238 Ga0307415_100007872 3300032126 Bacteria 5863
239 Ga0373943_0216393 3300035170 Bacteria 1066
240 Ga0373947_0038138 3300035725 Bacteria 2853
241 Ga0395899_0005085 3300037312 Bacteria 10236
242 Ga0395899_0006164 3300037312 Bacteria 9294
243 Ga0395899_0012341 3300037312 Bacteria 6544
244 Ga0395899_0012620 3300037312 Bacteria 6475
245 Ga0395899_0013227 3300037312 Bacteria 6313
246 Ga0395899_0034863 3300037312 Bacteria 3779
247 Ga0395899_0047722 3300037312 Bacteria 3188
248 Ga0395899_0064354 3300037312 Bacteria 2696
249 Ga0395899_0140887 3300037312 Bacteria 1716
250 Ga0395899_0160469 3300037312 Unclassified 1589
251 Ga0395899_0217229 3300037312 Bacteria 1326
252 Ga0395899_0241452 3300037312 Bacteria 1243
253 Ga0395899_0262934 3300037312 Bacteria 1179
254 Ga0395899_0298789 3300037312 Bacteria 1090
255 Ga0395899_0365561 3300037312 Bacteria 962
256 Ga0395899_0776727 3300037312 Unclassified 594
257 Ga0395900_0001525 3300037418 Bacteria 27540
258 Ga0395900_0004057 3300037418 Bacteria 15613
259 Ga0395900_0007518 3300037418 Bacteria 11260
260 Ga0395900_0031744 3300037418 Bacteria 5429
261 Ga0395900_0077931 3300037418 Bacteria 3405
262 Ga0395900_0115266 3300037418 Bacteria 2757
263 Ga0395900_0120872 3300037418 Bacteria 2687
264 Ga0395900_0121106 3300037418 Bacteria 2684
265 Ga0395900_0200812 3300037418 Unclassified 2017
266 Ga0395900_0202426 3300037418 Bacteria 2008
267 Ga0395900_0211731 3300037418 Unclassified 1957
268 Ga0395900_0227736 3300037418 Bacteria 1876
269 Ga0395900_0234650 3300037418 Bacteria 1843
270 Ga0395900_0464664 3300037418 Bacteria 1220
271 Ga0395900_0470565 3300037418 Bacteria 1210
272 Ga0395900_0562097 3300037418 Unclassified 1084
273 Ga0395900_0588090 3300037418 Bacteria 1054
274 Ga0395900_1092639 3300037418 Bacteria 715
275 Ga0395898_0001639 3300037466 Bacteria 30312
276 Ga0395898_0007983 3300037466 Bacteria 11228
277 Ga0395898_0009582 3300037466 Bacteria 10171
278 Ga0395898_0038910 3300037466 Bacteria 4710
279 Ga0395898_0064538 3300037466 Unclassified 3551
280 Ga0395898_0065835 3300037466 Bacteria 3513
281 Ga0395898_0078652 3300037466 Bacteria 3182
282 Ga0395898_0082572 3300037466 Bacteria 3097
283 Ga0395898_0107067 3300037466 Bacteria 2681
284 Ga0395898_0121525 3300037466 Bacteria 2502
285 Ga0395898_0195860 3300037466 Bacteria 1930
286 Ga0395898_0197489 3300037466 Bacteria 1921
287 Ga0395898_0206290 3300037466 Bacteria 1875
288 Ga0395898_0588625 3300037466 Bacteria 1055
289 Ga0395898_0593119 3300037466 Bacteria 1050
290 Ga0395898_0692479 3300037466 Bacteria 961
291 Ga0395898_0793391 3300037466 Bacteria 887
292 Ga0395898_0874618 3300037466 Unclassified 837
293 Ga0395898_1602496 3300037466 Bacteria 575
294 Ga0395898_1905737 3300037466 Bacteria 514
295 Ga0395905_0015229 3300037471 Bacteria 7312
296 Ga0395905_0025100 3300037471 Bacteria 5622
297 Ga0395905_0038128 3300037471 Bacteria 4508
298 Ga0395905_0043116 3300037471 Bacteria 4233
299 Ga0395905_0047343 3300037471 Bacteria 4030
300 Ga0395905_0065203 3300037471 Bacteria 3410
301 Ga0395905_0079537 3300037471 Bacteria 3073
302 Ga0395905_0080884 3300037471 Bacteria 3045
303 Ga0395905_0086730 3300037471 Bacteria 2934
304 Ga0395905_0110837 3300037471 Bacteria 2577
305 Ga0395905_0127611 3300037471 Bacteria 2392
306 Ga0395905_0216308 3300037471 Bacteria 1794
307 Ga0395905_0225345 3300037471 Unclassified 1754
308 Ga0395905_0242412 3300037471 Bacteria 1684
309 Ga0395905_0576953 3300037471 Bacteria 1026
310 Ga0395905_0629004 3300037471 Unclassified 975
311 Ga0395905_0723837 3300037471 Unclassified 897
312 Ga0395901_0006124 3300038443 Bacteria 12189
313 Ga0395901_0007488 3300038443 Bacteria 11026
314 Ga0395901_0008254 3300038443 Bacteria 10523
315 Ga0395901_0008409 3300038443 Bacteria 10429
316 Ga0395901_0026707 3300038443 Bacteria 5928
317 Ga0395901_0028174 3300038443 Bacteria 5778
318 Ga0395901_0032593 3300038443 Bacteria 5375
319 Ga0395901_0040982 3300038443 Bacteria 4797
320 Ga0395901_0098087 3300038443 Bacteria 3072
321 Ga0395901_0119125 3300038443 Unclassified 2774
322 Ga0395901_0127326 3300038443 Bacteria 2676
323 Ga0395901_0144861 3300038443 Bacteria 2497
324 Ga0395901_0153429 3300038443 Bacteria 2419
325 Ga0395901_0175908 3300038443 Bacteria 2245
326 Ga0395901_0181375 3300038443 Bacteria 2208
327 Ga0395901_0212189 3300038443 Bacteria 2026
328 Ga0395901_0438373 3300038443 Unclassified 1337
329 Ga0395901_0568046 3300038443 Unclassified 1147
330 Ga0395901_0938177 3300038443 Bacteria 845
331 Ga0395901_1379007 3300038443 Bacteria 664
332 Ga0395901_1908025 3300038443 Bacteria 541
333 Ga0439439_0019743 3300041406 Bacteria 1674
334 Ga0439461_0075359 3300041410 Bacteria 788
335 Ga0451845_0447178 3300041501 Bacteria 802
336 Ga0451853_0274801 3300041512 Bacteria 731
337 Ga0451853_2439056 3300041512 Bacteria 772
338 Ga0439433_0068977 3300041999 Bacteria 850
339 Ga0439462_0023740 3300042015 Bacteria 1608
340 Ga0450905_015829 3300042142 Bacteria 1083
341 Ga0439446_0017014 3300042156 Bacteria 2029
342 Ga0466963_0427415 3300044694 Bacteria 934
343 Ga0466964_0162219 3300044706 Bacteria 1046
344 Ga0466960_0000070 3300044901 Bacteria 33398
345 Ga0451576_0402277 3300045051 Bacteria 1436
346 Ga0451576_0410605 3300045051 Bacteria 1420
347 Ga0466967_0009603 3300045976 Bacteria 7191
348 Ga0466967_0278370 3300045976 Bacteria 1605
349 Ga0495603_0044908 3300046455 Bacteria 2636
350 Ga0495603_0168805 3300046455 Bacteria 1268
351 Ga0495629_0215709 3300046459 Bacteria 1324
352 Ga0495629_0756350 3300046459 Bacteria 643
353 Ga0495638_0021134 3300046460 Bacteria 4293
354 Ga0495639_0175801 3300046475 Bacteria 1041
355 Ga0495584_0366567 3300046491 Bacteria 732
356 Ga0495584_0540253 3300046491 Bacteria 594
357 Ga0495644_0201313 3300046523 Bacteria 768
358 Ga0495598_0291403 3300046537 Bacteria 615
359 Ga0495609_0280915 3300046538 Bacteria 681
360 Ga0495656_0099492 3300046615 Unclassified 1343
361 Ga0495656_0130831 3300046615 Bacteria 1194
362 Ga0495647_0056475 3300046681 Bacteria 1539
363 Ga0495647_0060874 3300046681 Bacteria 1489
364 Ga0495658_0034295 3300046683 Bacteria 2784
365 Ga0495613_0248293 3300046689 Bacteria 1242
366 Ga0495672_0061783 3300047320 Bacteria 2158
367 Ga0496100_0022491 3300048903 Bacteria 3815
368 Ga0496100_0204581 3300048903 Bacteria 1441
369 Ga0496100_1076815 3300048903 Bacteria 633
370 Ga0496100_1090751 3300048903 Bacteria 629
371 Ga0496101_0040653 3300048904 Bacteria 3312
372 Ga0496101_0048060 3300048904 Bacteria 3065
373 Ga0496101_0084375 3300048904 Bacteria 2352
374 Ga0496101_0285945 3300048904 Bacteria 1290
375 Ga0496101_0566764 3300048904 Bacteria 898
376 Ga0496101_1108806 3300048904 Bacteria 621
377 Ga0496102_0004878 3300048905 Bacteria 11355
378 Ga0496102_0371888 3300048905 Bacteria 1345
379 Ga0496102_0671422 3300048905 Bacteria 959
380 Ga0496103_0017273 3300048906 Bacteria 4317
381 Ga0496103_0203020 3300048906 Bacteria 1275
382 Ga0496103_1005256 3300048906 Unclassified 519
383 Ga0496104_0000750 3300048907 Bacteria 27736
384 Ga0496104_0007405 3300048907 Bacteria 9697
385 Ga0496104_0026121 3300048907 Bacteria 5387
386 Ga0496104_0354872 3300048907 Bacteria 1379
387 Ga0496104_0386700 3300048907 Bacteria 1311
388 Ga0496104_0771174 3300048907 Bacteria 868
389 Ga0496105_0000125 3300048908 Bacteria 51796
390 Ga0496105_0133639 3300048908 Bacteria 2044
391 Ga0496105_0134130 3300048908 Bacteria 2040
392 Ga0496105_0215238 3300048908 Bacteria 1565
393 Ga0496105_0382909 3300048908 Bacteria 1119
394 Ga0496105_0427455 3300048908 Bacteria 1048
395 Ga0496106_0132514 3300048909 Bacteria 1955
396 Ga0496106_0379899 3300048909 Bacteria 1135
397 Ga0496106_0695344 3300048909 Unclassified 811
398 Ga0496107_0163880 3300048910 Bacteria 1648
399 Ga0496107_0449052 3300048910 Bacteria 958
400 Ga0496107_0896068 3300048910 Bacteria 647
401 Ga0496108_0007354 3300048911 Bacteria 8927
402 Ga0496108_0017462 3300048911 Bacteria 5871
403 Ga0496109_0001636 3300048912 Bacteria 18718
404 Ga0496109_0010472 3300048912 Bacteria 7923
405 Ga0496109_0517774 3300048912 Bacteria 1126
406 Ga0496109_1630107 3300048912 Bacteria 579
407 Ga0496110_0000772 3300048913 Bacteria 22233
408 Ga0496110_0001186 3300048913 Bacteria 18546
409 Ga0496110_0007457 3300048913 Bacteria 8741
410 Ga0496110_0043650 3300048913 Bacteria 3915
411 Ga0496110_0229449 3300048913 Bacteria 1688
412 Ga0496110_0636720 3300048913 Bacteria 966
413 Ga0496110_1154201 3300048913 Bacteria 683
414 Ga0496110_1464523 3300048913 Bacteria 592
415 Ga0496111_0000465 3300048914 Bacteria 20624
416 Ga0496111_0000589 3300048914 Bacteria 19074
417 Ga0496111_0042039 3300048914 Bacteria 3281
418 Ga0496111_0648684 3300048914 Bacteria 770
419 Ga0496112_0210793 3300048915 Bacteria 1900
420 Ga0496112_0780764 3300048915 Bacteria 881
421 Ga0496112_1024135 3300048915 Bacteria 745
422 Ga0496113_0024322 3300048916 Bacteria 4303
423 Ga0496113_0039835 3300048916 Bacteria 3460
424 Ga0496113_0095903 3300048916 Bacteria 2293
425 Ga0496113_0461401 3300048916 Unclassified 1021
426 Ga0496113_0998770 3300048916 Bacteria 659
427 Ga0496114_0005868 3300048917 Bacteria 9648
428 Ga0496114_0058388 3300048917 Bacteria 3222
429 Ga0496114_0064204 3300048917 Bacteria 3074
430 Ga0496114_0121986 3300048917 Bacteria 2242
431 Ga0496114_0203006 3300048917 Bacteria 1737
432 Ga0496114_0212698 3300048917 Bacteria 1696
433 Ga0496114_1271883 3300048917 Unclassified 622
434 Ga0496115_0033859 3300048918 Bacteria 4036
435 Ga0496115_0441125 3300048918 Bacteria 1053
436 Ga0496115_0457889 3300048918 Bacteria 1029
437 Ga0496125_0089486 3300048928 Bacteria 2315
438 Ga0496126_0008288 3300048929 Bacteria 11225
439 Ga0501031_0000303 3300049568 Bacteria 28129
440 Ga0501031_0004224 3300049568 Bacteria 9281
441 Ga0501031_0043953 3300049568 Bacteria 2914
442 Ga0501031_0435268 3300049568 Bacteria 847
443 Ga0501032_0001265 3300049569 Bacteria 20279
444 Ga0501032_0068465 3300049569 Bacteria 2369
445 Ga0501032_0127889 3300049569 Bacteria 1677
446 Ga0501033_0000196 3300049570 Bacteria 57814
447 Ga0501033_0024514 3300049570 Bacteria 4550
448 Ga0501033_0034856 3300049570 Bacteria 3772
449 Ga0501033_0666416 3300049570 Bacteria 710
450 Ga0501034_0009979 3300049571 Bacteria 9925
451 Ga0501034_0126515 3300049571 Bacteria 2540
452 Ga0501034_0160053 3300049571 Bacteria 2223
453 Ga0501036_0000532 3300049572 Bacteria 27334
454 Ga0501036_0018717 3300049572 Bacteria 5807
455 Ga0501036_0028954 3300049572 Bacteria 4680
456 Ga0501036_0198634 3300049572 Bacteria 1687
457 Ga0501036_0581092 3300049572 Bacteria 930
458 Ga0501036_0590862 3300049572 Bacteria 921
459 Ga0501037_0000254 3300049573 Bacteria 45796
460 Ga0501037_0122531 3300049573 Bacteria 1868
461 Ga0501038_0000266 3300049574 Bacteria 44169
462 Ga0501038_0067041 3300049574 Bacteria 3054
463 Ga0501038_0150099 3300049574 Bacteria 1900
464 Ga0501039_0000178 3300049575 Bacteria 45220
465 Ga0501039_0012273 3300049575 Bacteria 6532
466 Ga0501039_0017618 3300049575 Bacteria 5479
467 Ga0501039_0202201 3300049575 Bacteria 1562
468 Ga0501040_0000647 3300049576 Bacteria 21381
469 Ga0501040_0004249 3300049576 Bacteria 9323
470 Ga0501040_0019824 3300049576 Bacteria 4475
471 Ga0501040_0062339 3300049576 Bacteria 2565
472 Ga0501040_0465475 3300049576 Bacteria 910
473 Ga0501041_0004909 3300049577 Bacteria 7768
474 Ga0501041_0009532 3300049577 Bacteria 5723
475 Ga0501041_0014046 3300049577 Bacteria 4752
476 Ga0501042_0001946 3300049578 Bacteria 12432
477 Ga0501042_0021737 3300049578 Bacteria 4473
478 Ga0501042_0023593 3300049578 Bacteria 4306
479 Ga0501042_0466579 3300049578 Bacteria 916
480 Ga0501043_0002582 3300049579 Bacteria 15303
481 Ga0501043_0011117 3300049579 Bacteria 7050
482 Ga0501043_0039476 3300049579 Bacteria 3709
483 Ga0501043_0231927 3300049579 Unclassified 1426
484 Ga0501043_0374311 3300049579 Bacteria 1079
485 Ga0501046_0000640 3300049580 Bacteria 34263
486 Ga0501046_0008730 3300049580 Bacteria 8803
487 Ga0501046_0041619 3300049580 Bacteria 3665
488 Ga0501046_0051049 3300049580 Bacteria 3265
489 Ga0501046_0205297 3300049580 Bacteria 1465
490 Ga0501047_0000991 3300049581 Bacteria 28652
491 Ga0501047_0020840 3300049581 Bacteria 6296
492 Ga0501048_0000164 3300049582 Bacteria 41709
493 Ga0501048_0001886 3300049582 Bacteria 15915
494 Ga0501048_0114018 3300049582 Bacteria 1909
495 Ga0501048_0168493 3300049582 Unclassified 1551
496 Ga0501067_0099487 3300049583 Bacteria 1615
497 Ga0501068_0000009 3300049584 Bacteria 67122
498 Ga0501068_0009582 3300049584 Bacteria 5422
499 Ga0501068_0194182 3300049584 Bacteria 1286
500 Ga0501069_0001104 3300049585 Bacteria 13026
501 Ga0501069_0012741 3300049585 Bacteria 4475
502 Ga0501069_0015181 3300049585 Bacteria 4127
503 Ga0501070_0000808 3300049586 Bacteria 28444
504 Ga0501070_0010664 3300049586 Bacteria 7772
505 Ga0501070_0029143 3300049586 Bacteria 4629
506 Ga0501071_0000195 3300049587 Bacteria 27326
507 Ga0501071_0010722 3300049587 Bacteria 6146
508 Ga0501071_0078981 3300049587 Bacteria 2405
509 Ga0501071_0094502 3300049587 Bacteria 2199
510 Ga0501071_0193983 3300049587 Bacteria 1524
511 Ga0501072_0001130 3300049588 Bacteria 19825
512 Ga0501072_0006292 3300049588 Bacteria 9037
513 Ga0501072_0354853 3300049588 Bacteria 1164
514 Ga0501072_0733704 3300049588 Bacteria 775
515 Ga0501072_0915068 3300049588 Unclassified 685
516 Ga0501073_0000932 3300049589 Bacteria 20979
517 Ga0501073_0033895 3300049589 Bacteria 3634
518 Ga0501073_0050165 3300049589 Bacteria 2925
519 Ga0501074_0000249 3300049590 Bacteria 30332
520 Ga0501074_0035876 3300049590 Bacteria 3592
521 Ga0501074_0068890 3300049590 Bacteria 2543
522 Ga0501074_0210228 3300049590 Bacteria 1386
523 Ga0501075_0000310 3300049591 Bacteria 27255
524 Ga0501075_0009249 3300049591 Bacteria 6890
525 Ga0501075_0386099 3300049591 Bacteria 1067
526 Ga0501076_0000083 3300049592 Bacteria 49438
527 Ga0501076_0003053 3300049592 Bacteria 11651
528 Ga0501076_0066073 3300049592 Bacteria 2886
529 Ga0501076_0151433 3300049592 Bacteria 1887
530 Ga0501076_0164766 3300049592 Bacteria 1806
531 Ga0501076_0530577 3300049592 Unclassified 970
532 Ga0501077_0000048 3300049593 Bacteria 61935
533 Ga0501077_0027795 3300049593 Bacteria 3592
534 Ga0501077_0185794 3300049593 Bacteria 1320
535 Ga0501077_0359482 3300049593 Bacteria 929
536 Ga0501079_0000430 3300049741 Bacteria 27322
537 Ga0501079_0002092 3300049741 Bacteria 14316
538 Ga0501079_0014378 3300049741 Bacteria 6032
539 Ga0501079_0052264 3300049741 Bacteria 3153
540 Ga0501079_0334517 3300049741 Bacteria 1186
541 Ga0501080_0000026 3300049742 Bacteria 89548
542 Ga0501080_0017252 3300049742 Bacteria 6671
543 Ga0501080_0377538 3300049742 Bacteria 1277
544 Ga0501081_0000117 3300049743 Bacteria 34303
545 Ga0501081_0008319 3300049743 Bacteria 6731
546 Ga0501081_0011131 3300049743 Bacteria 5882
547 Ga0501081_0032970 3300049743 Bacteria 3516
548 Ga0501081_0097315 3300049743 Bacteria 2077
549 Ga0501081_0160024 3300049743 Bacteria 1622
550 Ga0501081_0290308 3300049743 Bacteria 1198
551 Ga0501083_0000136 3300049744 Bacteria 49859
552 Ga0501083_0003565 3300049744 Bacteria 10905
553 Ga0501083_0021027 3300049744 Bacteria 4535
554 Ga0501035_0001888 3300049822 Bacteria 21086
555 Ga0501035_0012156 3300049822 Bacteria 7960
556 Ga0501035_0081331 3300049822 Bacteria 2859
557 Ga0501035_0153536 3300049822 Bacteria 1996
558 Ga0501044_0008926 3300049823 Bacteria 10958
559 Ga0501044_0014704 3300049823 Bacteria 8438
560 Ga0501044_0121366 3300049823 Bacteria 2614
561 Ga0501045_0000199 3300049824 Bacteria 34181
562 Ga0501045_0012947 3300049824 Bacteria 5878
563 Ga0501045_0015290 3300049824 Bacteria 5447
564 Ga0501045_0038512 3300049824 Bacteria 3477
565 Ga0501045_0441625 3300049824 Bacteria 967
566 Ga0501045_0703612 3300049824 Unclassified 745
567 nmdc:mga0yw44_268467_c1 3300050492 Bacteria 1138
568 nmdc:mga05p37_1402314_c1 3300050507 Bacteria 703
569 nmdc:mga06r32_188958_c1 3300050510 Bacteria 2047
570 nmdc:mga0n895_101889_c1 3300050512 Bacteria 2881
571 nmdc:mga0n895_1312895_c1 3300050512 Bacteria 694
572 nmdc:mga0n895_151591_c1 3300050512 Bacteria 2349
573 nmdc:mga0n895_187228_c1 3300050512 Bacteria 2101
574 nmdc:mga0n895_340352_c1 3300050512 Bacteria 1519
575 nmdc:mga0n895_607384_c1 3300050512 Bacteria 1096
576 nmdc:mga0rr50_124964_c1 3300050513 Bacteria 2053
577 nmdc:mga0rr50_1537226_c1 3300050513 Bacteria 562
578 nmdc:mga0rr50_5484_c1 3300050513 Bacteria 7576
579 nmdc:mga0rr50_585895_c1 3300050513 Bacteria 950
580 nmdc:mga0rr50_85266_c1 3300050513 Bacteria 2448
581 nmdc:mga08x19_168300_c1 3300050514 Bacteria 1491
582 nmdc:mga08x19_18150_c1 3300050514 Bacteria 4310
583 nmdc:mga08x19_31942_c1 3300050514 Bacteria 3316
584 nmdc:mga0a205_1003912_c1 3300050515 Bacteria 681
585 nmdc:mga0a205_115966_c1 3300050515 Bacteria 2577
586 nmdc:mga0a205_53139_c1 3300050515 Bacteria 3909
587 nmdc:mga0a205_5657_c1 3300050515 Bacteria 11261
588 nmdc:mga0a205_817964_c1 3300050515 Bacteria 779
589 Ga0500578_0640978 3300053086 Bacteria 579
590 Ga0500643_155126 3300053087 Bacteria 614
591 Ga0500652_006729 3300053131 Bacteria 3719
592 Ga0500559_0031602 3300053136 Bacteria 2272
593 Ga0500627_0007464 3300053158 Bacteria 3809
594 Ga0500645_000176 3300053730 Bacteria 50665
595 Ga0500645_018902 3300053730 Bacteria 2147
596 Ga0501084_0002961 3300054114 Bacteria 13753
597 Ga0501084_0011176 3300054114 Bacteria 7437
598 Ga0501084_0034700 3300054114 Bacteria 4217
599 Ga0501084_0082699 3300054114 Bacteria 2694
600 Ga0501084_0209961 3300054114 Bacteria 1643
601 Ga0501084_0306111 3300054114 Bacteria 1342
602 Ga0501084_0599757 3300054114 Bacteria 930
603 Ga0501084_0620244 3300054114 Bacteria 913
604 Ga0590077_009437 3300059426 Bacteria 2001
605 Ga0501082_0000897 3300060353 Bacteria 26250
606 Ga0501082_0001243 3300060353 Bacteria 22391
607 Ga0501082_0029162 3300060353 Bacteria 4754
608 Ga0501082_0155984 3300060353 Bacteria 1983
609 Ga0501082_0226966 3300060353 Bacteria 1625
610 Ga0501082_0281699 3300060353 Bacteria 1447
611 Ga0530510_0000434 3300061734 Bacteria 26970
612 Ga0530510_0011916 3300061734 Bacteria 6098
613 Ga0530510_0020475 3300061734 Bacteria 4702
614 Ga0530510_0025174 3300061734 Bacteria 4254
615 Ga0530510_0026094 3300061734 Bacteria 4179

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005445 Ga0070708_100593569 Ga0070708_1005935692 111
2 3300037312 Ga0395899_0776727 Ga0395899_0776727_97_483 112
3 3300037418 Ga0395900_0470565 Ga0395900_0470565_290_676 112
4 3300037471 Ga0395905_0043116 Ga0395905_0043116_1107_1493 112
5 3300038443 Ga0395901_0028174 Ga0395901_0028174_332_718 112
6 3300005327 Ga0070658_11112606 Ga0070658_111126062 117
7 3300005356 Ga0070674_100361628 Ga0070674_1003616281 117
8 3300005547 Ga0070693_101298232 Ga0070693_1012982322 117
9 3300006051 Ga0075364_10474975 Ga0075364_104749753 117
10 3300009098 Ga0105245_10940287 Ga0105245_109402871 117
11 3300013308 Ga0157375_11743653 Ga0157375_117436532 117
12 3300025938 Ga0207704_10114813 Ga0207704_101148132 117
13 3300048912 Ga0496109_0517774 Ga0496109_0517774_141_524 117
14 3300048912 Ga0496109_1630107 Ga0496109_1630107_121_504 117
15 3300048913 Ga0496110_1154201 Ga0496110_1154201_227_610 117
16 3300049588 Ga0501072_0915068 Ga0501072_0915068_270_662 117
17 3300050492 nmdc:mga0yw44_268467_c1 nmdc:mga0yw44_268467_c1_78_464 117
18 3300005329 Ga0070683_100008497 Ga0070683_1000084977 118
19 3300005329 Ga0070683_101442496 Ga0070683_1014424962 118
20 3300005331 Ga0070670_101725755 Ga0070670_1017257551 118
21 3300005336 Ga0070680_100011675 Ga0070680_1000116754 118
22 3300005337 Ga0070682_100254855 Ga0070682_1002548552 118
23 3300005337 Ga0070682_100570017 Ga0070682_1005700171 118
24 3300005338 Ga0068868_100077331 Ga0068868_1000773312 118
25 3300005338 Ga0068868_101107151 Ga0068868_1011071512 118
26 3300005347 Ga0070668_100249507 Ga0070668_1002495072 118
27 3300005354 Ga0070675_101293008 Ga0070675_1012930082 118
28 3300005356 Ga0070674_100111687 Ga0070674_1001116872 118
29 3300005366 Ga0070659_101533103 Ga0070659_1015331032 118
30 3300005455 Ga0070663_100344530 Ga0070663_1003445302 118
31 3300005456 Ga0070678_100063957 Ga0070678_1000639573 118
32 3300005457 Ga0070662_101304322 Ga0070662_1013043222 118
33 3300005458 Ga0070681_10006745 Ga0070681_100067457 118
34 3300005471 Ga0070698_100039043 Ga0070698_1000390435 118
35 3300005530 Ga0070679_100013131 Ga0070679_1000131314 118
36 3300005535 Ga0070684_100013337 Ga0070684_1000133375 118
37 3300005535 Ga0070684_100901067 Ga0070684_1009010672 118
38 3300005544 Ga0070686_100254137 Ga0070686_1002541372 118
39 3300005547 Ga0070693_100058253 Ga0070693_1000582532 118
40 3300005548 Ga0070665_101938862 Ga0070665_1019388622 118
41 3300005549 Ga0070704_100511059 Ga0070704_1005110592 118
42 3300005563 Ga0068855_100943830 Ga0068855_1009438302 118
43 3300005614 Ga0068856_100238272 Ga0068856_1002382722 118
44 3300005614 Ga0068856_100271357 Ga0068856_1002713572 118
45 3300005617 Ga0068859_101148003 Ga0068859_1011480032 118
46 3300005719 Ga0068861_100399755 Ga0068861_1003997552 118
47 3300005842 Ga0068858_100575119 Ga0068858_1005751192 118
48 3300006175 Ga0070712_100460810 Ga0070712_1004608102 118
49 3300006237 Ga0097621_100896532 Ga0097621_1008965322 118
50 3300006358 Ga0068871_100273836 Ga0068871_1002738362 118
51 3300006871 Ga0075434_100203185 Ga0075434_1002031853 118
52 3300006914 Ga0075436_100410510 Ga0075436_1004105102 118
53 3300006931 Ga0097620_101148305 Ga0097620_1011483052 118
54 3300009011 Ga0105251_10543264 Ga0105251_105432642 118
55 3300009098 Ga0105245_10019665 Ga0105245_100196655 118
56 3300009098 Ga0105245_10115924 Ga0105245_101159243 118
57 3300009098 Ga0105245_10241089 Ga0105245_102410892 118
58 3300009147 Ga0114129_10929191 Ga0114129_109291912 118
59 3300009148 Ga0105243_10190359 Ga0105243_101903592 118
60 3300009148 Ga0105243_10347919 Ga0105243_103479192 118
61 3300009174 Ga0105241_10620542 Ga0105241_106205422 118
62 3300009174 Ga0105241_11225220 Ga0105241_112252202 118
63 3300009176 Ga0105242_10160284 Ga0105242_101602842 118
64 3300009176 Ga0105242_10166682 Ga0105242_101666822 118
65 3300009176 Ga0105242_12256613 Ga0105242_122566132 118
66 3300009177 Ga0105248_10884931 Ga0105248_108849312 118
67 3300009177 Ga0105248_11173232 Ga0105248_111732322 118
68 3300009551 Ga0105238_10563570 Ga0105238_105635702 118
69 3300010375 Ga0105239_10287556 Ga0105239_102875563 118
70 3300010375 Ga0105239_10352677 Ga0105239_103526771 118
71 3300011119 Ga0105246_10647642 Ga0105246_106476422 118
72 3300013296 Ga0157374_10309855 Ga0157374_103098554 118
73 3300013296 Ga0157374_10644914 Ga0157374_106449142 118
74 3300013297 Ga0157378_10738146 Ga0157378_107381461 118
75 3300013308 Ga0157375_10253374 Ga0157375_102533742 118
76 3300013308 Ga0157375_10421305 Ga0157375_104213051 118
77 3300013308 Ga0157375_10706899 Ga0157375_107068992 118
78 3300014325 Ga0163163_10183180 Ga0163163_101831802 118
79 3300014325 Ga0163163_10631268 Ga0163163_106312682 118
80 3300014325 Ga0163163_11281158 Ga0163163_112811582 118
81 3300014968 Ga0157379_10091950 Ga0157379_100919502 118
82 3300014969 Ga0157376_10346609 Ga0157376_103466092 118
83 3300014969 Ga0157376_10600532 Ga0157376_106005322 118
84 3300014969 Ga0157376_10713374 Ga0157376_107133742 118
85 3300025901 Ga0207688_10428741 Ga0207688_104287412 118
86 3300025910 Ga0207684_10562624 Ga0207684_105626241 118
87 3300025912 Ga0207707_10006426 Ga0207707_100064266 118
88 3300025915 Ga0207693_10489486 Ga0207693_104894862 118
89 3300025918 Ga0207662_10277755 Ga0207662_102777552 118
90 3300025920 Ga0207649_10087959 Ga0207649_100879592 118
91 3300025921 Ga0207652_10025019 Ga0207652_100250194 118
92 3300025924 Ga0207694_10258242 Ga0207694_102582422 118
93 3300025926 Ga0207659_10694738 Ga0207659_106947382 118
94 3300025927 Ga0207687_10311098 Ga0207687_103110982 118
95 3300025927 Ga0207687_10387934 Ga0207687_103879342 118
96 3300025928 Ga0207700_10813325 Ga0207700_108133252 118
97 3300025931 Ga0207644_11071254 Ga0207644_110712541 118
98 3300025932 Ga0207690_11064725 Ga0207690_110647252 118
99 3300025933 Ga0207706_10123498 Ga0207706_101234982 118
100 3300025933 Ga0207706_11098312 Ga0207706_110983122 118
101 3300025935 Ga0207709_10072214 Ga0207709_100722143 118
102 3300025935 Ga0207709_11826483 Ga0207709_118264832 118
103 3300025937 Ga0207669_10472144 Ga0207669_104721442 118
104 3300025938 Ga0207704_10775575 Ga0207704_107755752 118
105 3300025972 Ga0207668_10322328 Ga0207668_103223282 118
106 3300025972 Ga0207668_10579899 Ga0207668_105798992 118
107 3300025981 Ga0207640_11008463 Ga0207640_110084632 118
108 3300025981 Ga0207640_11510985 Ga0207640_115109852 118
109 3300025986 Ga0207658_11078028 Ga0207658_110780282 118
110 3300026023 Ga0207677_10060871 Ga0207677_100608712 118
111 3300026067 Ga0207678_10311883 Ga0207678_103118832 118
112 3300026078 Ga0207702_10019057 Ga0207702_100190576 118
113 3300026078 Ga0207702_10071568 Ga0207702_100715683 118
114 3300026089 Ga0207648_10584385 Ga0207648_105843852 118
115 3300026118 Ga0207675_100207947 Ga0207675_1002079472 118
116 3300026121 Ga0207683_10012927 Ga0207683_100129274 118
117 3300031344 Ga0265316_10742115 Ga0265316_107421152 118
118 3300035170 Ga0373943_0216393 Ga0373943_0216393_359_745 118
119 3300042142 Ga0450905_015829 Ga0450905_015829_397_783 118
120 3300046455 Ga0495603_0044908 Ga0495603_0044908_1455_1841 118
121 3300046455 Ga0495603_0168805 Ga0495603_0168805_765_1151 118
122 3300046459 Ga0495629_0215709 Ga0495629_0215709_402_788 118
123 3300046459 Ga0495629_0756350 Ga0495629_0756350_102_488 118
124 3300046475 Ga0495639_0175801 Ga0495639_0175801_375_761 118
125 3300046491 Ga0495584_0540253 Ga0495584_0540253_123_509 118
126 3300046523 Ga0495644_0201313 Ga0495644_0201313_182_568 118
127 3300046537 Ga0495598_0291403 Ga0495598_0291403_114_500 118
128 3300046615 Ga0495656_0130831 Ga0495656_0130831_96_482 118
129 3300046681 Ga0495647_0056475 Ga0495647_0056475_83_469 118
130 3300046681 Ga0495647_0060874 Ga0495647_0060874_162_548 118
131 3300046683 Ga0495658_0034295 Ga0495658_0034295_2304_2690 118
132 3300046689 Ga0495613_0248293 Ga0495613_0248293_56_442 118
133 3300048903 Ga0496100_0022491 Ga0496100_0022491_997_1383 118
134 3300048903 Ga0496100_1076815 Ga0496100_1076815_81_467 118
135 3300048903 Ga0496100_1090751 Ga0496100_1090751_145_531 118
136 3300048904 Ga0496101_0040653 Ga0496101_0040653_1573_1959 118
137 3300048904 Ga0496101_0048060 Ga0496101_0048060_2073_2459 118
138 3300048904 Ga0496101_0084375 Ga0496101_0084375_1729_2115 118
139 3300048904 Ga0496101_0285945 Ga0496101_0285945_525_911 118
140 3300048904 Ga0496101_1108806 Ga0496101_1108806_129_515 118
141 3300048905 Ga0496102_0004878 Ga0496102_0004878_9652_10038 118
142 3300048905 Ga0496102_0371888 Ga0496102_0371888_582_968 118
143 3300048905 Ga0496102_0671422 Ga0496102_0671422_250_636 118
144 3300048906 Ga0496103_0017273 Ga0496103_0017273_3333_3719 118
145 3300048906 Ga0496103_0203020 Ga0496103_0203020_149_535 118
146 3300048906 Ga0496103_1005256 Ga0496103_1005256_79_465 118
147 3300048907 Ga0496104_0000750 Ga0496104_0000750_14931_15317 118
148 3300048907 Ga0496104_0007405 Ga0496104_0007405_219_671 118
149 3300048907 Ga0496104_0026121 Ga0496104_0026121_4112_4498 118
150 3300048907 Ga0496104_0354872 Ga0496104_0354872_239_625 118
151 3300048907 Ga0496104_0386700 Ga0496104_0386700_841_1227 118
152 3300048907 Ga0496104_0771174 Ga0496104_0771174_121_507 118
153 3300048908 Ga0496105_0000125 Ga0496105_0000125_22908_23294 118
154 3300048908 Ga0496105_0133639 Ga0496105_0133639_490_876 118
155 3300048908 Ga0496105_0134130 Ga0496105_0134130_1529_1915 118
156 3300048908 Ga0496105_0215238 Ga0496105_0215238_1034_1486 118
157 3300048908 Ga0496105_0382909 Ga0496105_0382909_210_596 118
158 3300048909 Ga0496106_0132514 Ga0496106_0132514_322_708 118
159 3300048909 Ga0496106_0379899 Ga0496106_0379899_67_453 118
160 3300048909 Ga0496106_0695344 Ga0496106_0695344_408_794 118
161 3300048910 Ga0496107_0163880 Ga0496107_0163880_134_520 118
162 3300048910 Ga0496107_0449052 Ga0496107_0449052_454_840 118
163 3300048911 Ga0496108_0007354 Ga0496108_0007354_4999_5385 118
164 3300048911 Ga0496108_0017462 Ga0496108_0017462_1724_2110 118
165 3300048912 Ga0496109_0001636 Ga0496109_0001636_11793_12179 118
166 3300048912 Ga0496109_0010472 Ga0496109_0010472_7117_7503 118
167 3300048913 Ga0496110_0000772 Ga0496110_0000772_15964_16350 118
168 3300048913 Ga0496110_0001186 Ga0496110_0001186_7116_7502 118
169 3300048913 Ga0496110_0043650 Ga0496110_0043650_1383_1769 118
170 3300048913 Ga0496110_0229449 Ga0496110_0229449_1266_1652 118
171 3300048913 Ga0496110_0636720 Ga0496110_0636720_160_546 118
172 3300048914 Ga0496111_0000465 Ga0496111_0000465_1938_2324 118
173 3300048914 Ga0496111_0000589 Ga0496111_0000589_10765_11151 118
174 3300048914 Ga0496111_0042039 Ga0496111_0042039_534_920 118
175 3300048914 Ga0496111_0648684 Ga0496111_0648684_289_675 118
176 3300048915 Ga0496112_0210793 Ga0496112_0210793_81_467 118
177 3300048915 Ga0496112_1024135 Ga0496112_1024135_312_698 118
178 3300048916 Ga0496113_0024322 Ga0496113_0024322_64_450 118
179 3300048916 Ga0496113_0039835 Ga0496113_0039835_2129_2515 118
180 3300048916 Ga0496113_0095903 Ga0496113_0095903_1364_1816 118
181 3300048916 Ga0496113_0461401 Ga0496113_0461401_14_400 118
182 3300048917 Ga0496114_0005868 Ga0496114_0005868_240_626 118
183 3300048917 Ga0496114_0058388 Ga0496114_0058388_1724_2110 118
184 3300048917 Ga0496114_0064204 Ga0496114_0064204_2676_3062 118
185 3300048917 Ga0496114_0121986 Ga0496114_0121986_630_1016 118
186 3300048917 Ga0496114_0212698 Ga0496114_0212698_681_1067 118
187 3300048917 Ga0496114_1271883 Ga0496114_1271883_225_611 118
188 3300048918 Ga0496115_0033859 Ga0496115_0033859_3396_3782 118
189 3300048918 Ga0496115_0441125 Ga0496115_0441125_290_676 118
190 3300048918 Ga0496115_0457889 Ga0496115_0457889_165_551 118
191 3300049568 Ga0501031_0435268 Ga0501031_0435268_56_442 118
192 3300049572 Ga0501036_0198634 Ga0501036_0198634_444_830 118
193 3300049580 Ga0501046_0205297 Ga0501046_0205297_966_1352 118
194 3300049587 Ga0501071_0193983 Ga0501071_0193983_791_1177 118
195 3300049592 Ga0501076_0151433 Ga0501076_0151433_161_547 118
196 3300054114 Ga0501084_0306111 Ga0501084_0306111_600_986 118
197 3300005439 Ga0070711_100053930 Ga0070711_1000539301 120
198 3300005439 Ga0070711_100739330 Ga0070711_1007393301 120
199 3300005445 Ga0070708_100066590 Ga0070708_1000665904 120
200 3300005467 Ga0070706_100017626 Ga0070706_1000176264 120
201 3300005468 Ga0070707_100001420 Ga0070707_1000014206 120
202 3300005468 Ga0070707_100123086 Ga0070707_1001230863 120
203 3300005471 Ga0070698_100061106 Ga0070698_1000611063 120
204 3300005536 Ga0070697_100203075 Ga0070697_1002030753 120
205 3300005536 Ga0070697_100253350 Ga0070697_1002533503 120
206 3300005937 Ga0081455_10854526 Ga0081455_108545261 120
207 3300006175 Ga0070712_100003758 Ga0070712_1000037582 120
208 3300006847 Ga0075431_100213396 Ga0075431_1002133962 120
209 3300006852 Ga0075433_11201278 Ga0075433_112012782 120
210 3300006871 Ga0075434_100439022 Ga0075434_1004390222 120
211 3300025905 Ga0207685_10153253 Ga0207685_101532531 120
212 3300025915 Ga0207693_10191989 Ga0207693_101919892 120
213 3300025916 Ga0207663_10138084 Ga0207663_101380843 120
214 3300025922 Ga0207646_10012288 Ga0207646_100122886 120
215 3300025922 Ga0207646_10293117 Ga0207646_102931171 120
216 3300037312 Ga0395899_0005085 Ga0395899_0005085_7962_8336 120
217 3300037312 Ga0395899_0047722 Ga0395899_0047722_807_1172 120
218 3300037312 Ga0395899_0140887 Ga0395899_0140887_989_1354 120
219 3300037312 Ga0395899_0217229 Ga0395899_0217229_420_791 120
220 3300037312 Ga0395899_0262934 Ga0395899_0262934_415_786 120
221 3300037312 Ga0395899_0298789 Ga0395899_0298789_329_703 120
222 3300037418 Ga0395900_0031744 Ga0395900_0031744_4153_4518 120
223 3300037418 Ga0395900_0077931 Ga0395900_0077931_1570_1944 120
224 3300037418 Ga0395900_0120872 Ga0395900_0120872_2127_2498 120
225 3300037418 Ga0395900_0588090 Ga0395900_0588090_269_640 120
226 3300037418 Ga0395900_1092639 Ga0395900_1092639_269_634 120
227 3300037466 Ga0395898_0007983 Ga0395898_0007983_8913_9287 120
228 3300037466 Ga0395898_0038910 Ga0395898_0038910_170_541 120
229 3300037466 Ga0395898_0064538 Ga0395898_0064538_1106_1471 120
230 3300037466 Ga0395898_0107067 Ga0395898_0107067_16_381 120
231 3300037466 Ga0395898_0121525 Ga0395898_0121525_928_1302 120
232 3300037466 Ga0395898_0593119 Ga0395898_0593119_393_764 120
233 3300037466 Ga0395898_0692479 Ga0395898_0692479_20_385 120
234 3300037471 Ga0395905_0015229 Ga0395905_0015229_6101_6475 120
235 3300037471 Ga0395905_0038128 Ga0395905_0038128_1853_2227 120
236 3300037471 Ga0395905_0047343 Ga0395905_0047343_1780_2151 120
237 3300037471 Ga0395905_0216308 Ga0395905_0216308_135_500 120
238 3300037471 Ga0395905_0723837 Ga0395905_0723837_519_884 120
239 3300038443 Ga0395901_0040982 Ga0395901_0040982_2265_2636 120
240 3300038443 Ga0395901_0098087 Ga0395901_0098087_1193_1567 120
241 3300038443 Ga0395901_0119125 Ga0395901_0119125_604_969 120
242 3300038443 Ga0395901_0127326 Ga0395901_0127326_989_1354 120
243 3300038443 Ga0395901_0144861 Ga0395901_0144861_741_1112 120
244 3300038443 Ga0395901_0181375 Ga0395901_0181375_182_547 120
245 3300038443 Ga0395901_0438373 Ga0395901_0438373_747_1121 120
246 3300038443 Ga0395901_1908025 Ga0395901_1908025_105_521 120
247 3300048908 Ga0496105_0427455 Ga0496105_0427455_208_582 120
248 3300048910 Ga0496107_0896068 Ga0496107_0896068_119_484 120
249 3300048913 Ga0496110_0007457 Ga0496110_0007457_6701_7075 120
250 3300048913 Ga0496110_1464523 Ga0496110_1464523_208_582 120
251 3300048915 Ga0496112_0780764 Ga0496112_0780764_55_420 120
252 3300048916 Ga0496113_0998770 Ga0496113_0998770_210_584 120
253 3300049568 Ga0501031_0000303 Ga0501031_0000303_11431_11799 120
254 3300049569 Ga0501032_0001265 Ga0501032_0001265_10715_11083 120
255 3300049570 Ga0501033_0000196 Ga0501033_0000196_11299_11667 120
256 3300049570 Ga0501033_0666416 Ga0501033_0666416_208_576 120
257 3300049571 Ga0501034_0126515 Ga0501034_0126515_1311_1679 120
258 3300049572 Ga0501036_0000532 Ga0501036_0000532_11316_11684 120
259 3300049572 Ga0501036_0590862 Ga0501036_0590862_109_477 120
260 3300049573 Ga0501037_0000254 Ga0501037_0000254_34242_34610 120
261 3300049574 Ga0501038_0000266 Ga0501038_0000266_10327_10695 120
262 3300049575 Ga0501039_0000178 Ga0501039_0000178_33489_33857 120
263 3300049576 Ga0501040_0000647 Ga0501040_0000647_19450_19818 120
264 3300049576 Ga0501040_0465475 Ga0501040_0465475_261_629 120
265 3300049577 Ga0501041_0014046 Ga0501041_0014046_1493_1861 120
266 3300049578 Ga0501042_0001946 Ga0501042_0001946_11364_11732 120
267 3300049579 Ga0501043_0002582 Ga0501043_0002582_3596_3964 120
268 3300049580 Ga0501046_0000640 Ga0501046_0000640_11336_11704 120
269 3300049581 Ga0501047_0000991 Ga0501047_0000991_11341_11709 120
270 3300049582 Ga0501048_0000164 Ga0501048_0000164_29707_30075 120
271 3300049584 Ga0501068_0000009 Ga0501068_0000009_11285_11653 120
272 3300049585 Ga0501069_0001104 Ga0501069_0001104_6009_6377 120
273 3300049586 Ga0501070_0000808 Ga0501070_0000808_11530_11898 120
274 3300049587 Ga0501071_0000195 Ga0501071_0000195_15595_15963 120
275 3300049588 Ga0501072_0001130 Ga0501072_0001130_17679_18047 120
276 3300049589 Ga0501073_0000932 Ga0501073_0000932_11351_11719 120
277 3300049590 Ga0501074_0000249 Ga0501074_0000249_21618_21986 120
278 3300049591 Ga0501075_0000310 Ga0501075_0000310_11364_11732 120
279 3300049591 Ga0501075_0386099 Ga0501075_0386099_290_658 120
280 3300049592 Ga0501076_0000083 Ga0501076_0000083_11364_11732 120
281 3300049593 Ga0501077_0000048 Ga0501077_0000048_50847_51215 120
282 3300049593 Ga0501077_0359482 Ga0501077_0359482_125_493 120
283 3300049741 Ga0501079_0000430 Ga0501079_0000430_15652_16020 120
284 3300049742 Ga0501080_0000026 Ga0501080_0000026_7735_8103 120
285 3300049743 Ga0501081_0000117 Ga0501081_0000117_22572_22940 120
286 3300049743 Ga0501081_0290308 Ga0501081_0290308_769_1137 120
287 3300049744 Ga0501083_0000136 Ga0501083_0000136_11249_11617 120
288 3300049822 Ga0501035_0001888 Ga0501035_0001888_9355_9723 120
289 3300049823 Ga0501044_0008926 Ga0501044_0008926_9287_9655 120
290 3300049824 Ga0501045_0000199 Ga0501045_0000199_22450_22818 120
291 3300050512 nmdc:mga0n895_101889_c1 nmdc:mga0n895_101889_c1_1316_1690 120
292 3300050513 nmdc:mga0rr50_1537226_c1 nmdc:mga0rr50_1537226_c1_50_427 120
293 3300050515 nmdc:mga0a205_817964_c1 nmdc:mga0a205_817964_c1_197_571 120
294 3300054114 Ga0501084_0002961 Ga0501084_0002961_2665_3033 120
295 3300054114 Ga0501084_0599757 Ga0501084_0599757_229_597 120
296 3300060353 Ga0501082_0000897 Ga0501082_0000897_10359_10727 120
297 3300061734 Ga0530510_0000434 Ga0530510_0000434_15239_15607 120
298 3300005536 Ga0070697_102131662 Ga0070697_1021316621 121
299 3300005546 Ga0070696_100793527 Ga0070696_1007935272 121
300 3300050513 nmdc:mga0rr50_585895_c1 nmdc:mga0rr50_585895_c1_467_871 121
301 3300044901 Ga0466960_0000070 Ga0466960_0000070_29663_30061 122
302 3300005467 Ga0070706_100066019 Ga0070706_1000660193 124
303 3300005471 Ga0070698_100023335 Ga0070698_1000233355 124
304 3300025910 Ga0207684_10071502 Ga0207684_100715023 124
305 3300041406 Ga0439439_0019743 Ga0439439_0019743_1138_1542 124
306 3300041410 Ga0439461_0075359 Ga0439461_0075359_244_648 124
307 3300041999 Ga0439433_0068977 Ga0439433_0068977_300_704 124
308 3300042015 Ga0439462_0023740 Ga0439462_0023740_331_735 124
309 3300042156 Ga0439446_0017014 Ga0439446_0017014_905_1309 124
310 3300006058 Ga0075432_10047954 Ga0075432_100479542 125
311 3300009098 Ga0105245_10538950 Ga0105245_105389502 125
312 3300049579 Ga0501043_0374311 Ga0501043_0374311_24_419 125
313 3300005434 Ga0070709_10007340 Ga0070709_100073405 127
314 3300005435 Ga0070714_100525760 Ga0070714_1005257602 127
315 3300005436 Ga0070713_100045663 Ga0070713_1000456634 127
316 3300005467 Ga0070706_100233012 Ga0070706_1002330124 127
317 3300005467 Ga0070706_100872519 Ga0070706_1008725191 127
318 3300005471 Ga0070698_100108883 Ga0070698_1001088832 127
319 3300005518 Ga0070699_100000030 Ga0070699_100000030154 127
320 3300005518 Ga0070699_100029119 Ga0070699_1000291192 127
321 3300005549 Ga0070704_100274264 Ga0070704_1002742642 127
322 3300005937 Ga0081455_10024369 Ga0081455_100243692 127
323 3300005937 Ga0081455_10423775 Ga0081455_104237752 127
324 3300006038 Ga0075365_10046103 Ga0075365_100461033 127
325 3300006173 Ga0070716_100113178 Ga0070716_1001131783 127
326 3300006178 Ga0075367_10177959 Ga0075367_101779592 127
327 3300006178 Ga0075367_10385098 Ga0075367_103850982 127
328 3300006186 Ga0075369_10213609 Ga0075369_102136092 127
329 3300006847 Ga0075431_100233821 Ga0075431_1002338211 127
330 3300006852 Ga0075433_10009573 Ga0075433_100095734 127
331 3300006871 Ga0075434_100016059 Ga0075434_1000160593 127
332 3300006871 Ga0075434_101433482 Ga0075434_1014334822 127
333 3300006914 Ga0075436_100028526 Ga0075436_1000285263 127
334 3300006914 Ga0075436_100182281 Ga0075436_1001822812 127
335 3300007076 Ga0075435_100005251 Ga0075435_1000052513 127
336 3300009094 Ga0111539_10776258 Ga0111539_107762582 127
337 3300009147 Ga0114129_10025667 Ga0114129_100256673 127
338 3300009147 Ga0114129_10271497 Ga0114129_102714972 127
339 3300025303 Ga0209051_1017236 Ga0209051_10172364 127
340 3300025906 Ga0207699_10020452 Ga0207699_100204523 127
341 3300025928 Ga0207700_10000001 Ga0207700_10000001631 127
342 3300025929 Ga0207664_10640552 Ga0207664_106405522 127
343 3300025939 Ga0207665_10006018 Ga0207665_100060183 127
344 3300031995 Ga0307409_100363901 Ga0307409_1003639012 127
345 3300037312 Ga0395899_0012341 Ga0395899_0012341_2076_2471 127
346 3300037312 Ga0395899_0012620 Ga0395899_0012620_3014_3409 127
347 3300037312 Ga0395899_0013227 Ga0395899_0013227_4391_4795 127
348 3300037312 Ga0395899_0034863 Ga0395899_0034863_2063_2461 127
349 3300037312 Ga0395899_0064354 Ga0395899_0064354_2239_2634 127
350 3300037312 Ga0395899_0160469 Ga0395899_0160469_183_578 127
351 3300037312 Ga0395899_0241452 Ga0395899_0241452_366_767 127
352 3300037312 Ga0395899_0365561 Ga0395899_0365561_267_662 127
353 3300037418 Ga0395900_0001525 Ga0395900_0001525_25649_26053 127
354 3300037418 Ga0395900_0004057 Ga0395900_0004057_4297_4695 127
355 3300037418 Ga0395900_0115266 Ga0395900_0115266_1918_2313 127
356 3300037418 Ga0395900_0200812 Ga0395900_0200812_1261_1656 127
357 3300037418 Ga0395900_0202426 Ga0395900_0202426_62_460 127
358 3300037418 Ga0395900_0211731 Ga0395900_0211731_127_522 127
359 3300037418 Ga0395900_0227736 Ga0395900_0227736_1054_1449 127
360 3300037418 Ga0395900_0234650 Ga0395900_0234650_553_948 127
361 3300037418 Ga0395900_0562097 Ga0395900_0562097_523_924 127
362 3300037466 Ga0395898_0001639 Ga0395898_0001639_3810_4214 127
363 3300037466 Ga0395898_0009582 Ga0395898_0009582_8581_8979 127
364 3300037466 Ga0395898_0065835 Ga0395898_0065835_2735_3130 127
365 3300037466 Ga0395898_0078652 Ga0395898_0078652_2725_3120 127
366 3300037466 Ga0395898_0082572 Ga0395898_0082572_2424_2819 127
367 3300037466 Ga0395898_0195860 Ga0395898_0195860_1319_1720 127
368 3300037466 Ga0395898_0197489 Ga0395898_0197489_866_1267 127
369 3300037466 Ga0395898_0793391 Ga0395898_0793391_367_762 127
370 3300037466 Ga0395898_0874618 Ga0395898_0874618_49_444 127
371 3300037466 Ga0395898_1602496 Ga0395898_1602496_10_456 127
372 3300037466 Ga0395898_1905737 Ga0395898_1905737_109_504 127
373 3300037471 Ga0395905_0025100 Ga0395905_0025100_457_852 127
374 3300037471 Ga0395905_0065203 Ga0395905_0065203_1649_2053 127
375 3300037471 Ga0395905_0079537 Ga0395905_0079537_1444_1890 127
376 3300037471 Ga0395905_0080884 Ga0395905_0080884_694_1089 127
377 3300037471 Ga0395905_0086730 Ga0395905_0086730_445_840 127
378 3300037471 Ga0395905_0127611 Ga0395905_0127611_1405_1803 127
379 3300037471 Ga0395905_0242412 Ga0395905_0242412_1266_1661 127
380 3300037471 Ga0395905_0576953 Ga0395905_0576953_16_411 127
381 3300037471 Ga0395905_0629004 Ga0395905_0629004_260_655 127
382 3300038443 Ga0395901_0006124 Ga0395901_0006124_2211_2609 127
383 3300038443 Ga0395901_0007488 Ga0395901_0007488_2936_3331 127
384 3300038443 Ga0395901_0008254 Ga0395901_0008254_2775_3173 127
385 3300038443 Ga0395901_0008409 Ga0395901_0008409_1378_1776 127
386 3300038443 Ga0395901_0026707 Ga0395901_0026707_1571_1975 127
387 3300038443 Ga0395901_0153429 Ga0395901_0153429_1913_2308 127
388 3300038443 Ga0395901_0175908 Ga0395901_0175908_150_551 127
389 3300038443 Ga0395901_0212189 Ga0395901_0212189_1558_1953 127
390 3300038443 Ga0395901_0568046 Ga0395901_0568046_742_1137 127
391 3300038443 Ga0395901_1379007 Ga0395901_1379007_238_633 127
392 3300041501 Ga0451845_0447178 Ga0451845_0447178_313_711 127
393 3300041512 Ga0451853_0274801 Ga0451853_0274801_87_485 127
394 3300041512 Ga0451853_2439056 Ga0451853_2439056_331_753 127
395 3300045051 Ga0451576_0402277 Ga0451576_0402277_515_913 127
396 3300045051 Ga0451576_0410605 Ga0451576_0410605_40_435 127
397 3300046460 Ga0495638_0021134 Ga0495638_0021134_3050_3451 127
398 3300046491 Ga0495584_0366567 Ga0495584_0366567_11_409 127
399 3300046538 Ga0495609_0280915 Ga0495609_0280915_272_667 127
400 3300046615 Ga0495656_0099492 Ga0495656_0099492_611_1009 127
401 3300047320 Ga0495672_0061783 Ga0495672_0061783_1047_1448 127
402 3300048903 Ga0496100_0204581 Ga0496100_0204581_370_765 127
403 3300048904 Ga0496101_0566764 Ga0496101_0566764_358_753 127
404 3300048917 Ga0496114_0203006 Ga0496114_0203006_709_1104 127
405 3300048928 Ga0496125_0089486 Ga0496125_0089486_1196_1597 127
406 3300048929 Ga0496126_0008288 Ga0496126_0008288_5523_5924 127
407 3300049588 Ga0501072_0354853 Ga0501072_0354853_427_828 127
408 3300050507 nmdc:mga05p37_1402314_c1 nmdc:mga05p37_1402314_c1_103_510 127
409 3300050510 nmdc:mga06r32_188958_c1 nmdc:mga06r32_188958_c1_1453_1848 127
410 3300050512 nmdc:mga0n895_1312895_c1 nmdc:mga0n895_1312895_c1_217_612 127
411 3300050512 nmdc:mga0n895_151591_c1 nmdc:mga0n895_151591_c1_1262_1657 127
412 3300050513 nmdc:mga0rr50_5484_c1 nmdc:mga0rr50_5484_c1_4993_5388 127
413 3300050514 nmdc:mga08x19_168300_c1 nmdc:mga08x19_168300_c1_724_1119 127
414 3300050514 nmdc:mga08x19_18150_c1 nmdc:mga08x19_18150_c1_1674_2069 127
415 3300050515 nmdc:mga0a205_1003912_c1 nmdc:mga0a205_1003912_c1_34_429 127
416 3300050515 nmdc:mga0a205_5657_c1 nmdc:mga0a205_5657_c1_7798_8193 127
417 3300053086 Ga0500578_0640978 Ga0500578_0640978_16_417 127
418 3300053087 Ga0500643_155126 Ga0500643_155126_134_535 127
419 3300053131 Ga0500652_006729 Ga0500652_006729_1601_2002 127
420 3300053136 Ga0500559_0031602 Ga0500559_0031602_1841_2242 127
421 3300053158 Ga0500627_0007464 Ga0500627_0007464_940_1341 127
422 3300053730 Ga0500645_000176 Ga0500645_000176_35421_35822 127
423 3300053730 Ga0500645_018902 Ga0500645_018902_1006_1407 127
424 3300060353 Ga0501082_0281699 Ga0501082_0281699_29_466 127
425 iso_pu_bacteria 2902799365 2902803088 127
426 3300009093 Ga0105240_11245970 Ga0105240_112459701 128
427 3300003373 JGI25407J50210_10001985 JGI25407J50210_100019855 129
428 3300005435 Ga0070714_100183331 Ga0070714_1001833313 129
429 3300005445 Ga0070708_100005486 Ga0070708_1000054868 129
430 3300005445 Ga0070708_100653502 Ga0070708_1006535021 129
431 3300005445 Ga0070708_101272905 Ga0070708_1012729051 129
432 3300005445 Ga0070708_101619049 Ga0070708_1016190491 129
433 3300005459 Ga0068867_100454006 Ga0068867_1004540062 129
434 3300005467 Ga0070706_100007740 Ga0070706_1000077401 129
435 3300005468 Ga0070707_100007630 Ga0070707_1000076308 129
436 3300005468 Ga0070707_100008086 Ga0070707_1000080864 129
437 3300005468 Ga0070707_100183236 Ga0070707_1001832363 129
438 3300005468 Ga0070707_101609606 Ga0070707_1016096061 129
439 3300005471 Ga0070698_100110565 Ga0070698_1001105653 129
440 3300005471 Ga0070698_100312088 Ga0070698_1003120882 129
441 3300005471 Ga0070698_100313163 Ga0070698_1003131632 129
442 3300005471 Ga0070698_100765308 Ga0070698_1007653082 129
443 3300005518 Ga0070699_100006698 Ga0070699_1000066988 129
444 3300005518 Ga0070699_100135928 Ga0070699_1001359283 129
445 3300005518 Ga0070699_100583775 Ga0070699_1005837752 129
446 3300005518 Ga0070699_100697453 Ga0070699_1006974532 129
447 3300005518 Ga0070699_100788322 Ga0070699_1007883221 129
448 3300005536 Ga0070697_100000540 Ga0070697_1000005403 129
449 3300005536 Ga0070697_100018829 Ga0070697_1000188291 129
450 3300005549 Ga0070704_100065221 Ga0070704_1000652211 129
451 3300005549 Ga0070704_100543961 Ga0070704_1005439612 129
452 3300005549 Ga0070704_101268473 Ga0070704_1012684731 129
453 3300005718 Ga0068866_10279760 Ga0068866_102797601 129
454 3300005719 Ga0068861_100126222 Ga0068861_1001262222 129
455 3300005937 Ga0081455_10087289 Ga0081455_100872892 129
456 3300005981 Ga0081538_10000786 Ga0081538_1000078634 129
457 3300005981 Ga0081538_10004487 Ga0081538_100044874 129
458 3300005981 Ga0081538_10016522 Ga0081538_100165223 129
459 3300005981 Ga0081538_10084356 Ga0081538_100843562 129
460 3300006058 Ga0075432_10325513 Ga0075432_103255132 129
461 3300006852 Ga0075433_10007980 Ga0075433_1000798011 129
462 3300006852 Ga0075433_10216985 Ga0075433_102169853 129
463 3300006871 Ga0075434_100116143 Ga0075434_1001161433 129
464 3300006914 Ga0075436_100117604 Ga0075436_1001176043 129
465 3300007076 Ga0075435_100460144 Ga0075435_1004601443 129
466 3300009098 Ga0105245_10154175 Ga0105245_101541752 129
467 3300009147 Ga0114129_11285842 Ga0114129_112858422 129
468 3300009148 Ga0105243_10409581 Ga0105243_104095812 129
469 3300009553 Ga0105249_11918200 Ga0105249_119182001 129
470 3300010375 Ga0105239_10539597 Ga0105239_105395972 129
471 3300013297 Ga0157378_12246463 Ga0157378_122464631 129
472 3300013308 Ga0157375_10906428 Ga0157375_109064282 129
473 3300014326 Ga0157380_10948784 Ga0157380_109487842 129
474 3300014745 Ga0157377_10176112 Ga0157377_101761123 129
475 3300025899 Ga0207642_10336481 Ga0207642_103364812 129
476 3300025910 Ga0207684_10007179 Ga0207684_100071791 129
477 3300025910 Ga0207684_10008659 Ga0207684_100086595 129
478 3300025910 Ga0207684_10009374 Ga0207684_100093744 129
479 3300025910 Ga0207684_10911023 Ga0207684_109110231 129
480 3300025919 Ga0207657_11072882 Ga0207657_110728821 129
481 3300025922 Ga0207646_10000051 Ga0207646_1000005136 129
482 3300025922 Ga0207646_10001612 Ga0207646_100016122 129
483 3300025922 Ga0207646_10005217 Ga0207646_1000521718 129
484 3300025922 Ga0207646_10008806 Ga0207646_100088061 129
485 3300025922 Ga0207646_10879966 Ga0207646_108799662 129
486 3300025927 Ga0207687_10133266 Ga0207687_101332663 129
487 3300025929 Ga0207664_10292351 Ga0207664_102923513 129
488 3300025934 Ga0207686_11018187 Ga0207686_110181871 129
489 3300025937 Ga0207669_10586553 Ga0207669_105865532 129
490 3300025940 Ga0207691_10231380 Ga0207691_102313802 129
491 3300026089 Ga0207648_10311532 Ga0207648_103115322 129
492 3300027907 Ga0207428_10398412 Ga0207428_103984122 129
493 3300031548 Ga0307408_100472405 Ga0307408_1004724052 129
494 3300031852 Ga0307410_10400158 Ga0307410_104001582 129
495 3300031901 Ga0307406_10026388 Ga0307406_100263883 129
496 3300031995 Ga0307409_100064867 Ga0307409_1000648673 129
497 3300032126 Ga0307415_100007872 Ga0307415_1000078727 129
498 3300035725 Ga0373947_0038138 Ga0373947_0038138_2402_2827 129
499 3300037312 Ga0395899_0006164 Ga0395899_0006164_2212_2625 129
500 3300037418 Ga0395900_0007518 Ga0395900_0007518_9854_10297 129
501 3300037418 Ga0395900_0121106 Ga0395900_0121106_1741_2154 129
502 3300037418 Ga0395900_0464664 Ga0395900_0464664_104_526 129
503 3300037466 Ga0395898_0206290 Ga0395898_0206290_448_861 129
504 3300037466 Ga0395898_0588625 Ga0395898_0588625_555_977 129
505 3300037471 Ga0395905_0110837 Ga0395905_0110837_373_786 129
506 3300037471 Ga0395905_0225345 Ga0395905_0225345_760_1203 129
507 3300038443 Ga0395901_0032593 Ga0395901_0032593_2483_2926 129
508 3300038443 Ga0395901_0938177 Ga0395901_0938177_53_475 129
509 3300044694 Ga0466963_0427415 Ga0466963_0427415_210_629 129
510 3300044706 Ga0466964_0162219 Ga0466964_0162219_394_804 129
511 3300045976 Ga0466967_0009603 Ga0466967_0009603_3356_3775 129
512 3300045976 Ga0466967_0278370 Ga0466967_0278370_407_817 129
513 3300049568 Ga0501031_0004224 Ga0501031_0004224_2633_3043 129
514 3300049568 Ga0501031_0043953 Ga0501031_0043953_514_930 129
515 3300049569 Ga0501032_0068465 Ga0501032_0068465_1411_1821 129
516 3300049569 Ga0501032_0127889 Ga0501032_0127889_269_685 129
517 3300049570 Ga0501033_0024514 Ga0501033_0024514_1606_2016 129
518 3300049570 Ga0501033_0034856 Ga0501033_0034856_1562_1978 129
519 3300049571 Ga0501034_0009979 Ga0501034_0009979_4886_5296 129
520 3300049571 Ga0501034_0160053 Ga0501034_0160053_1342_1758 129
521 3300049572 Ga0501036_0018717 Ga0501036_0018717_5362_5772 129
522 3300049572 Ga0501036_0028954 Ga0501036_0028954_2702_3118 129
523 3300049572 Ga0501036_0581092 Ga0501036_0581092_242_655 129
524 3300049573 Ga0501037_0122531 Ga0501037_0122531_221_631 129
525 3300049574 Ga0501038_0067041 Ga0501038_0067041_2056_2472 129
526 3300049574 Ga0501038_0150099 Ga0501038_0150099_123_533 129
527 3300049575 Ga0501039_0012273 Ga0501039_0012273_549_959 129
528 3300049575 Ga0501039_0017618 Ga0501039_0017618_1234_1650 129
529 3300049575 Ga0501039_0202201 Ga0501039_0202201_1005_1418 129
530 3300049576 Ga0501040_0004249 Ga0501040_0004249_36_446 129
531 3300049576 Ga0501040_0019824 Ga0501040_0019824_3885_4295 129
532 3300049576 Ga0501040_0062339 Ga0501040_0062339_475_888 129
533 3300049577 Ga0501041_0004909 Ga0501041_0004909_7194_7604 129
534 3300049577 Ga0501041_0009532 Ga0501041_0009532_4026_4442 129
535 3300049578 Ga0501042_0021737 Ga0501042_0021737_4028_4438 129
536 3300049578 Ga0501042_0023593 Ga0501042_0023593_3666_4082 129
537 3300049578 Ga0501042_0466579 Ga0501042_0466579_262_675 129
538 3300049579 Ga0501043_0011117 Ga0501043_0011117_4090_4506 129
539 3300049579 Ga0501043_0039476 Ga0501043_0039476_1238_1648 129
540 3300049579 Ga0501043_0231927 Ga0501043_0231927_773_1162 129
541 3300049580 Ga0501046_0008730 Ga0501046_0008730_4385_4795 129
542 3300049580 Ga0501046_0041619 Ga0501046_0041619_920_1336 129
543 3300049580 Ga0501046_0051049 Ga0501046_0051049_158_568 129
544 3300049581 Ga0501047_0020840 Ga0501047_0020840_311_721 129
545 3300049582 Ga0501048_0001886 Ga0501048_0001886_5651_6061 129
546 3300049582 Ga0501048_0114018 Ga0501048_0114018_1355_1765 129
547 3300049582 Ga0501048_0168493 Ga0501048_0168493_880_1284 129
548 3300049583 Ga0501067_0099487 Ga0501067_0099487_1105_1515 129
549 3300049584 Ga0501068_0009582 Ga0501068_0009582_255_665 129
550 3300049584 Ga0501068_0194182 Ga0501068_0194182_225_641 129
551 3300049585 Ga0501069_0012741 Ga0501069_0012741_1238_1648 129
552 3300049585 Ga0501069_0015181 Ga0501069_0015181_2105_2521 129
553 3300049586 Ga0501070_0010664 Ga0501070_0010664_3427_3843 129
554 3300049586 Ga0501070_0029143 Ga0501070_0029143_192_602 129
555 3300049587 Ga0501071_0010722 Ga0501071_0010722_2032_2442 129
556 3300049587 Ga0501071_0078981 Ga0501071_0078981_969_1385 129
557 3300049587 Ga0501071_0094502 Ga0501071_0094502_1426_1830 129
558 3300049588 Ga0501072_0006292 Ga0501072_0006292_1283_1693 129
559 3300049588 Ga0501072_0733704 Ga0501072_0733704_340_750 129
560 3300049589 Ga0501073_0033895 Ga0501073_0033895_927_1337 129
561 3300049589 Ga0501073_0050165 Ga0501073_0050165_1847_2263 129
562 3300049590 Ga0501074_0035876 Ga0501074_0035876_2032_2442 129
563 3300049590 Ga0501074_0068890 Ga0501074_0068890_1563_1979 129
564 3300049590 Ga0501074_0210228 Ga0501074_0210228_914_1327 129
565 3300049591 Ga0501075_0009249 Ga0501075_0009249_36_446 129
566 3300049592 Ga0501076_0003053 Ga0501076_0003053_11206_11616 129
567 3300049592 Ga0501076_0066073 Ga0501076_0066073_1540_1944 129
568 3300049592 Ga0501076_0164766 Ga0501076_0164766_920_1336 129
569 3300049592 Ga0501076_0530577 Ga0501076_0530577_391_804 129
570 3300049593 Ga0501077_0027795 Ga0501077_0027795_2032_2442 129
571 3300049593 Ga0501077_0185794 Ga0501077_0185794_501_917 129
572 3300049741 Ga0501079_0002092 Ga0501079_0002092_2326_2736 129
573 3300049741 Ga0501079_0014378 Ga0501079_0014378_320_736 129
574 3300049741 Ga0501079_0052264 Ga0501079_0052264_2104_2517 129
575 3300049741 Ga0501079_0334517 Ga0501079_0334517_150_563 129
576 3300049742 Ga0501080_0017252 Ga0501080_0017252_1563_1979 129
577 3300049742 Ga0501080_0377538 Ga0501080_0377538_447_857 129
578 3300049743 Ga0501081_0008319 Ga0501081_0008319_3705_4115 129
579 3300049743 Ga0501081_0011131 Ga0501081_0011131_4370_4786 129
580 3300049743 Ga0501081_0032970 Ga0501081_0032970_1432_1842 129
581 3300049743 Ga0501081_0097315 Ga0501081_0097315_214_618 129
582 3300049743 Ga0501081_0160024 Ga0501081_0160024_242_655 129
583 3300049744 Ga0501083_0003565 Ga0501083_0003565_5342_5758 129
584 3300049744 Ga0501083_0021027 Ga0501083_0021027_421_831 129
585 3300049822 Ga0501035_0012156 Ga0501035_0012156_6048_6464 129
586 3300049822 Ga0501035_0081331 Ga0501035_0081331_2204_2614 129
587 3300049822 Ga0501035_0153536 Ga0501035_0153536_349_759 129
588 3300049823 Ga0501044_0014704 Ga0501044_0014704_2151_2561 129
589 3300049823 Ga0501044_0121366 Ga0501044_0121366_838_1254 129
590 3300049824 Ga0501045_0012947 Ga0501045_0012947_1764_2174 129
591 3300049824 Ga0501045_0015290 Ga0501045_0015290_4258_4674 129
592 3300049824 Ga0501045_0038512 Ga0501045_0038512_2318_2728 129
593 3300049824 Ga0501045_0441625 Ga0501045_0441625_53_466 129
594 3300049824 Ga0501045_0703612 Ga0501045_0703612_242_655 129
595 3300050512 nmdc:mga0n895_187228_c1 nmdc:mga0n895_187228_c1_874_1299 129
596 3300050512 nmdc:mga0n895_340352_c1 nmdc:mga0n895_340352_c1_562_972 129
597 3300050512 nmdc:mga0n895_607384_c1 nmdc:mga0n895_607384_c1_72_497 129
598 3300050513 nmdc:mga0rr50_124964_c1 nmdc:mga0rr50_124964_c1_1256_1666 129
599 3300050513 nmdc:mga0rr50_85266_c1 nmdc:mga0rr50_85266_c1_697_1122 129
600 3300050514 nmdc:mga08x19_31942_c1 nmdc:mga08x19_31942_c1_1673_2086 129
601 3300050515 nmdc:mga0a205_115966_c1 nmdc:mga0a205_115966_c1_1654_2079 129
602 3300050515 nmdc:mga0a205_53139_c1 nmdc:mga0a205_53139_c1_1431_1841 129
603 3300054114 Ga0501084_0011176 Ga0501084_0011176_1679_2089 129
604 3300054114 Ga0501084_0034700 Ga0501084_0034700_3746_4156 129
605 3300054114 Ga0501084_0082699 Ga0501084_0082699_1778_2194 129
606 3300054114 Ga0501084_0209961 Ga0501084_0209961_370_774 129
607 3300054114 Ga0501084_0620244 Ga0501084_0620244_68_481 129
608 3300059426 Ga0590077_009437 Ga0590077_009437_990_1436 129
609 3300060353 Ga0501082_0001243 Ga0501082_0001243_11060_11470 129
610 3300060353 Ga0501082_0029162 Ga0501082_0029162_1507_1917 129
611 3300060353 Ga0501082_0155984 Ga0501082_0155984_471_887 129
612 3300060353 Ga0501082_0226966 Ga0501082_0226966_910_1323 129
613 3300061734 Ga0530510_0011916 Ga0530510_0011916_3705_4115 129
614 3300061734 Ga0530510_0020475 Ga0530510_0020475_1585_2001 129
615 3300061734 Ga0530510_0025174 Ga0530510_0025174_3567_3977 129
616 3300061734 Ga0530510_0026094 Ga0530510_0026094_1832_2236 129

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01243

Putative_PNPOx

Pyridoxamine 5'-phosphate oxidase

24

113

0.94

PF12900

Pyridox_ox_2

Pyridoxamine 5'-phosphate oxidase

23

144

0.76

Structural Annotation

Top 5 Hits

ID Description Score Start End
5jv4-assembly3.cif.gz_F structure of f420 binding protein, msmeg_6526, from mycobacterium smegmatis with f420 bound 0.9013 3 128
5jv4-assembly3.cif.gz_F structure of f420 binding protein, msmeg_6526, from mycobacterium smegmatis with f420 bound 0.8748 3 128
5jab-assembly2.cif.gz_D structure of the biliverdin reductase rv2074 from mycobacterium tuberculosis in complex with f420 0.8327 3 127
5jab-assembly1.cif.gz_B structure of the biliverdin reductase rv2074 from mycobacterium tuberculosis in complex with f420 0.8188 3 127
7kq2-assembly1.cif.gz_A 1.98 a resolution crystal structure of group a streptococcus h111a hupz-v5-his6 0.8065 4 128
ID Description Score Start End Superfamily
5jv4A00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.8647 3 128 2.30.110.10
1rfeA01 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.8507 5 128 2.30.110.10
5jv4A00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.8399 3 128 2.30.110.10
5escD00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.8148 9 129 2.30.110.10
3u0iA00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.8038 2 127 2.30.110.10
ID Description Score Start End GO Terms
AF-A0A6C0QB21-F1-model_v4 Pyridoxamine 5'-phosphate oxidase 0.99 25 128
AF-A0A7W1BQW8-F1-model_v4 Pyridoxamine 5'-phosphate oxidase family protein 0.984 31 128 GO:0005829
GO:0016627
GO:0070967
AF-A0A3E0NYQ5-F1-model_v4 TIGR03668 family PPOX class F420-dependent oxidoreductase 0.9836 4 128 GO:0005829
GO:0016627
GO:0070967
AF-D7BT75-F1-model_v4 Pyridoxamine 5'-phosphate oxidase N-terminal domain-containing protein 0.9779 11 128 GO:0005829
GO:0016627
GO:0070967
AF-A0A0S4QYV4-F1-model_v4 TIGR00725 family protein/PPOX class probable F420-dependent enzyme, Rv0121 family 0.976 2 128 GO:0005829
GO:0016627
GO:0070967

Feature Viewer

pLDDT pTM Quality
95.9 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map