F469446
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 615 | 274 | 615 | 130 |
Family's Representative Sequence
| Representative Sequence | 3300025916|Ga0207663_10358236|Ga0207663_103582362 |
| Length | 149 |
| Sequence | VGCNGPLSLIDCADDAMPATAMNHFTILTDDVPATVRFYRELLGLADGPRPPLQFPGAWLYAGGSPILHVVGGRPADELKAGVIDHMAFSATDLSDTLAMLTSRNIEHTCRRQAGSGTWQVFFHDPNGARVELDFAADEPHHPKEAATR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 2 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 5 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 6 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 9 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 11 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 13 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 15 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 16 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 18 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 40 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 41 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 46 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 48 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 50 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 56 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 58 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 59 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 60 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 61 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 62 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 63 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 64 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 65 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 66 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 67 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 68 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 69 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 70 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 71 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 72 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 73 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 74 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 76 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 77 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 78 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 79 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 81 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 82 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 83 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 84 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 85 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 86 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 87 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 88 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 90 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 115 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 116 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 117 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 175 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 179 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 180 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 181 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 182 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 183 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 184 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 185 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 186 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 187 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 188 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 189 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 190 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 191 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 192 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 193 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 194 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 195 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 196 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 197 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 198 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 199 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 200 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 201 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 202 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 203 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 204 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 205 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 206 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 207 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 208 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 209 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 210 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 211 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 212 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 213 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 214 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 215 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 216 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 217 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 218 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 219 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 220 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 221 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 222 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 223 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 224 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 225 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 226 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 237 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 238 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 239 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 240 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 241 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 242 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 243 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 244 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 245 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 246 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 247 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 248 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 249 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 250 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 251 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 252 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 253 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 254 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 255 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 256 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 257 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 258 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 259 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 260 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 261 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 262 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 263 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 264 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 265 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 266 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 267 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 268 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 269 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 270 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 273 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 274 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.35 |
| Metatranscriptomes | 0.65 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.16 |
| Nodule | 0 |
| Rhizoplane | 2.11 |
| Rhizosphere | 97.72 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25404J52841_10012451 | 3300003659 | Unclassified | 1842 |
| 2 | Ga0070658_10131831 | 3300005327 | Unclassified | 2083 |
| 3 | Ga0070658_10184180 | 3300005327 | Bacteria | 1758 |
| 4 | Ga0070658_10228101 | 3300005327 | Unclassified | 1576 |
| 5 | Ga0070676_10351451 | 3300005328 | Bacteria | 1013 |
| 6 | Ga0070683_100030094 | 3300005329 | Bacteria | 4924 |
| 7 | Ga0070683_100109442 | 3300005329 | Bacteria | 2606 |
| 8 | Ga0070683_100606557 | 3300005329 | Unclassified | 1048 |
| 9 | Ga0070683_100916236 | 3300005329 | Bacteria | 841 |
| 10 | Ga0070690_100021326 | 3300005330 | Bacteria | 3954 |
| 11 | Ga0070690_101766116 | 3300005330 | Unclassified | 504 |
| 12 | Ga0070670_100016039 | 3300005331 | Bacteria | 6429 |
| 13 | Ga0070670_100017719 | 3300005331 | Bacteria | 6110 |
| 14 | Ga0070670_100030694 | 3300005331 | Bacteria | 4628 |
| 15 | Ga0070670_100073088 | 3300005331 | Bacteria | 2946 |
| 16 | Ga0070670_100533647 | 3300005331 | Unclassified | 1046 |
| 17 | Ga0070670_100553470 | 3300005331 | Bacteria | 1026 |
| 18 | Ga0070677_10226025 | 3300005333 | Unclassified | 917 |
| 19 | Ga0068869_100015730 | 3300005334 | Bacteria | 5083 |
| 20 | Ga0068869_100117232 | 3300005334 | Bacteria | 2032 |
| 21 | Ga0068869_101034802 | 3300005334 | Bacteria | 716 |
| 22 | Ga0070666_10784153 | 3300005335 | Unclassified | 701 |
| 23 | Ga0070680_100110066 | 3300005336 | Bacteria | 2293 |
| 24 | Ga0070680_100171575 | 3300005336 | Unclassified | 1825 |
| 25 | Ga0070680_100560931 | 3300005336 | Bacteria | 979 |
| 26 | Ga0070680_100798877 | 3300005336 | Unclassified | 813 |
| 27 | Ga0070680_101415430 | 3300005336 | Bacteria | 602 |
| 28 | Ga0070682_100006581 | 3300005337 | Bacteria | 6518 |
| 29 | Ga0068868_100575467 | 3300005338 | Unclassified | 995 |
| 30 | Ga0068868_101604875 | 3300005338 | Bacteria | 611 |
| 31 | Ga0070660_100074822 | 3300005339 | Bacteria | 2651 |
| 32 | Ga0070660_100083449 | 3300005339 | Bacteria | 2510 |
| 33 | Ga0070660_100116430 | 3300005339 | Unclassified | 2131 |
| 34 | Ga0070660_100751133 | 3300005339 | Bacteria | 819 |
| 35 | Ga0070689_100772089 | 3300005340 | Bacteria | 843 |
| 36 | Ga0070691_10069010 | 3300005341 | Bacteria | 1712 |
| 37 | Ga0070661_100004383 | 3300005344 | Bacteria | 9732 |
| 38 | Ga0070661_100059040 | 3300005344 | Unclassified | 2812 |
| 39 | Ga0070661_100095951 | 3300005344 | Bacteria | 2200 |
| 40 | Ga0070661_100309556 | 3300005344 | Bacteria | 1231 |
| 41 | Ga0070661_100808476 | 3300005344 | Unclassified | 770 |
| 42 | Ga0070692_10024547 | 3300005345 | Bacteria | 2964 |
| 43 | Ga0070692_10934002 | 3300005345 | Unclassified | 602 |
| 44 | Ga0070668_100132512 | 3300005347 | Bacteria | 2001 |
| 45 | Ga0070668_100216125 | 3300005347 | Bacteria | 1579 |
| 46 | Ga0070668_100788404 | 3300005347 | Bacteria | 843 |
| 47 | Ga0070669_100194598 | 3300005353 | Unclassified | 1592 |
| 48 | Ga0070675_100008923 | 3300005354 | Bacteria | 7788 |
| 49 | Ga0070675_100026327 | 3300005354 | Bacteria | 4668 |
| 50 | Ga0070675_100414976 | 3300005354 | Bacteria | 1203 |
| 51 | Ga0070675_101274279 | 3300005354 | Unclassified | 677 |
| 52 | Ga0070671_100037619 | 3300005355 | Bacteria | 4014 |
| 53 | Ga0070671_100066394 | 3300005355 | Bacteria | 3006 |
| 54 | Ga0070671_100831820 | 3300005355 | Bacteria | 805 |
| 55 | Ga0070671_101278973 | 3300005355 | Bacteria | 647 |
| 56 | Ga0070671_101705110 | 3300005355 | Unclassified | 559 |
| 57 | Ga0070671_101948687 | 3300005355 | Unclassified | 523 |
| 58 | Ga0070674_100070820 | 3300005356 | Bacteria | 2465 |
| 59 | Ga0070674_100216515 | 3300005356 | Bacteria | 1488 |
| 60 | Ga0070674_100714626 | 3300005356 | Bacteria | 858 |
| 61 | Ga0070673_100015316 | 3300005364 | Bacteria | 5381 |
| 62 | Ga0070659_100005229 | 3300005366 | Bacteria | 9312 |
| 63 | Ga0070659_100252463 | 3300005366 | Bacteria | 1462 |
| 64 | Ga0070659_101784936 | 3300005366 | Bacteria | 551 |
| 65 | Ga0070667_100246002 | 3300005367 | Bacteria | 1598 |
| 66 | Ga0070667_100744729 | 3300005367 | Bacteria | 908 |
| 67 | Ga0070667_100988836 | 3300005367 | Unclassified | 785 |
| 68 | Ga0070709_10114820 | 3300005434 | Bacteria | 1815 |
| 69 | Ga0070709_10157916 | 3300005434 | Bacteria | 1574 |
| 70 | Ga0070709_10218638 | 3300005434 | Bacteria | 1358 |
| 71 | Ga0070714_100009546 | 3300005435 | Bacteria | 7634 |
| 72 | Ga0070714_100016715 | 3300005435 | Bacteria | 5932 |
| 73 | Ga0070714_100557635 | 3300005435 | Bacteria | 1097 |
| 74 | Ga0070713_100761686 | 3300005436 | Bacteria | 927 |
| 75 | Ga0070713_101225203 | 3300005436 | Unclassified | 727 |
| 76 | Ga0070710_10059970 | 3300005437 | Bacteria | 2163 |
| 77 | Ga0070710_10548033 | 3300005437 | Unclassified | 798 |
| 78 | Ga0070701_10078614 | 3300005438 | Bacteria | 1780 |
| 79 | Ga0070701_10780902 | 3300005438 | Bacteria | 650 |
| 80 | Ga0070711_100061572 | 3300005439 | Bacteria | 2613 |
| 81 | Ga0070711_100254872 | 3300005439 | Bacteria | 1378 |
| 82 | Ga0070711_100264466 | 3300005439 | Bacteria | 1355 |
| 83 | Ga0070711_100400816 | 3300005439 | Bacteria | 1114 |
| 84 | Ga0070705_100050646 | 3300005440 | Bacteria | 2417 |
| 85 | Ga0070705_100559572 | 3300005440 | Bacteria | 878 |
| 86 | Ga0070700_100169471 | 3300005441 | Bacteria | 1511 |
| 87 | Ga0070700_100464481 | 3300005441 | Bacteria | 966 |
| 88 | Ga0070694_100028218 | 3300005444 | Bacteria | 3650 |
| 89 | Ga0070694_100283316 | 3300005444 | Unclassified | 1264 |
| 90 | Ga0070708_100062093 | 3300005445 | Unclassified | 3340 |
| 91 | Ga0070708_101060919 | 3300005445 | Bacteria | 759 |
| 92 | Ga0070663_100013346 | 3300005455 | Bacteria | 5234 |
| 93 | Ga0070663_100064699 | 3300005455 | Bacteria | 2644 |
| 94 | Ga0070678_100672357 | 3300005456 | Unclassified | 930 |
| 95 | Ga0070678_100738170 | 3300005456 | Unclassified | 890 |
| 96 | Ga0070662_100212177 | 3300005457 | Unclassified | 1541 |
| 97 | Ga0070662_101271960 | 3300005457 | Unclassified | 633 |
| 98 | Ga0070662_101379886 | 3300005457 | Unclassified | 607 |
| 99 | Ga0070681_10002557 | 3300005458 | Bacteria | 16703 |
| 100 | Ga0070681_10017663 | 3300005458 | Bacteria | 7129 |
| 101 | Ga0070681_10251868 | 3300005458 | Unclassified | 1678 |
| 102 | Ga0070681_10353651 | 3300005458 | Bacteria | 1379 |
| 103 | Ga0070681_10840985 | 3300005458 | Bacteria | 835 |
| 104 | Ga0070681_11332216 | 3300005458 | Bacteria | 641 |
| 105 | Ga0068867_100316526 | 3300005459 | Unclassified | 1291 |
| 106 | Ga0070706_100142185 | 3300005467 | Bacteria | 2240 |
| 107 | Ga0070707_100635284 | 3300005468 | Bacteria | 1030 |
| 108 | Ga0070698_100025599 | 3300005471 | Bacteria | 6150 |
| 109 | Ga0070698_100057238 | 3300005471 | Bacteria | 3946 |
| 110 | Ga0070698_100299014 | 3300005471 | Bacteria | 1540 |
| 111 | Ga0070699_100074642 | 3300005518 | Bacteria | 2951 |
| 112 | Ga0070699_100099661 | 3300005518 | Bacteria | 2546 |
| 113 | Ga0070699_100806266 | 3300005518 | Bacteria | 859 |
| 114 | Ga0070699_101707736 | 3300005518 | Unclassified | 577 |
| 115 | Ga0070679_100059945 | 3300005530 | Bacteria | 3792 |
| 116 | Ga0070679_100138861 | 3300005530 | Bacteria | 2411 |
| 117 | Ga0070679_100450072 | 3300005530 | Unclassified | 1232 |
| 118 | Ga0070679_100989860 | 3300005530 | Bacteria | 785 |
| 119 | Ga0070684_100003238 | 3300005535 | Bacteria | 12177 |
| 120 | Ga0070684_100920162 | 3300005535 | Unclassified | 820 |
| 121 | Ga0068853_100004451 | 3300005539 | Bacteria | 10856 |
| 122 | Ga0068853_100076922 | 3300005539 | Bacteria | 2915 |
| 123 | Ga0068853_100467410 | 3300005539 | Unclassified | 1188 |
| 124 | Ga0068853_100522057 | 3300005539 | Unclassified | 1123 |
| 125 | Ga0070672_100025743 | 3300005543 | Bacteria | 4369 |
| 126 | Ga0070672_100148482 | 3300005543 | Bacteria | 1938 |
| 127 | Ga0070672_101122800 | 3300005543 | Bacteria | 699 |
| 128 | Ga0070686_101034081 | 3300005544 | Bacteria | 675 |
| 129 | Ga0070695_100025393 | 3300005545 | Bacteria | 3658 |
| 130 | Ga0070696_100009400 | 3300005546 | Bacteria | 6545 |
| 131 | Ga0070696_100012892 | 3300005546 | Bacteria | 5611 |
| 132 | Ga0070693_100112322 | 3300005547 | Unclassified | 1678 |
| 133 | Ga0070693_100297914 | 3300005547 | Unclassified | 1086 |
| 134 | Ga0070693_101195099 | 3300005547 | Unclassified | 584 |
| 135 | Ga0070665_100918815 | 3300005548 | Unclassified | 888 |
| 136 | Ga0070665_101449755 | 3300005548 | Bacteria | 695 |
| 137 | Ga0070665_101576840 | 3300005548 | Unclassified | 665 |
| 138 | Ga0070704_100396643 | 3300005549 | Unclassified | 1176 |
| 139 | Ga0068855_100007207 | 3300005563 | Bacteria | 13495 |
| 140 | Ga0068855_100262575 | 3300005563 | Bacteria | 1923 |
| 141 | Ga0068855_100827129 | 3300005563 | Unclassified | 983 |
| 142 | Ga0068855_101461795 | 3300005563 | Bacteria | 703 |
| 143 | Ga0070664_100014442 | 3300005564 | Bacteria | 6438 |
| 144 | Ga0070664_100063712 | 3300005564 | Bacteria | 3143 |
| 145 | Ga0070664_100127526 | 3300005564 | Bacteria | 2233 |
| 146 | Ga0070664_101850624 | 3300005564 | Bacteria | 572 |
| 147 | Ga0068857_100037437 | 3300005577 | Bacteria | 4297 |
| 148 | Ga0068857_101064988 | 3300005577 | Bacteria | 780 |
| 149 | Ga0068857_101321657 | 3300005577 | Bacteria | 700 |
| 150 | Ga0068854_100024769 | 3300005578 | Bacteria | 4112 |
| 151 | Ga0068854_100293111 | 3300005578 | Bacteria | 1314 |
| 152 | Ga0068856_100003385 | 3300005614 | Bacteria | 16148 |
| 153 | Ga0068856_100006230 | 3300005614 | Bacteria | 11706 |
| 154 | Ga0068856_100029868 | 3300005614 | Bacteria | 5327 |
| 155 | Ga0068856_100409436 | 3300005614 | Bacteria | 1376 |
| 156 | Ga0068856_100780751 | 3300005614 | Unclassified | 975 |
| 157 | Ga0068856_101783214 | 3300005614 | Unclassified | 627 |
| 158 | Ga0068856_102017300 | 3300005614 | Unclassified | 587 |
| 159 | Ga0068852_100075176 | 3300005616 | Bacteria | 2979 |
| 160 | Ga0068852_100134074 | 3300005616 | Unclassified | 2284 |
| 161 | Ga0068852_102837392 | 3300005616 | Unclassified | 503 |
| 162 | Ga0068859_100226616 | 3300005617 | Bacteria | 1957 |
| 163 | Ga0068859_100267259 | 3300005617 | Bacteria | 1802 |
| 164 | Ga0068859_100916544 | 3300005617 | Unclassified | 961 |
| 165 | Ga0068859_102188805 | 3300005617 | Unclassified | 610 |
| 166 | Ga0068864_100000841 | 3300005618 | Bacteria | 25890 |
| 167 | Ga0068864_100114451 | 3300005618 | Bacteria | 2405 |
| 168 | Ga0068864_100159951 | 3300005618 | Bacteria | 2047 |
| 169 | Ga0068864_101821933 | 3300005618 | Bacteria | 614 |
| 170 | Ga0068864_101837956 | 3300005618 | Bacteria | 611 |
| 171 | Ga0068864_102024975 | 3300005618 | Bacteria | 582 |
| 172 | Ga0068864_102364233 | 3300005618 | Unclassified | 538 |
| 173 | Ga0068866_10325635 | 3300005718 | Unclassified | 968 |
| 174 | Ga0068861_100010493 | 3300005719 | Bacteria | 6430 |
| 175 | Ga0068861_100132229 | 3300005719 | Unclassified | 2026 |
| 176 | Ga0068861_100205450 | 3300005719 | Bacteria | 1656 |
| 177 | Ga0068851_10000457 | 3300005834 | Bacteria | 18129 |
| 178 | Ga0068851_10549360 | 3300005834 | Unclassified | 698 |
| 179 | Ga0068870_10006062 | 3300005840 | Bacteria | 5311 |
| 180 | Ga0068870_10109265 | 3300005840 | Unclassified | 1576 |
| 181 | Ga0068863_100027650 | 3300005841 | Bacteria | 5411 |
| 182 | Ga0068863_100147927 | 3300005841 | Unclassified | 2247 |
| 183 | Ga0068863_100229248 | 3300005841 | Unclassified | 1791 |
| 184 | Ga0068858_100013104 | 3300005842 | Bacteria | 7818 |
| 185 | Ga0068860_100014659 | 3300005843 | Bacteria | 7670 |
| 186 | Ga0068862_100016324 | 3300005844 | Bacteria | 6179 |
| 187 | Ga0068862_100036063 | 3300005844 | Bacteria | 4189 |
| 188 | Ga0081455_10040570 | 3300005937 | Bacteria | 4103 |
| 189 | Ga0081455_10245942 | 3300005937 | Bacteria | 1311 |
| 190 | Ga0081538_10000830 | 3300005981 | Bacteria | 33520 |
| 191 | Ga0081540_1000689 | 3300005983 | Bacteria | 31559 |
| 192 | Ga0081540_1062866 | 3300005983 | Bacteria | 1760 |
| 193 | Ga0070717_11778426 | 3300006028 | Bacteria | 557 |
| 194 | Ga0070715_10063013 | 3300006163 | Bacteria | 1633 |
| 195 | Ga0070716_100067535 | 3300006173 | Bacteria | 2089 |
| 196 | Ga0070716_100466568 | 3300006173 | Bacteria | 924 |
| 197 | Ga0070712_100563221 | 3300006175 | Unclassified | 961 |
| 198 | Ga0070712_100681750 | 3300006175 | Bacteria | 875 |
| 199 | Ga0070712_101124179 | 3300006175 | Bacteria | 682 |
| 200 | Ga0075366_10062748 | 3300006195 | Bacteria | 2208 |
| 201 | Ga0097621_100009171 | 3300006237 | Bacteria | 7172 |
| 202 | Ga0097621_100256787 | 3300006237 | Unclassified | 1532 |
| 203 | Ga0097621_100284598 | 3300006237 | Unclassified | 1456 |
| 204 | Ga0068871_100026041 | 3300006358 | Bacteria | 4559 |
| 205 | Ga0068871_100074190 | 3300006358 | Unclassified | 2806 |
| 206 | Ga0068871_100327750 | 3300006358 | Unclassified | 1350 |
| 207 | Ga0068871_100437974 | 3300006358 | Unclassified | 1170 |
| 208 | Ga0068871_100456398 | 3300006358 | Unclassified | 1146 |
| 209 | Ga0068871_102369069 | 3300006358 | Bacteria | 506 |
| 210 | Ga0075428_100060102 | 3300006844 | Bacteria | 4161 |
| 211 | Ga0075428_100152732 | 3300006844 | Bacteria | 2508 |
| 212 | Ga0075430_100603733 | 3300006846 | Unclassified | 905 |
| 213 | Ga0075431_100052301 | 3300006847 | Bacteria | 4211 |
| 214 | Ga0075431_100675198 | 3300006847 | Bacteria | 1012 |
| 215 | Ga0075431_100829331 | 3300006847 | Bacteria | 897 |
| 216 | Ga0075433_10001112 | 3300006852 | Bacteria | 19430 |
| 217 | Ga0075433_10223062 | 3300006852 | Bacteria | 1674 |
| 218 | Ga0075433_11041446 | 3300006852 | Unclassified | 712 |
| 219 | Ga0075433_11603121 | 3300006852 | Unclassified | 561 |
| 220 | Ga0075434_100003189 | 3300006871 | Bacteria | 14630 |
| 221 | Ga0075434_100375841 | 3300006871 | Unclassified | 1442 |
| 222 | Ga0075434_101429951 | 3300006871 | Unclassified | 701 |
| 223 | Ga0068865_100243368 | 3300006881 | Unclassified | 1416 |
| 224 | Ga0075436_100614805 | 3300006914 | Bacteria | 801 |
| 225 | Ga0097620_100226601 | 3300006931 | Bacteria | 1957 |
| 226 | Ga0097620_100267247 | 3300006931 | Bacteria | 1802 |
| 227 | Ga0097620_100916534 | 3300006931 | Unclassified | 961 |
| 228 | Ga0097620_102189228 | 3300006931 | Unclassified | 610 |
| 229 | Ga0075435_100032237 | 3300007076 | Bacteria | 4137 |
| 230 | Ga0105251_10117670 | 3300009011 | Bacteria | 1208 |
| 231 | Ga0105240_10012034 | 3300009093 | Bacteria | 11994 |
| 232 | Ga0105240_10017559 | 3300009093 | Bacteria | 9640 |
| 233 | Ga0105240_10517782 | 3300009093 | Unclassified | 1324 |
| 234 | Ga0105240_11029126 | 3300009093 | Unclassified | 879 |
| 235 | Ga0111539_10003831 | 3300009094 | Bacteria | 19809 |
| 236 | Ga0111539_10067648 | 3300009094 | Bacteria | 4218 |
| 237 | Ga0111539_10285013 | 3300009094 | Bacteria | 1922 |
| 238 | Ga0111539_10398881 | 3300009094 | Bacteria | 1602 |
| 239 | Ga0111539_12039158 | 3300009094 | Unclassified | 665 |
| 240 | Ga0105245_11414358 | 3300009098 | Bacteria | 746 |
| 241 | Ga0114129_10037458 | 3300009147 | Bacteria | 6846 |
| 242 | Ga0114129_10243061 | 3300009147 | Bacteria | 2419 |
| 243 | Ga0114129_10461701 | 3300009147 | Bacteria | 1664 |
| 244 | Ga0114129_11530696 | 3300009147 | Bacteria | 819 |
| 245 | Ga0105241_10012204 | 3300009174 | Bacteria | 6305 |
| 246 | Ga0105241_10474295 | 3300009174 | Unclassified | 1111 |
| 247 | Ga0105242_10068067 | 3300009176 | Bacteria | 2945 |
| 248 | Ga0105242_10477497 | 3300009176 | Bacteria | 1181 |
| 249 | Ga0105237_10586760 | 3300009545 | Bacteria | 1121 |
| 250 | Ga0105238_10019514 | 3300009551 | Bacteria | 6904 |
| 251 | Ga0105238_11622146 | 3300009551 | Unclassified | 677 |
| 252 | Ga0105249_10017355 | 3300009553 | Bacteria | 6391 |
| 253 | Ga0105239_10061727 | 3300010375 | Bacteria | 4114 |
| 254 | Ga0157373_10002549 | 3300013100 | Bacteria | 13854 |
| 255 | Ga0157373_10047428 | 3300013100 | Bacteria | 3064 |
| 256 | Ga0157370_10039988 | 3300013104 | Bacteria | 4530 |
| 257 | Ga0157370_10043896 | 3300013104 | Bacteria | 4300 |
| 258 | Ga0157370_10096451 | 3300013104 | Bacteria | 2774 |
| 259 | Ga0157370_10134545 | 3300013104 | Bacteria | 2305 |
| 260 | Ga0157370_10192997 | 3300013104 | Unclassified | 1890 |
| 261 | Ga0157370_10550113 | 3300013104 | Bacteria | 1058 |
| 262 | Ga0157369_10002831 | 3300013105 | Bacteria | 20703 |
| 263 | Ga0157369_10298023 | 3300013105 | Bacteria | 1678 |
| 264 | Ga0157369_10697660 | 3300013105 | Bacteria | 1045 |
| 265 | Ga0157369_10762026 | 3300013105 | Bacteria | 995 |
| 266 | Ga0157369_11871603 | 3300013105 | Unclassified | 609 |
| 267 | Ga0157369_12490289 | 3300013105 | Unclassified | 524 |
| 268 | Ga0157374_10190184 | 3300013296 | Bacteria | 2008 |
| 269 | Ga0157378_10032366 | 3300013297 | Bacteria | 4621 |
| 270 | Ga0157378_10774702 | 3300013297 | Unclassified | 983 |
| 271 | Ga0157378_10803016 | 3300013297 | Unclassified | 967 |
| 272 | Ga0157378_11783025 | 3300013297 | Bacteria | 663 |
| 273 | Ga0163162_10332794 | 3300013306 | Bacteria | 1651 |
| 274 | Ga0163162_10406189 | 3300013306 | Bacteria | 1495 |
| 275 | Ga0157372_10016270 | 3300013307 | Bacteria | 7983 |
| 276 | Ga0157372_10066836 | 3300013307 | Bacteria | 4039 |
| 277 | Ga0157372_10193129 | 3300013307 | Bacteria | 2358 |
| 278 | Ga0157372_10204539 | 3300013307 | Bacteria | 2288 |
| 279 | Ga0157372_10222084 | 3300013307 | Unclassified | 2190 |
| 280 | Ga0157375_10767287 | 3300013308 | Bacteria | 1115 |
| 281 | Ga0157375_11008296 | 3300013308 | Bacteria | 972 |
| 282 | Ga0163163_10024385 | 3300014325 | Bacteria | 5757 |
| 283 | Ga0163163_10044224 | 3300014325 | Bacteria | 4368 |
| 284 | Ga0163163_11399267 | 3300014325 | Unclassified | 761 |
| 285 | Ga0157380_10045652 | 3300014326 | Bacteria | 3439 |
| 286 | Ga0157379_10160855 | 3300014968 | Unclassified | 2027 |
| 287 | Ga0157379_10764361 | 3300014968 | Bacteria | 910 |
| 288 | Ga0157376_10060630 | 3300014969 | Bacteria | 3178 |
| 289 | Ga0157376_10481682 | 3300014969 | Unclassified | 1216 |
| 290 | Ga0157376_12933235 | 3300014969 | Bacteria | 516 |
| 291 | Ga0163161_10012763 | 3300017792 | Bacteria | 5835 |
| 292 | Ga0163161_10017531 | 3300017792 | Bacteria | 5012 |
| 293 | Ga0163161_11321444 | 3300017792 | Bacteria | 627 |
| 294 | Ga0197907_10211369 | 3300020069 | Unclassified | 946 |
| 295 | Ga0206354_10160873 | 3300020081 | Unclassified | 1216 |
| 296 | Ga0206353_10584646 | 3300020082 | Unclassified | 694 |
| 297 | Ga0206353_11840695 | 3300020082 | Bacteria | 2979 |
| 298 | Ga0207656_10002389 | 3300025321 | Bacteria | 6315 |
| 299 | Ga0207656_10003117 | 3300025321 | Bacteria | 5681 |
| 300 | Ga0207682_10154474 | 3300025893 | Bacteria | 1037 |
| 301 | Ga0207692_10146712 | 3300025898 | Bacteria | 1347 |
| 302 | Ga0207710_10636272 | 3300025900 | Bacteria | 558 |
| 303 | Ga0207680_10090608 | 3300025903 | Unclassified | 1944 |
| 304 | Ga0207680_10195095 | 3300025903 | Unclassified | 1377 |
| 305 | Ga0207680_10500692 | 3300025903 | Bacteria | 865 |
| 306 | Ga0207685_10165822 | 3300025905 | Unclassified | 1012 |
| 307 | Ga0207699_10107838 | 3300025906 | Unclassified | 1780 |
| 308 | Ga0207699_10290263 | 3300025906 | Bacteria | 1139 |
| 309 | Ga0207699_10294031 | 3300025906 | Bacteria | 1132 |
| 310 | Ga0207645_10289787 | 3300025907 | Bacteria | 1088 |
| 311 | Ga0207645_10593312 | 3300025907 | Unclassified | 752 |
| 312 | Ga0207643_10009557 | 3300025908 | Bacteria | 5209 |
| 313 | Ga0207643_10021345 | 3300025908 | Bacteria | 3557 |
| 314 | Ga0207705_10320220 | 3300025909 | Bacteria | 1191 |
| 315 | Ga0207705_10658968 | 3300025909 | Bacteria | 814 |
| 316 | Ga0207705_10754153 | 3300025909 | Unclassified | 756 |
| 317 | Ga0207684_10113265 | 3300025910 | Bacteria | 2322 |
| 318 | Ga0207654_10108462 | 3300025911 | Unclassified | 1723 |
| 319 | Ga0207707_10023534 | 3300025912 | Bacteria | 5387 |
| 320 | Ga0207707_10041401 | 3300025912 | Unclassified | 4023 |
| 321 | Ga0207707_10098180 | 3300025912 | Bacteria | 2560 |
| 322 | Ga0207707_10101262 | 3300025912 | Unclassified | 2518 |
| 323 | Ga0207707_10283095 | 3300025912 | Viruses | 1436 |
| 324 | Ga0207707_10331402 | 3300025912 | Bacteria | 1313 |
| 325 | Ga0207695_10004525 | 3300025913 | Bacteria | 18922 |
| 326 | Ga0207695_10029883 | 3300025913 | Bacteria | 6011 |
| 327 | Ga0207695_10810506 | 3300025913 | Unclassified | 816 |
| 328 | Ga0207671_11318228 | 3300025914 | Bacteria | 562 |
| 329 | Ga0207663_10221670 | 3300025916 | Bacteria | 1376 |
| 330 | Ga0207663_10306983 | 3300025916 | Bacteria | 1188 |
| 331 | Ga0207663_10358236 | 3300025916 | Bacteria | 1106 |
| 332 | Ga0207660_10031547 | 3300025917 | Bacteria | 3651 |
| 333 | Ga0207660_10088234 | 3300025917 | Bacteria | 2293 |
| 334 | Ga0207660_10220570 | 3300025917 | Bacteria | 1488 |
| 335 | Ga0207660_10345555 | 3300025917 | Bacteria | 1192 |
| 336 | Ga0207660_10501780 | 3300025917 | Unclassified | 984 |
| 337 | Ga0207657_10000160 | 3300025919 | Bacteria | 69252 |
| 338 | Ga0207657_10086192 | 3300025919 | Bacteria | 2629 |
| 339 | Ga0207657_10428516 | 3300025919 | Bacteria | 1039 |
| 340 | Ga0207657_10764853 | 3300025919 | Unclassified | 748 |
| 341 | Ga0207649_10051967 | 3300025920 | Bacteria | 2540 |
| 342 | Ga0207649_10262342 | 3300025920 | Bacteria | 1249 |
| 343 | Ga0207649_10411138 | 3300025920 | Bacteria | 1014 |
| 344 | Ga0207649_10521067 | 3300025920 | Unclassified | 906 |
| 345 | Ga0207652_10036527 | 3300025921 | Bacteria | 4153 |
| 346 | Ga0207652_10136059 | 3300025921 | Bacteria | 2194 |
| 347 | Ga0207681_10002595 | 3300025923 | Bacteria | 11448 |
| 348 | Ga0207681_10109902 | 3300025923 | Unclassified | 2003 |
| 349 | Ga0207681_10189621 | 3300025923 | Bacteria | 1572 |
| 350 | Ga0207694_10144832 | 3300025924 | Bacteria | 1912 |
| 351 | Ga0207694_10211388 | 3300025924 | Unclassified | 1580 |
| 352 | Ga0207694_10776029 | 3300025924 | Bacteria | 809 |
| 353 | Ga0207650_10016678 | 3300025925 | Bacteria | 5135 |
| 354 | Ga0207650_10059256 | 3300025925 | Bacteria | 2853 |
| 355 | Ga0207650_10386277 | 3300025925 | Unclassified | 1157 |
| 356 | Ga0207650_10401915 | 3300025925 | Bacteria | 1134 |
| 357 | Ga0207650_10478083 | 3300025925 | Unclassified | 1039 |
| 358 | Ga0207650_10505370 | 3300025925 | Unclassified | 1010 |
| 359 | Ga0207659_10241241 | 3300025926 | Unclassified | 1462 |
| 360 | Ga0207659_10452027 | 3300025926 | Bacteria | 1082 |
| 361 | Ga0207659_10756398 | 3300025926 | Unclassified | 834 |
| 362 | Ga0207659_11761141 | 3300025926 | Unclassified | 527 |
| 363 | Ga0207687_10512663 | 3300025927 | Bacteria | 1002 |
| 364 | Ga0207700_11291244 | 3300025928 | Bacteria | 650 |
| 365 | Ga0207664_10053693 | 3300025929 | Bacteria | 3191 |
| 366 | Ga0207664_10213063 | 3300025929 | Bacteria | 1672 |
| 367 | Ga0207664_10297747 | 3300025929 | Bacteria | 1419 |
| 368 | Ga0207644_10003913 | 3300025931 | Bacteria | 9660 |
| 369 | Ga0207644_10080502 | 3300025931 | Unclassified | 2406 |
| 370 | Ga0207644_10176282 | 3300025931 | Bacteria | 1673 |
| 371 | Ga0207644_10446830 | 3300025931 | Bacteria | 1062 |
| 372 | Ga0207644_10826260 | 3300025931 | Bacteria | 775 |
| 373 | Ga0207706_11193811 | 3300025933 | Unclassified | 632 |
| 374 | Ga0207686_10018972 | 3300025934 | Bacteria | 3902 |
| 375 | Ga0207670_10343299 | 3300025936 | Unclassified | 1180 |
| 376 | Ga0207670_10392897 | 3300025936 | Unclassified | 1107 |
| 377 | Ga0207669_10015637 | 3300025937 | Bacteria | 3832 |
| 378 | Ga0207669_10049903 | 3300025937 | Bacteria | 2498 |
| 379 | Ga0207669_10630346 | 3300025937 | Bacteria | 875 |
| 380 | Ga0207704_11078606 | 3300025938 | Unclassified | 682 |
| 381 | Ga0207691_10000368 | 3300025940 | Bacteria | 45434 |
| 382 | Ga0207691_10002837 | 3300025940 | Bacteria | 16878 |
| 383 | Ga0207691_10075030 | 3300025940 | Bacteria | 3050 |
| 384 | Ga0207691_10786805 | 3300025940 | Bacteria | 800 |
| 385 | Ga0207691_10959472 | 3300025940 | Bacteria | 714 |
| 386 | Ga0207711_10428898 | 3300025941 | Unclassified | 1230 |
| 387 | Ga0207711_11035971 | 3300025941 | Bacteria | 761 |
| 388 | Ga0207689_10001809 | 3300025942 | Bacteria | 20177 |
| 389 | Ga0207689_10344669 | 3300025942 | Unclassified | 1238 |
| 390 | Ga0207661_10197849 | 3300025944 | Bacteria | 1765 |
| 391 | Ga0207661_11416675 | 3300025944 | Bacteria | 638 |
| 392 | Ga0207679_10128494 | 3300025945 | Unclassified | 2029 |
| 393 | Ga0207679_10260646 | 3300025945 | Bacteria | 1478 |
| 394 | Ga0207679_11591037 | 3300025945 | Bacteria | 599 |
| 395 | Ga0207667_10001999 | 3300025949 | Bacteria | 25585 |
| 396 | Ga0207667_10025368 | 3300025949 | Bacteria | 6488 |
| 397 | Ga0207667_10281114 | 3300025949 | Bacteria | 1701 |
| 398 | Ga0207667_10301974 | 3300025949 | Unclassified | 1636 |
| 399 | Ga0207667_10631838 | 3300025949 | Bacteria | 1077 |
| 400 | Ga0207667_11901319 | 3300025949 | Unclassified | 557 |
| 401 | Ga0207651_10286000 | 3300025960 | Bacteria | 1365 |
| 402 | Ga0207651_12017190 | 3300025960 | Unclassified | 518 |
| 403 | Ga0207712_10051585 | 3300025961 | Unclassified | 2878 |
| 404 | Ga0207668_10001959 | 3300025972 | Bacteria | 12049 |
| 405 | Ga0207668_10055267 | 3300025972 | Bacteria | 2759 |
| 406 | Ga0207668_10426472 | 3300025972 | Bacteria | 1127 |
| 407 | Ga0207668_11008545 | 3300025972 | Bacteria | 744 |
| 408 | Ga0207640_10331775 | 3300025981 | Unclassified | 1215 |
| 409 | Ga0207640_10549413 | 3300025981 | Bacteria | 970 |
| 410 | Ga0207640_10846921 | 3300025981 | Unclassified | 795 |
| 411 | Ga0207658_10019724 | 3300025986 | Bacteria | 4663 |
| 412 | Ga0207658_10230020 | 3300025986 | Bacteria | 1565 |
| 413 | Ga0207658_10640273 | 3300025986 | Unclassified | 958 |
| 414 | Ga0207677_10145037 | 3300026023 | Unclassified | 1823 |
| 415 | Ga0207677_10160316 | 3300026023 | Unclassified | 1747 |
| 416 | Ga0207677_10190310 | 3300026023 | Bacteria | 1622 |
| 417 | Ga0207677_10647757 | 3300026023 | Unclassified | 932 |
| 418 | Ga0207677_11338168 | 3300026023 | Bacteria | 658 |
| 419 | Ga0207703_10009047 | 3300026035 | Bacteria | 7844 |
| 420 | Ga0207703_10157782 | 3300026035 | Unclassified | 1985 |
| 421 | Ga0207703_10553498 | 3300026035 | Bacteria | 1085 |
| 422 | Ga0207703_10629642 | 3300026035 | Unclassified | 1016 |
| 423 | Ga0207703_11182983 | 3300026035 | Bacteria | 735 |
| 424 | Ga0207703_11888989 | 3300026035 | Unclassified | 573 |
| 425 | Ga0207639_10038616 | 3300026041 | Bacteria | 3552 |
| 426 | Ga0207639_10246026 | 3300026041 | Bacteria | 1557 |
| 427 | Ga0207639_10285339 | 3300026041 | Bacteria | 1453 |
| 428 | Ga0207678_10000797 | 3300026067 | Bacteria | 28895 |
| 429 | Ga0207678_10061500 | 3300026067 | Bacteria | 3230 |
| 430 | Ga0207678_10343877 | 3300026067 | Unclassified | 1286 |
| 431 | Ga0207708_10021861 | 3300026075 | Bacteria | 4827 |
| 432 | Ga0207708_10401935 | 3300026075 | Unclassified | 1133 |
| 433 | Ga0207702_10024608 | 3300026078 | Unclassified | 4997 |
| 434 | Ga0207702_10224100 | 3300026078 | Bacteria | 1753 |
| 435 | Ga0207641_10000735 | 3300026088 | Bacteria | 35180 |
| 436 | Ga0207641_10014305 | 3300026088 | Bacteria | 6501 |
| 437 | Ga0207641_10087438 | 3300026088 | Bacteria | 2719 |
| 438 | Ga0207641_10217122 | 3300026088 | Bacteria | 1771 |
| 439 | Ga0207641_10680208 | 3300026088 | Unclassified | 1012 |
| 440 | Ga0207641_11628651 | 3300026088 | Bacteria | 647 |
| 441 | Ga0207648_10000089 | 3300026089 | Bacteria | 86359 |
| 442 | Ga0207676_10033385 | 3300026095 | Bacteria | 3887 |
| 443 | Ga0207676_10121944 | 3300026095 | Bacteria | 2200 |
| 444 | Ga0207676_10122666 | 3300026095 | Unclassified | 2194 |
| 445 | Ga0207676_10198383 | 3300026095 | Unclassified | 1771 |
| 446 | Ga0207676_10221732 | 3300026095 | Bacteria | 1684 |
| 447 | Ga0207676_10792625 | 3300026095 | Bacteria | 924 |
| 448 | Ga0207676_11635064 | 3300026095 | Unclassified | 642 |
| 449 | Ga0207674_10000236 | 3300026116 | Bacteria | 68955 |
| 450 | Ga0207674_11260379 | 3300026116 | Bacteria | 709 |
| 451 | Ga0207675_100018267 | 3300026118 | Bacteria | 6538 |
| 452 | Ga0207675_100027845 | 3300026118 | Bacteria | 5265 |
| 453 | Ga0207675_100132150 | 3300026118 | Bacteria | 2367 |
| 454 | Ga0207683_10103612 | 3300026121 | Bacteria | 2542 |
| 455 | Ga0207683_10590606 | 3300026121 | Unclassified | 1027 |
| 456 | Ga0207698_10015841 | 3300026142 | Bacteria | 5065 |
| 457 | Ga0207428_10000081 | 3300027907 | Bacteria | 136049 |
| 458 | Ga0207428_10042174 | 3300027907 | Bacteria | 3690 |
| 459 | Ga0207428_10161613 | 3300027907 | Bacteria | 1700 |
| 460 | Ga0207428_10162704 | 3300027907 | Bacteria | 1694 |
| 461 | Ga0268266_10010137 | 3300028379 | Bacteria | 8259 |
| 462 | Ga0268266_10244487 | 3300028379 | Bacteria | 1657 |
| 463 | Ga0268266_10400374 | 3300028379 | Bacteria | 1298 |
| 464 | Ga0268266_11268289 | 3300028379 | Bacteria | 712 |
| 465 | Ga0268265_10017818 | 3300028380 | Bacteria | 4910 |
| 466 | Ga0268265_10056120 | 3300028380 | Unclassified | 2995 |
| 467 | Ga0268264_10755686 | 3300028381 | Bacteria | 969 |
| 468 | Ga0265330_10000580 | 3300031235 | Bacteria | 23800 |
| 469 | Ga0265332_10000141 | 3300031238 | Bacteria | 59136 |
| 470 | Ga0265325_10020311 | 3300031241 | Bacteria | 3662 |
| 471 | Ga0265329_10001151 | 3300031242 | Bacteria | 13007 |
| 472 | Ga0265339_10025885 | 3300031249 | Bacteria | 3363 |
| 473 | Ga0265331_10000298 | 3300031250 | Bacteria | 54129 |
| 474 | Ga0265327_10003686 | 3300031251 | Bacteria | 14323 |
| 475 | Ga0265316_10072482 | 3300031344 | Bacteria | 2653 |
| 476 | Ga0265314_10003464 | 3300031711 | Bacteria | 15244 |
| 477 | Ga0265342_10004733 | 3300031712 | Bacteria | 10597 |
| 478 | Ga0307405_11742641 | 3300031731 | Unclassified | 553 |
| 479 | Ga0307413_10082415 | 3300031824 | Bacteria | 2066 |
| 480 | Ga0307410_10193153 | 3300031852 | Bacteria | 1549 |
| 481 | Ga0307406_10142484 | 3300031901 | Bacteria | 1699 |
| 482 | Ga0307407_10030810 | 3300031903 | Bacteria | 2898 |
| 483 | Ga0307409_100069665 | 3300031995 | Bacteria | 2788 |
| 484 | Ga0307416_100512613 | 3300032002 | Bacteria | 1266 |
| 485 | Ga0307416_102702324 | 3300032002 | Bacteria | 593 |
| 486 | Ga0307411_10004870 | 3300032005 | Bacteria | 6520 |
| 487 | Ga0373948_0044856 | 3300034817 | Bacteria | 935 |
| 488 | Ga0373950_0020873 | 3300034818 | Bacteria | 1155 |
| 489 | Ga0373938_0153734 | 3300034957 | Unclassified | 614 |
| 490 | Ga0373928_0017588 | 3300035084 | Bacteria | 1472 |
| 491 | Ga0373928_0040905 | 3300035084 | Unclassified | 1064 |
| 492 | Ga0373940_0010193 | 3300035088 | Bacteria | 2204 |
| 493 | Ga0373940_0084642 | 3300035088 | Unclassified | 942 |
| 494 | Ga0373940_0177261 | 3300035088 | Bacteria | 691 |
| 495 | Ga0373949_0072103 | 3300035090 | Unclassified | 906 |
| 496 | Ga0373952_0129598 | 3300035092 | Unclassified | 691 |
| 497 | Ga0373952_0209764 | 3300035092 | Bacteria | 574 |
| 498 | Ga0373923_0435081 | 3300035111 | Bacteria | 635 |
| 499 | Ga0373923_0526608 | 3300035111 | Bacteria | 578 |
| 500 | Ga0373932_0120971 | 3300035112 | Bacteria | 873 |
| 501 | Ga0373932_0161951 | 3300035112 | Bacteria | 774 |
| 502 | Ga0373936_0415734 | 3300035113 | Unclassified | 619 |
| 503 | Ga0373939_0044847 | 3300035114 | Bacteria | 1347 |
| 504 | Ga0373945_0329387 | 3300035116 | Bacteria | 659 |
| 505 | Ga0373954_0109349 | 3300035118 | Bacteria | 1337 |
| 506 | Ga0373956_0228119 | 3300035119 | Bacteria | 884 |
| 507 | Ga0373946_0300691 | 3300035171 | Unclassified | 793 |
| 508 | Ga0373955_0666352 | 3300035172 | Bacteria | 638 |
| 509 | Ga0373955_0679034 | 3300035172 | Unclassified | 632 |
| 510 | Ga0373942_0007862 | 3300035207 | Bacteria | 2478 |
| 511 | Ga0373942_0088880 | 3300035207 | Unclassified | 928 |
| 512 | Ga0373961_0013564 | 3300035241 | Bacteria | 2057 |
| 513 | Ga0373962_0198216 | 3300035242 | Bacteria | 678 |
| 514 | Ga0373962_0384434 | 3300035242 | Unclassified | 513 |
| 515 | Ga0316574_0002686 | 3300035398 | Bacteria | 8988 |
| 516 | Ga0373924_0350575 | 3300035410 | Unclassified | 658 |
| 517 | Ga0373924_0477288 | 3300035410 | Bacteria | 560 |
| 518 | Ga0373931_0002223 | 3300035691 | Bacteria | 8573 |
| 519 | Ga0373931_0033622 | 3300035691 | Bacteria | 2658 |
| 520 | Ga0373931_0065223 | 3300035691 | Bacteria | 1973 |
| 521 | Ga0373931_0529800 | 3300035691 | Bacteria | 763 |
| 522 | Ga0373927_0085772 | 3300035695 | Bacteria | 2044 |
| 523 | Ga0373927_0222428 | 3300035695 | Bacteria | 1240 |
| 524 | Ga0373927_0541238 | 3300035695 | Bacteria | 770 |
| 525 | Ga0373937_0136714 | 3300036401 | Bacteria | 2292 |
| 526 | Ga0373937_0228903 | 3300036401 | Bacteria | 1750 |
| 527 | Ga0373937_0560659 | 3300036401 | Bacteria | 1085 |
| 528 | Ga0373937_1909064 | 3300036401 | Bacteria | 540 |
| 529 | Ga0373925_0458322 | 3300037068 | Bacteria | 1045 |
| 530 | Ga0373925_0513597 | 3300037068 | Bacteria | 984 |
| 531 | Ga0395900_0327314 | 3300037418 | Unclassified | 1511 |
| 532 | Ga0395905_0049771 | 3300037471 | Bacteria | 3928 |
| 533 | Ga0466963_0053523 | 3300044694 | Bacteria | 2680 |
| 534 | Ga0453684_0795825 | 3300044712 | Unclassified | 1020 |
| 535 | Ga0466967_0789352 | 3300045976 | Unclassified | 943 |
| 536 | Ga0466967_0978058 | 3300045976 | Bacteria | 842 |
| 537 | Ga0495629_0609603 | 3300046459 | Bacteria | 730 |
| 538 | Ga0495580_0749333 | 3300046472 | Unclassified | 636 |
| 539 | Ga0495584_0360119 | 3300046491 | Unclassified | 739 |
| 540 | Ga0495630_0507527 | 3300046517 | Bacteria | 925 |
| 541 | Ga0495637_0173211 | 3300046520 | Unclassified | 804 |
| 542 | Ga0495656_0426786 | 3300046615 | Unclassified | 696 |
| 543 | Ga0495635_0499446 | 3300046663 | Unclassified | 801 |
| 544 | Ga0495635_0663622 | 3300046663 | Bacteria | 678 |
| 545 | Ga0495657_0079165 | 3300046675 | Bacteria | 2129 |
| 546 | Ga0495647_0455161 | 3300046681 | Unclassified | 593 |
| 547 | Ga0495658_0736028 | 3300046683 | Unclassified | 632 |
| 548 | Ga0496104_1196640 | 3300048907 | Bacteria | 663 |
| 549 | Ga0496106_0193552 | 3300048909 | Bacteria | 1617 |
| 550 | Ga0496109_0240565 | 3300048912 | Bacteria | 1704 |
| 551 | Ga0496109_0537474 | 3300048912 | Unclassified | 1103 |
| 552 | Ga0496109_0703462 | 3300048912 | Bacteria | 948 |
| 553 | Ga0496111_0218254 | 3300048914 | Unclassified | 1417 |
| 554 | Ga0496111_0452866 | 3300048914 | Bacteria | 947 |
| 555 | Ga0496112_0000843 | 3300048915 | Bacteria | 21885 |
| 556 | Ga0496112_0890253 | 3300048915 | Unclassified | 812 |
| 557 | Ga0496113_0112719 | 3300048916 | Unclassified | 2119 |
| 558 | Ga0496113_0235467 | 3300048916 | Bacteria | 1461 |
| 559 | Ga0496114_0231958 | 3300048917 | Bacteria | 1622 |
| 560 | Ga0496114_0684005 | 3300048917 | Bacteria | 901 |
| 561 | Ga0501031_0287857 | 3300049568 | Bacteria | 1065 |
| 562 | Ga0501031_0487216 | 3300049568 | Bacteria | 796 |
| 563 | Ga0501031_0643872 | 3300049568 | Bacteria | 681 |
| 564 | Ga0501032_0003557 | 3300049569 | Bacteria | 11879 |
| 565 | Ga0501032_0013432 | 3300049569 | Bacteria | 5824 |
| 566 | Ga0501034_0087101 | 3300049571 | Bacteria | 3123 |
| 567 | Ga0501034_1046964 | 3300049571 | Bacteria | 698 |
| 568 | Ga0501038_0001368 | 3300049574 | Bacteria | 22255 |
| 569 | Ga0501038_0205272 | 3300049574 | Bacteria | 1579 |
| 570 | Ga0501039_0142075 | 3300049575 | Bacteria | 1885 |
| 571 | Ga0501043_0557901 | 3300049579 | Bacteria | 850 |
| 572 | Ga0501047_0022207 | 3300049581 | Bacteria | 6097 |
| 573 | Ga0501067_0030060 | 3300049583 | Bacteria | 3012 |
| 574 | Ga0501068_0323233 | 3300049584 | Bacteria | 989 |
| 575 | Ga0501070_0000738 | 3300049586 | Bacteria | 29944 |
| 576 | Ga0501072_0099590 | 3300049588 | Bacteria | 2310 |
| 577 | Ga0501073_0003208 | 3300049589 | Bacteria | 12278 |
| 578 | Ga0501074_0061141 | 3300049590 | Bacteria | 2714 |
| 579 | Ga0501076_0749725 | 3300049592 | Bacteria | 806 |
| 580 | Ga0501079_0147856 | 3300049741 | Bacteria | 1831 |
| 581 | Ga0501080_0011550 | 3300049742 | Bacteria | 8087 |
| 582 | Ga0501080_0124653 | 3300049742 | Bacteria | 2386 |
| 583 | Ga0501083_0051750 | 3300049744 | Bacteria | 2761 |
| 584 | Ga0501035_0042645 | 3300049822 | Bacteria | 4092 |
| 585 | Ga0501035_0275203 | 3300049822 | Bacteria | 1424 |
| 586 | Ga0501035_0458931 | 3300049822 | Bacteria | 1053 |
| 587 | Ga0501035_0693068 | 3300049822 | Bacteria | 822 |
| 588 | Ga0501044_1088660 | 3300049823 | Bacteria | 669 |
| 589 | nmdc:mga05p37_212802_c1 | 3300050507 | Bacteria | 2336 |
| 590 | nmdc:mga05p37_23855_c1 | 3300050507 | Bacteria | 7429 |
| 591 | nmdc:mga05p37_53721_c1 | 3300050507 | Bacteria | 4955 |
| 592 | nmdc:mga05p37_712167_c1 | 3300050507 | Bacteria | 1113 |
| 593 | nmdc:mga09592_1332616_c1 | 3300050508 | Unclassified | 589 |
| 594 | nmdc:mga0qj67_704542_c1 | 3300050509 | Unclassified | 803 |
| 595 | nmdc:mga06r32_110079_c1 | 3300050510 | Bacteria | 2709 |
| 596 | nmdc:mga06r32_1120282_c1 | 3300050510 | Bacteria | 735 |
| 597 | nmdc:mga06r32_1404303_c1 | 3300050510 | Bacteria | 640 |
| 598 | nmdc:mga06r32_278091_c1 | 3300050510 | Bacteria | 1661 |
| 599 | nmdc:mga06r32_90299_c1 | 3300050510 | Bacteria | 2992 |
| 600 | nmdc:mga08y16_229081_c1 | 3300050511 | Bacteria | 1922 |
| 601 | nmdc:mga08y16_31_c1 | 3300050511 | Bacteria | 195124 |
| 602 | nmdc:mga08y16_666496_c1 | 3300050511 | Unclassified | 1043 |
| 603 | nmdc:mga08y16_74519_c1 | 3300050511 | Bacteria | 3537 |
| 604 | nmdc:mga0n895_2090713_c1 | 3300050512 | Unclassified | 523 |
| 605 | nmdc:mga0n895_4648_c1 | 3300050512 | Bacteria | 11325 |
| 606 | nmdc:mga0rr50_9393_c1 | 3300050513 | Bacteria | 6144 |
| 607 | nmdc:mga0a205_1085114_c1 | 3300050515 | Unclassified | 648 |
| 608 | nmdc:mga0a205_249639_c1 | 3300050515 | Bacteria | 1654 |
| 609 | nmdc:mga0a205_58448_c1 | 3300050515 | Bacteria | 3725 |
| 610 | Ga0495595_0072245 | 3300053084 | Bacteria | 1632 |
| 611 | Ga0495619_0352685 | 3300053085 | Bacteria | 1018 |
| 612 | Ga0495619_0985415 | 3300053085 | Bacteria | 564 |
| 613 | Ga0501084_0107241 | 3300054114 | Bacteria | 2347 |
| 614 | Ga0590077_009215 | 3300059426 | Bacteria | 2022 |
| 615 | Ga0501082_0174134 | 3300060353 | Bacteria | 1871 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300009093 | Ga0105240_10017559 | Ga0105240_100175594 | 119 |
| 2 | 3300009174 | Ga0105241_10012204 | Ga0105241_100122044 | 119 |
| 3 | 3300009551 | Ga0105238_10019514 | Ga0105238_100195142 | 119 |
| 4 | 3300010375 | Ga0105239_10061727 | Ga0105239_100617273 | 119 |
| 5 | 3300013100 | Ga0157373_10002549 | Ga0157373_1000254912 | 119 |
| 6 | 3300013104 | Ga0157370_10192997 | Ga0157370_101929973 | 119 |
| 7 | 3300013105 | Ga0157369_10762026 | Ga0157369_107620262 | 119 |
| 8 | 3300035113 | Ga0373936_0415734 | Ga0373936_0415734_245_607 | 119 |
| 9 | 3300035171 | Ga0373946_0300691 | Ga0373946_0300691_278_640 | 119 |
| 10 | 3300035172 | Ga0373955_0679034 | Ga0373955_0679034_59_421 | 119 |
| 11 | 3300035410 | Ga0373924_0350575 | Ga0373924_0350575_142_504 | 119 |
| 12 | 3300035410 | Ga0373924_0477288 | Ga0373924_0477288_153_515 | 119 |
| 13 | 3300035695 | Ga0373927_0222428 | Ga0373927_0222428_17_379 | 119 |
| 14 | 3300037418 | Ga0395900_0327314 | Ga0395900_0327314_490_888 | 119 |
| 15 | 3300046472 | Ga0495580_0749333 | Ga0495580_0749333_142_504 | 119 |
| 16 | 3300046681 | Ga0495647_0455161 | Ga0495647_0455161_59_421 | 119 |
| 17 | 3300048916 | Ga0496113_0235467 | Ga0496113_0235467_699_1097 | 119 |
| 18 | 3300050512 | nmdc:mga0n895_2090713_c1 | nmdc:mga0n895_2090713_c1_44_406 | 119 |
| 19 | 3300005438 | Ga0070701_10078614 | Ga0070701_100786144 | 120 |
| 20 | 3300006195 | Ga0075366_10062748 | Ga0075366_100627483 | 120 |
| 21 | 3300009011 | Ga0105251_10117670 | Ga0105251_101176702 | 121 |
| 22 | 3300009174 | Ga0105241_10474295 | Ga0105241_104742952 | 121 |
| 23 | 3300009176 | Ga0105242_10068067 | Ga0105242_100680673 | 121 |
| 24 | 3300009553 | Ga0105249_10017355 | Ga0105249_100173552 | 121 |
| 25 | 3300013297 | Ga0157378_10032366 | Ga0157378_100323663 | 121 |
| 26 | 3300013308 | Ga0157375_11008296 | Ga0157375_110082962 | 121 |
| 27 | 3300014325 | Ga0163163_10024385 | Ga0163163_100243853 | 121 |
| 28 | 3300014326 | Ga0157380_10045652 | Ga0157380_100456524 | 121 |
| 29 | 3300014968 | Ga0157379_10160855 | Ga0157379_101608551 | 121 |
| 30 | 3300014969 | Ga0157376_12933235 | Ga0157376_129332351 | 121 |
| 31 | 3300048912 | Ga0496109_0537474 | Ga0496109_0537474_677_1051 | 121 |
| 32 | 3300046663 | Ga0495635_0663622 | Ga0495635_0663622_14_394 | 122 |
| 33 | 3300005327 | Ga0070658_10228101 | Ga0070658_102281011 | 123 |
| 34 | 3300005329 | Ga0070683_100606557 | Ga0070683_1006065572 | 123 |
| 35 | 3300005330 | Ga0070690_101766116 | Ga0070690_1017661161 | 123 |
| 36 | 3300005333 | Ga0070677_10226025 | Ga0070677_102260252 | 123 |
| 37 | 3300005345 | Ga0070692_10934002 | Ga0070692_109340022 | 123 |
| 38 | 3300005355 | Ga0070671_101278973 | Ga0070671_1012789731 | 123 |
| 39 | 3300005355 | Ga0070671_101948687 | Ga0070671_1019486871 | 123 |
| 40 | 3300005367 | Ga0070667_100246002 | Ga0070667_1002460022 | 123 |
| 41 | 3300005539 | Ga0068853_100522057 | Ga0068853_1005220572 | 123 |
| 42 | 3300005543 | Ga0070672_101122800 | Ga0070672_1011228002 | 123 |
| 43 | 3300005548 | Ga0070665_101576840 | Ga0070665_1015768402 | 123 |
| 44 | 3300005564 | Ga0070664_101850624 | Ga0070664_1018506242 | 123 |
| 45 | 3300005614 | Ga0068856_102017300 | Ga0068856_1020173001 | 123 |
| 46 | 3300005616 | Ga0068852_102837392 | Ga0068852_1028373921 | 123 |
| 47 | 3300005617 | Ga0068859_102188805 | Ga0068859_1021888052 | 123 |
| 48 | 3300005618 | Ga0068864_101821933 | Ga0068864_1018219332 | 123 |
| 49 | 3300005834 | Ga0068851_10549360 | Ga0068851_105493602 | 123 |
| 50 | 3300006931 | Ga0097620_102189228 | Ga0097620_1021892282 | 123 |
| 51 | 3300013104 | Ga0157370_10550113 | Ga0157370_105501132 | 123 |
| 52 | 3300025919 | Ga0207657_10764853 | Ga0207657_107648531 | 123 |
| 53 | 3300025920 | Ga0207649_10521067 | Ga0207649_105210672 | 123 |
| 54 | 3300025925 | Ga0207650_10401915 | Ga0207650_104019152 | 123 |
| 55 | 3300025931 | Ga0207644_10176282 | Ga0207644_101762822 | 123 |
| 56 | 3300025940 | Ga0207691_10786805 | Ga0207691_107868052 | 123 |
| 57 | 3300025941 | Ga0207711_11035971 | Ga0207711_110359712 | 123 |
| 58 | 3300025960 | Ga0207651_10286000 | Ga0207651_102860002 | 123 |
| 59 | 3300025986 | Ga0207658_10640273 | Ga0207658_106402732 | 123 |
| 60 | 3300026023 | Ga0207677_10647757 | Ga0207677_106477572 | 123 |
| 61 | 3300026067 | Ga0207678_10061500 | Ga0207678_100615002 | 123 |
| 62 | 3300026095 | Ga0207676_10792625 | Ga0207676_107926251 | 123 |
| 63 | 3300049568 | Ga0501031_0487216 | Ga0501031_0487216_91_465 | 123 |
| 64 | 3300005327 | Ga0070658_10131831 | Ga0070658_101318312 | 124 |
| 65 | 3300005327 | Ga0070658_10184180 | Ga0070658_101841802 | 124 |
| 66 | 3300005329 | Ga0070683_100030094 | Ga0070683_1000300943 | 124 |
| 67 | 3300005329 | Ga0070683_100109442 | Ga0070683_1001094423 | 124 |
| 68 | 3300005329 | Ga0070683_100916236 | Ga0070683_1009162361 | 124 |
| 69 | 3300005331 | Ga0070670_100016039 | Ga0070670_1000160393 | 124 |
| 70 | 3300005331 | Ga0070670_100017719 | Ga0070670_1000177193 | 124 |
| 71 | 3300005331 | Ga0070670_100533647 | Ga0070670_1005336471 | 124 |
| 72 | 3300005336 | Ga0070680_100171575 | Ga0070680_1001715752 | 124 |
| 73 | 3300005336 | Ga0070680_100560931 | Ga0070680_1005609312 | 124 |
| 74 | 3300005336 | Ga0070680_100798877 | Ga0070680_1007988771 | 124 |
| 75 | 3300005336 | Ga0070680_101415430 | Ga0070680_1014154301 | 124 |
| 76 | 3300005337 | Ga0070682_100006581 | Ga0070682_1000065816 | 124 |
| 77 | 3300005338 | Ga0068868_100575467 | Ga0068868_1005754672 | 124 |
| 78 | 3300005338 | Ga0068868_101604875 | Ga0068868_1016048752 | 124 |
| 79 | 3300005339 | Ga0070660_100074822 | Ga0070660_1000748223 | 124 |
| 80 | 3300005339 | Ga0070660_100083449 | Ga0070660_1000834492 | 124 |
| 81 | 3300005339 | Ga0070660_100116430 | Ga0070660_1001164303 | 124 |
| 82 | 3300005339 | Ga0070660_100751133 | Ga0070660_1007511332 | 124 |
| 83 | 3300005344 | Ga0070661_100004383 | Ga0070661_1000043832 | 124 |
| 84 | 3300005344 | Ga0070661_100059040 | Ga0070661_1000590404 | 124 |
| 85 | 3300005344 | Ga0070661_100095951 | Ga0070661_1000959513 | 124 |
| 86 | 3300005344 | Ga0070661_100808476 | Ga0070661_1008084762 | 124 |
| 87 | 3300005345 | Ga0070692_10024547 | Ga0070692_100245473 | 124 |
| 88 | 3300005356 | Ga0070674_100216515 | Ga0070674_1002165152 | 124 |
| 89 | 3300005366 | Ga0070659_100005229 | Ga0070659_1000052295 | 124 |
| 90 | 3300005366 | Ga0070659_100252463 | Ga0070659_1002524632 | 124 |
| 91 | 3300005366 | Ga0070659_101784936 | Ga0070659_1017849361 | 124 |
| 92 | 3300005434 | Ga0070709_10114820 | Ga0070709_101148202 | 124 |
| 93 | 3300005434 | Ga0070709_10218638 | Ga0070709_102186382 | 124 |
| 94 | 3300005435 | Ga0070714_100009546 | Ga0070714_1000095464 | 124 |
| 95 | 3300005435 | Ga0070714_100016715 | Ga0070714_1000167155 | 124 |
| 96 | 3300005435 | Ga0070714_100557635 | Ga0070714_1005576352 | 124 |
| 97 | 3300005436 | Ga0070713_101225203 | Ga0070713_1012252032 | 124 |
| 98 | 3300005437 | Ga0070710_10059970 | Ga0070710_100599701 | 124 |
| 99 | 3300005439 | Ga0070711_100061572 | Ga0070711_1000615723 | 124 |
| 100 | 3300005455 | Ga0070663_100013346 | Ga0070663_1000133464 | 124 |
| 101 | 3300005455 | Ga0070663_100064699 | Ga0070663_1000646992 | 124 |
| 102 | 3300005456 | Ga0070678_100738170 | Ga0070678_1007381702 | 124 |
| 103 | 3300005457 | Ga0070662_100212177 | Ga0070662_1002121772 | 124 |
| 104 | 3300005457 | Ga0070662_101379886 | Ga0070662_1013798861 | 124 |
| 105 | 3300005458 | Ga0070681_10002557 | Ga0070681_1000255710 | 124 |
| 106 | 3300005458 | Ga0070681_10017663 | Ga0070681_100176638 | 124 |
| 107 | 3300005458 | Ga0070681_10251868 | Ga0070681_102518682 | 124 |
| 108 | 3300005458 | Ga0070681_11332216 | Ga0070681_113322162 | 124 |
| 109 | 3300005471 | Ga0070698_100025599 | Ga0070698_1000255992 | 124 |
| 110 | 3300005518 | Ga0070699_100099661 | Ga0070699_1000996612 | 124 |
| 111 | 3300005518 | Ga0070699_101707736 | Ga0070699_1017077362 | 124 |
| 112 | 3300005530 | Ga0070679_100138861 | Ga0070679_1001388613 | 124 |
| 113 | 3300005530 | Ga0070679_100450072 | Ga0070679_1004500722 | 124 |
| 114 | 3300005530 | Ga0070679_100989860 | Ga0070679_1009898602 | 124 |
| 115 | 3300005535 | Ga0070684_100003238 | Ga0070684_1000032382 | 124 |
| 116 | 3300005539 | Ga0068853_100004451 | Ga0068853_1000044512 | 124 |
| 117 | 3300005546 | Ga0070696_100012892 | Ga0070696_1000128921 | 124 |
| 118 | 3300005547 | Ga0070693_100112322 | Ga0070693_1001123222 | 124 |
| 119 | 3300005547 | Ga0070693_100297914 | Ga0070693_1002979142 | 124 |
| 120 | 3300005548 | Ga0070665_100918815 | Ga0070665_1009188152 | 124 |
| 121 | 3300005563 | Ga0068855_100007207 | Ga0068855_1000072077 | 124 |
| 122 | 3300005563 | Ga0068855_100262575 | Ga0068855_1002625753 | 124 |
| 123 | 3300005563 | Ga0068855_100827129 | Ga0068855_1008271291 | 124 |
| 124 | 3300005563 | Ga0068855_101461795 | Ga0068855_1014617952 | 124 |
| 125 | 3300005564 | Ga0070664_100014442 | Ga0070664_1000144425 | 124 |
| 126 | 3300005564 | Ga0070664_100063712 | Ga0070664_1000637124 | 124 |
| 127 | 3300005564 | Ga0070664_100127526 | Ga0070664_1001275264 | 124 |
| 128 | 3300005577 | Ga0068857_100037437 | Ga0068857_1000374374 | 124 |
| 129 | 3300005578 | Ga0068854_100024769 | Ga0068854_1000247692 | 124 |
| 130 | 3300005578 | Ga0068854_100293111 | Ga0068854_1002931112 | 124 |
| 131 | 3300005614 | Ga0068856_100003385 | Ga0068856_10000338511 | 124 |
| 132 | 3300005614 | Ga0068856_100006230 | Ga0068856_1000062306 | 124 |
| 133 | 3300005614 | Ga0068856_100029868 | Ga0068856_1000298684 | 124 |
| 134 | 3300005614 | Ga0068856_100780751 | Ga0068856_1007807512 | 124 |
| 135 | 3300005616 | Ga0068852_100075176 | Ga0068852_1000751763 | 124 |
| 136 | 3300005616 | Ga0068852_100134074 | Ga0068852_1001340742 | 124 |
| 137 | 3300005618 | Ga0068864_102364233 | Ga0068864_1023642332 | 124 |
| 138 | 3300005834 | Ga0068851_10000457 | Ga0068851_1000045715 | 124 |
| 139 | 3300005840 | Ga0068870_10109265 | Ga0068870_101092651 | 124 |
| 140 | 3300005841 | Ga0068863_100229248 | Ga0068863_1002292482 | 124 |
| 141 | 3300006028 | Ga0070717_11778426 | Ga0070717_117784262 | 124 |
| 142 | 3300006175 | Ga0070712_100563221 | Ga0070712_1005632212 | 124 |
| 143 | 3300006237 | Ga0097621_100284598 | Ga0097621_1002845982 | 124 |
| 144 | 3300006358 | Ga0068871_100327750 | Ga0068871_1003277502 | 124 |
| 145 | 3300006358 | Ga0068871_100456398 | Ga0068871_1004563982 | 124 |
| 146 | 3300006914 | Ga0075436_100614805 | Ga0075436_1006148052 | 124 |
| 147 | 3300009093 | Ga0105240_10012034 | Ga0105240_1001203410 | 124 |
| 148 | 3300009093 | Ga0105240_10517782 | Ga0105240_105177822 | 124 |
| 149 | 3300009093 | Ga0105240_11029126 | Ga0105240_110291262 | 124 |
| 150 | 3300009147 | Ga0114129_11530696 | Ga0114129_115306962 | 124 |
| 151 | 3300009551 | Ga0105238_11622146 | Ga0105238_116221462 | 124 |
| 152 | 3300013104 | Ga0157370_10043896 | Ga0157370_100438965 | 124 |
| 153 | 3300013104 | Ga0157370_10096451 | Ga0157370_100964512 | 124 |
| 154 | 3300013104 | Ga0157370_10134545 | Ga0157370_101345454 | 124 |
| 155 | 3300013105 | Ga0157369_10002831 | Ga0157369_100028315 | 124 |
| 156 | 3300013105 | Ga0157369_10298023 | Ga0157369_102980232 | 124 |
| 157 | 3300013105 | Ga0157369_10697660 | Ga0157369_106976602 | 124 |
| 158 | 3300013105 | Ga0157369_11871603 | Ga0157369_118716032 | 124 |
| 159 | 3300013296 | Ga0157374_10190184 | Ga0157374_101901843 | 124 |
| 160 | 3300013307 | Ga0157372_10016270 | Ga0157372_100162704 | 124 |
| 161 | 3300013307 | Ga0157372_10193129 | Ga0157372_101931293 | 124 |
| 162 | 3300013307 | Ga0157372_10204539 | Ga0157372_102045393 | 124 |
| 163 | 3300013307 | Ga0157372_10222084 | Ga0157372_102220844 | 124 |
| 164 | 3300014325 | Ga0163163_11399267 | Ga0163163_113992672 | 124 |
| 165 | 3300017792 | Ga0163161_10012763 | Ga0163161_100127632 | 124 |
| 166 | 3300020069 | Ga0197907_10211369 | Ga0197907_102113692 | 124 |
| 167 | 3300020081 | Ga0206354_10160873 | Ga0206354_101608732 | 124 |
| 168 | 3300020082 | Ga0206353_10584646 | Ga0206353_105846462 | 124 |
| 169 | 3300020082 | Ga0206353_11840695 | Ga0206353_118406954 | 124 |
| 170 | 3300025321 | Ga0207656_10002389 | Ga0207656_100023893 | 124 |
| 171 | 3300025321 | Ga0207656_10003117 | Ga0207656_100031173 | 124 |
| 172 | 3300025893 | Ga0207682_10154474 | Ga0207682_101544742 | 124 |
| 173 | 3300025898 | Ga0207692_10146712 | Ga0207692_101467122 | 124 |
| 174 | 3300025903 | Ga0207680_10500692 | Ga0207680_105006922 | 124 |
| 175 | 3300025906 | Ga0207699_10107838 | Ga0207699_101078382 | 124 |
| 176 | 3300025908 | Ga0207643_10021345 | Ga0207643_100213455 | 124 |
| 177 | 3300025909 | Ga0207705_10320220 | Ga0207705_103202202 | 124 |
| 178 | 3300025909 | Ga0207705_10658968 | Ga0207705_106589682 | 124 |
| 179 | 3300025909 | Ga0207705_10754153 | Ga0207705_107541532 | 124 |
| 180 | 3300025911 | Ga0207654_10108462 | Ga0207654_101084622 | 124 |
| 181 | 3300025912 | Ga0207707_10041401 | Ga0207707_100414015 | 124 |
| 182 | 3300025912 | Ga0207707_10098180 | Ga0207707_100981803 | 124 |
| 183 | 3300025912 | Ga0207707_10101262 | Ga0207707_101012623 | 124 |
| 184 | 3300025912 | Ga0207707_10331402 | Ga0207707_103314022 | 124 |
| 185 | 3300025913 | Ga0207695_10004525 | Ga0207695_1000452518 | 124 |
| 186 | 3300025913 | Ga0207695_10029883 | Ga0207695_100298835 | 124 |
| 187 | 3300025913 | Ga0207695_10810506 | Ga0207695_108105061 | 124 |
| 188 | 3300025916 | Ga0207663_10358236 | Ga0207663_103582362 | 124 |
| 189 | 3300025917 | Ga0207660_10031547 | Ga0207660_100315472 | 124 |
| 190 | 3300025917 | Ga0207660_10220570 | Ga0207660_102205703 | 124 |
| 191 | 3300025917 | Ga0207660_10345555 | Ga0207660_103455552 | 124 |
| 192 | 3300025917 | Ga0207660_10501780 | Ga0207660_105017802 | 124 |
| 193 | 3300025919 | Ga0207657_10000160 | Ga0207657_1000016039 | 124 |
| 194 | 3300025919 | Ga0207657_10086192 | Ga0207657_100861923 | 124 |
| 195 | 3300025919 | Ga0207657_10428516 | Ga0207657_104285162 | 124 |
| 196 | 3300025920 | Ga0207649_10051967 | Ga0207649_100519672 | 124 |
| 197 | 3300025920 | Ga0207649_10411138 | Ga0207649_104111382 | 124 |
| 198 | 3300025921 | Ga0207652_10036527 | Ga0207652_100365273 | 124 |
| 199 | 3300025921 | Ga0207652_10136059 | Ga0207652_101360592 | 124 |
| 200 | 3300025923 | Ga0207681_10002595 | Ga0207681_100025952 | 124 |
| 201 | 3300025924 | Ga0207694_10211388 | Ga0207694_102113883 | 124 |
| 202 | 3300025924 | Ga0207694_10776029 | Ga0207694_107760292 | 124 |
| 203 | 3300025925 | Ga0207650_10386277 | Ga0207650_103862772 | 124 |
| 204 | 3300025925 | Ga0207650_10505370 | Ga0207650_105053701 | 124 |
| 205 | 3300025926 | Ga0207659_10756398 | Ga0207659_107563981 | 124 |
| 206 | 3300025927 | Ga0207687_10512663 | Ga0207687_105126632 | 124 |
| 207 | 3300025929 | Ga0207664_10053693 | Ga0207664_100536934 | 124 |
| 208 | 3300025929 | Ga0207664_10213063 | Ga0207664_102130632 | 124 |
| 209 | 3300025929 | Ga0207664_10297747 | Ga0207664_102977473 | 124 |
| 210 | 3300025931 | Ga0207644_10003913 | Ga0207644_100039132 | 124 |
| 211 | 3300025933 | Ga0207706_11193811 | Ga0207706_111938111 | 124 |
| 212 | 3300025936 | Ga0207670_10392897 | Ga0207670_103928971 | 124 |
| 213 | 3300025937 | Ga0207669_10015637 | Ga0207669_100156373 | 124 |
| 214 | 3300025940 | Ga0207691_10000368 | Ga0207691_1000036817 | 124 |
| 215 | 3300025944 | Ga0207661_10197849 | Ga0207661_101978493 | 124 |
| 216 | 3300025944 | Ga0207661_11416675 | Ga0207661_114166751 | 124 |
| 217 | 3300025945 | Ga0207679_10128494 | Ga0207679_101284942 | 124 |
| 218 | 3300025945 | Ga0207679_11591037 | Ga0207679_115910371 | 124 |
| 219 | 3300025949 | Ga0207667_10001999 | Ga0207667_1000199920 | 124 |
| 220 | 3300025949 | Ga0207667_10025368 | Ga0207667_100253684 | 124 |
| 221 | 3300025949 | Ga0207667_10281114 | Ga0207667_102811143 | 124 |
| 222 | 3300025949 | Ga0207667_10301974 | Ga0207667_103019743 | 124 |
| 223 | 3300025949 | Ga0207667_10631838 | Ga0207667_106318382 | 124 |
| 224 | 3300025949 | Ga0207667_11901319 | Ga0207667_119013191 | 124 |
| 225 | 3300025972 | Ga0207668_10001959 | Ga0207668_100019593 | 124 |
| 226 | 3300025981 | Ga0207640_10331775 | Ga0207640_103317752 | 124 |
| 227 | 3300025981 | Ga0207640_10549413 | Ga0207640_105494132 | 124 |
| 228 | 3300025981 | Ga0207640_10846921 | Ga0207640_108469212 | 124 |
| 229 | 3300025986 | Ga0207658_10019724 | Ga0207658_100197243 | 124 |
| 230 | 3300026023 | Ga0207677_10145037 | Ga0207677_101450372 | 124 |
| 231 | 3300026023 | Ga0207677_10190310 | Ga0207677_101903101 | 124 |
| 232 | 3300026023 | Ga0207677_11338168 | Ga0207677_113381682 | 124 |
| 233 | 3300026035 | Ga0207703_10009047 | Ga0207703_100090473 | 124 |
| 234 | 3300026041 | Ga0207639_10038616 | Ga0207639_100386164 | 124 |
| 235 | 3300026067 | Ga0207678_10000797 | Ga0207678_1000079713 | 124 |
| 236 | 3300026067 | Ga0207678_10343877 | Ga0207678_103438772 | 124 |
| 237 | 3300026078 | Ga0207702_10024608 | Ga0207702_100246084 | 124 |
| 238 | 3300026078 | Ga0207702_10224100 | Ga0207702_102241002 | 124 |
| 239 | 3300026088 | Ga0207641_10000735 | Ga0207641_100007355 | 124 |
| 240 | 3300026088 | Ga0207641_11628651 | Ga0207641_116286512 | 124 |
| 241 | 3300026089 | Ga0207648_10000089 | Ga0207648_1000008931 | 124 |
| 242 | 3300026095 | Ga0207676_10221732 | Ga0207676_102217322 | 124 |
| 243 | 3300026095 | Ga0207676_11635064 | Ga0207676_116350642 | 124 |
| 244 | 3300026116 | Ga0207674_10000236 | Ga0207674_1000023623 | 124 |
| 245 | 3300026118 | Ga0207675_100132150 | Ga0207675_1001321503 | 124 |
| 246 | 3300026121 | Ga0207683_10590606 | Ga0207683_105906062 | 124 |
| 247 | 3300026142 | Ga0207698_10015841 | Ga0207698_100158414 | 124 |
| 248 | 3300028379 | Ga0268266_10244487 | Ga0268266_102444871 | 124 |
| 249 | 3300028379 | Ga0268266_10400374 | Ga0268266_104003742 | 124 |
| 250 | 3300031731 | Ga0307405_11742641 | Ga0307405_117426411 | 124 |
| 251 | 3300032002 | Ga0307416_102702324 | Ga0307416_1027023241 | 124 |
| 252 | 3300035112 | Ga0373932_0120971 | Ga0373932_0120971_21_422 | 124 |
| 253 | 3300035118 | Ga0373954_0109349 | Ga0373954_0109349_374_772 | 124 |
| 254 | 3300035119 | Ga0373956_0228119 | Ga0373956_0228119_354_752 | 124 |
| 255 | 3300035691 | Ga0373931_0065223 | Ga0373931_0065223_104_505 | 124 |
| 256 | 3300035691 | Ga0373931_0529800 | Ga0373931_0529800_299_685 | 124 |
| 257 | 3300036401 | Ga0373937_0228903 | Ga0373937_0228903_195_593 | 124 |
| 258 | 3300037471 | Ga0395905_0049771 | Ga0395905_0049771_1399_1812 | 124 |
| 259 | 3300044694 | Ga0466963_0053523 | Ga0466963_0053523_1975_2361 | 124 |
| 260 | 3300045976 | Ga0466967_0978058 | Ga0466967_0978058_343_744 | 124 |
| 261 | 3300046683 | Ga0495658_0736028 | Ga0495658_0736028_203_589 | 124 |
| 262 | 3300048909 | Ga0496106_0193552 | Ga0496106_0193552_1120_1518 | 124 |
| 263 | 3300053085 | Ga0495619_0985415 | Ga0495619_0985415_75_473 | 124 |
| 264 | 3300005437 | Ga0070710_10548033 | Ga0070710_105480332 | 125 |
| 265 | 3300005439 | Ga0070711_100254872 | Ga0070711_1002548722 | 125 |
| 266 | 3300005445 | Ga0070708_100062093 | Ga0070708_1000620932 | 125 |
| 267 | 3300005471 | Ga0070698_100299014 | Ga0070698_1002990142 | 125 |
| 268 | 3300006871 | Ga0075434_101429951 | Ga0075434_1014299512 | 125 |
| 269 | 3300025916 | Ga0207663_10306983 | Ga0207663_103069832 | 125 |
| 270 | 3300031235 | Ga0265330_10000580 | Ga0265330_1000058010 | 125 |
| 271 | 3300031238 | Ga0265332_10000141 | Ga0265332_100001418 | 125 |
| 272 | 3300031241 | Ga0265325_10020311 | Ga0265325_100203114 | 125 |
| 273 | 3300031242 | Ga0265329_10001151 | Ga0265329_100011517 | 125 |
| 274 | 3300031249 | Ga0265339_10025885 | Ga0265339_100258852 | 125 |
| 275 | 3300031250 | Ga0265331_10000298 | Ga0265331_1000029834 | 125 |
| 276 | 3300031251 | Ga0265327_10003686 | Ga0265327_1000368613 | 125 |
| 277 | 3300031344 | Ga0265316_10072482 | Ga0265316_100724823 | 125 |
| 278 | 3300031711 | Ga0265314_10003464 | Ga0265314_100034648 | 125 |
| 279 | 3300031712 | Ga0265342_10004733 | Ga0265342_100047333 | 125 |
| 280 | 3300035111 | Ga0373923_0526608 | Ga0373923_0526608_81_473 | 125 |
| 281 | 3300036401 | Ga0373937_1909064 | Ga0373937_1909064_97_489 | 125 |
| 282 | 3300045976 | Ga0466967_0789352 | Ga0466967_0789352_327_719 | 125 |
| 283 | 3300046663 | Ga0495635_0499446 | Ga0495635_0499446_16_402 | 125 |
| 284 | 3300053084 | Ga0495595_0072245 | Ga0495595_0072245_950_1336 | 125 |
| 285 | 3300005328 | Ga0070676_10351451 | Ga0070676_103514512 | 126 |
| 286 | 3300005330 | Ga0070690_100021326 | Ga0070690_1000213265 | 126 |
| 287 | 3300005331 | Ga0070670_100030694 | Ga0070670_1000306943 | 126 |
| 288 | 3300005331 | Ga0070670_100073088 | Ga0070670_1000730883 | 126 |
| 289 | 3300005331 | Ga0070670_100553470 | Ga0070670_1005534702 | 126 |
| 290 | 3300005334 | Ga0068869_100015730 | Ga0068869_1000157304 | 126 |
| 291 | 3300005334 | Ga0068869_100117232 | Ga0068869_1001172323 | 126 |
| 292 | 3300005334 | Ga0068869_101034802 | Ga0068869_1010348021 | 126 |
| 293 | 3300005335 | Ga0070666_10784153 | Ga0070666_107841532 | 126 |
| 294 | 3300005340 | Ga0070689_100772089 | Ga0070689_1007720892 | 126 |
| 295 | 3300005347 | Ga0070668_100132512 | Ga0070668_1001325122 | 126 |
| 296 | 3300005347 | Ga0070668_100216125 | Ga0070668_1002161252 | 126 |
| 297 | 3300005347 | Ga0070668_100788404 | Ga0070668_1007884041 | 126 |
| 298 | 3300005353 | Ga0070669_100194598 | Ga0070669_1001945982 | 126 |
| 299 | 3300005354 | Ga0070675_100008923 | Ga0070675_1000089237 | 126 |
| 300 | 3300005354 | Ga0070675_100026327 | Ga0070675_1000263276 | 126 |
| 301 | 3300005354 | Ga0070675_100414976 | Ga0070675_1004149762 | 126 |
| 302 | 3300005354 | Ga0070675_101274279 | Ga0070675_1012742791 | 126 |
| 303 | 3300005355 | Ga0070671_100037619 | Ga0070671_1000376191 | 126 |
| 304 | 3300005355 | Ga0070671_100066394 | Ga0070671_1000663943 | 126 |
| 305 | 3300005355 | Ga0070671_100831820 | Ga0070671_1008318202 | 126 |
| 306 | 3300005355 | Ga0070671_101705110 | Ga0070671_1017051102 | 126 |
| 307 | 3300005356 | Ga0070674_100070820 | Ga0070674_1000708202 | 126 |
| 308 | 3300005356 | Ga0070674_100714626 | Ga0070674_1007146261 | 126 |
| 309 | 3300005364 | Ga0070673_100015316 | Ga0070673_1000153167 | 126 |
| 310 | 3300005367 | Ga0070667_100744729 | Ga0070667_1007447292 | 126 |
| 311 | 3300005367 | Ga0070667_100988836 | Ga0070667_1009888361 | 126 |
| 312 | 3300005438 | Ga0070701_10780902 | Ga0070701_107809021 | 126 |
| 313 | 3300005440 | Ga0070705_100050646 | Ga0070705_1000506463 | 126 |
| 314 | 3300005440 | Ga0070705_100559572 | Ga0070705_1005595722 | 126 |
| 315 | 3300005441 | Ga0070700_100169471 | Ga0070700_1001694712 | 126 |
| 316 | 3300005441 | Ga0070700_100464481 | Ga0070700_1004644811 | 126 |
| 317 | 3300005444 | Ga0070694_100283316 | Ga0070694_1002833162 | 126 |
| 318 | 3300005445 | Ga0070708_101060919 | Ga0070708_1010609192 | 126 |
| 319 | 3300005456 | Ga0070678_100672357 | Ga0070678_1006723572 | 126 |
| 320 | 3300005457 | Ga0070662_101271960 | Ga0070662_1012719602 | 126 |
| 321 | 3300005459 | Ga0068867_100316526 | Ga0068867_1003165262 | 126 |
| 322 | 3300005518 | Ga0070699_100074642 | Ga0070699_1000746423 | 126 |
| 323 | 3300005535 | Ga0070684_100920162 | Ga0070684_1009201622 | 126 |
| 324 | 3300005543 | Ga0070672_100025743 | Ga0070672_1000257432 | 126 |
| 325 | 3300005543 | Ga0070672_100148482 | Ga0070672_1001484822 | 126 |
| 326 | 3300005544 | Ga0070686_101034081 | Ga0070686_1010340812 | 126 |
| 327 | 3300005546 | Ga0070696_100009400 | Ga0070696_1000094006 | 126 |
| 328 | 3300005547 | Ga0070693_101195099 | Ga0070693_1011950991 | 126 |
| 329 | 3300005548 | Ga0070665_101449755 | Ga0070665_1014497552 | 126 |
| 330 | 3300005549 | Ga0070704_100396643 | Ga0070704_1003966432 | 126 |
| 331 | 3300005614 | Ga0068856_101783214 | Ga0068856_1017832142 | 126 |
| 332 | 3300005617 | Ga0068859_100226616 | Ga0068859_1002266162 | 126 |
| 333 | 3300005617 | Ga0068859_100267259 | Ga0068859_1002672594 | 126 |
| 334 | 3300005617 | Ga0068859_100916544 | Ga0068859_1009165442 | 126 |
| 335 | 3300005618 | Ga0068864_100000841 | Ga0068864_10000084115 | 126 |
| 336 | 3300005618 | Ga0068864_100114451 | Ga0068864_1001144512 | 126 |
| 337 | 3300005618 | Ga0068864_100159951 | Ga0068864_1001599512 | 126 |
| 338 | 3300005618 | Ga0068864_102024975 | Ga0068864_1020249751 | 126 |
| 339 | 3300005718 | Ga0068866_10325635 | Ga0068866_103256352 | 126 |
| 340 | 3300005719 | Ga0068861_100132229 | Ga0068861_1001322292 | 126 |
| 341 | 3300005719 | Ga0068861_100205450 | Ga0068861_1002054502 | 126 |
| 342 | 3300005840 | Ga0068870_10006062 | Ga0068870_100060622 | 126 |
| 343 | 3300005841 | Ga0068863_100027650 | Ga0068863_1000276504 | 126 |
| 344 | 3300005841 | Ga0068863_100147927 | Ga0068863_1001479272 | 126 |
| 345 | 3300005842 | Ga0068858_100013104 | Ga0068858_1000131048 | 126 |
| 346 | 3300005843 | Ga0068860_100014659 | Ga0068860_1000146592 | 126 |
| 347 | 3300005844 | Ga0068862_100016324 | Ga0068862_1000163243 | 126 |
| 348 | 3300005844 | Ga0068862_100036063 | Ga0068862_1000360632 | 126 |
| 349 | 3300005981 | Ga0081538_10000830 | Ga0081538_1000083025 | 126 |
| 350 | 3300006175 | Ga0070712_101124179 | Ga0070712_1011241792 | 126 |
| 351 | 3300006237 | Ga0097621_100009171 | Ga0097621_1000091714 | 126 |
| 352 | 3300006237 | Ga0097621_100256787 | Ga0097621_1002567872 | 126 |
| 353 | 3300006358 | Ga0068871_100026041 | Ga0068871_1000260413 | 126 |
| 354 | 3300006358 | Ga0068871_100074190 | Ga0068871_1000741902 | 126 |
| 355 | 3300006358 | Ga0068871_100437974 | Ga0068871_1004379742 | 126 |
| 356 | 3300006846 | Ga0075430_100603733 | Ga0075430_1006037332 | 126 |
| 357 | 3300006847 | Ga0075431_100829331 | Ga0075431_1008293312 | 126 |
| 358 | 3300006852 | Ga0075433_10223062 | Ga0075433_102230623 | 126 |
| 359 | 3300006871 | Ga0075434_100375841 | Ga0075434_1003758412 | 126 |
| 360 | 3300006881 | Ga0068865_100243368 | Ga0068865_1002433683 | 126 |
| 361 | 3300006931 | Ga0097620_100226601 | Ga0097620_1002266012 | 126 |
| 362 | 3300006931 | Ga0097620_100267247 | Ga0097620_1002672471 | 126 |
| 363 | 3300006931 | Ga0097620_100916534 | Ga0097620_1009165342 | 126 |
| 364 | 3300009094 | Ga0111539_10003831 | Ga0111539_1000383116 | 126 |
| 365 | 3300009176 | Ga0105242_10477497 | Ga0105242_104774971 | 126 |
| 366 | 3300013297 | Ga0157378_10774702 | Ga0157378_107747022 | 126 |
| 367 | 3300013297 | Ga0157378_10803016 | Ga0157378_108030162 | 126 |
| 368 | 3300013297 | Ga0157378_11783025 | Ga0157378_117830252 | 126 |
| 369 | 3300013306 | Ga0163162_10332794 | Ga0163162_103327942 | 126 |
| 370 | 3300013306 | Ga0163162_10406189 | Ga0163162_104061892 | 126 |
| 371 | 3300013308 | Ga0157375_10767287 | Ga0157375_107672872 | 126 |
| 372 | 3300014968 | Ga0157379_10764361 | Ga0157379_107643611 | 126 |
| 373 | 3300014969 | Ga0157376_10060630 | Ga0157376_100606305 | 126 |
| 374 | 3300014969 | Ga0157376_10481682 | Ga0157376_104816822 | 126 |
| 375 | 3300017792 | Ga0163161_10017531 | Ga0163161_100175312 | 126 |
| 376 | 3300017792 | Ga0163161_11321444 | Ga0163161_113214442 | 126 |
| 377 | 3300025903 | Ga0207680_10090608 | Ga0207680_100906082 | 126 |
| 378 | 3300025903 | Ga0207680_10195095 | Ga0207680_101950952 | 126 |
| 379 | 3300025907 | Ga0207645_10289787 | Ga0207645_102897872 | 126 |
| 380 | 3300025907 | Ga0207645_10593312 | Ga0207645_105933122 | 126 |
| 381 | 3300025908 | Ga0207643_10009557 | Ga0207643_100095577 | 126 |
| 382 | 3300025923 | Ga0207681_10109902 | Ga0207681_101099023 | 126 |
| 383 | 3300025923 | Ga0207681_10189621 | Ga0207681_101896213 | 126 |
| 384 | 3300025925 | Ga0207650_10016678 | Ga0207650_100166783 | 126 |
| 385 | 3300025925 | Ga0207650_10059256 | Ga0207650_100592565 | 126 |
| 386 | 3300025925 | Ga0207650_10478083 | Ga0207650_104780832 | 126 |
| 387 | 3300025926 | Ga0207659_10241241 | Ga0207659_102412413 | 126 |
| 388 | 3300025926 | Ga0207659_10452027 | Ga0207659_104520271 | 126 |
| 389 | 3300025926 | Ga0207659_11761141 | Ga0207659_117611411 | 126 |
| 390 | 3300025931 | Ga0207644_10080502 | Ga0207644_100805024 | 126 |
| 391 | 3300025931 | Ga0207644_10446830 | Ga0207644_104468302 | 126 |
| 392 | 3300025931 | Ga0207644_10826260 | Ga0207644_108262602 | 126 |
| 393 | 3300025934 | Ga0207686_10018972 | Ga0207686_100189722 | 126 |
| 394 | 3300025936 | Ga0207670_10343299 | Ga0207670_103432992 | 126 |
| 395 | 3300025937 | Ga0207669_10049903 | Ga0207669_100499032 | 126 |
| 396 | 3300025937 | Ga0207669_10630346 | Ga0207669_106303461 | 126 |
| 397 | 3300025938 | Ga0207704_11078606 | Ga0207704_110786062 | 126 |
| 398 | 3300025940 | Ga0207691_10002837 | Ga0207691_1000283714 | 126 |
| 399 | 3300025940 | Ga0207691_10075030 | Ga0207691_100750302 | 126 |
| 400 | 3300025940 | Ga0207691_10959472 | Ga0207691_109594722 | 126 |
| 401 | 3300025941 | Ga0207711_10428898 | Ga0207711_104288982 | 126 |
| 402 | 3300025942 | Ga0207689_10001809 | Ga0207689_1000180911 | 126 |
| 403 | 3300025942 | Ga0207689_10344669 | Ga0207689_103446692 | 126 |
| 404 | 3300025945 | Ga0207679_10260646 | Ga0207679_102606462 | 126 |
| 405 | 3300025960 | Ga0207651_12017190 | Ga0207651_120171901 | 126 |
| 406 | 3300025961 | Ga0207712_10051585 | Ga0207712_100515852 | 126 |
| 407 | 3300025972 | Ga0207668_10055267 | Ga0207668_100552672 | 126 |
| 408 | 3300025972 | Ga0207668_10426472 | Ga0207668_104264722 | 126 |
| 409 | 3300025972 | Ga0207668_11008545 | Ga0207668_110085452 | 126 |
| 410 | 3300025986 | Ga0207658_10230020 | Ga0207658_102300203 | 126 |
| 411 | 3300026023 | Ga0207677_10160316 | Ga0207677_101603162 | 126 |
| 412 | 3300026035 | Ga0207703_10157782 | Ga0207703_101577822 | 126 |
| 413 | 3300026035 | Ga0207703_10553498 | Ga0207703_105534982 | 126 |
| 414 | 3300026035 | Ga0207703_10629642 | Ga0207703_106296421 | 126 |
| 415 | 3300026035 | Ga0207703_11888989 | Ga0207703_118889892 | 126 |
| 416 | 3300026075 | Ga0207708_10021861 | Ga0207708_100218614 | 126 |
| 417 | 3300026075 | Ga0207708_10401935 | Ga0207708_104019352 | 126 |
| 418 | 3300026088 | Ga0207641_10014305 | Ga0207641_100143056 | 126 |
| 419 | 3300026088 | Ga0207641_10087438 | Ga0207641_100874382 | 126 |
| 420 | 3300026088 | Ga0207641_10217122 | Ga0207641_102171223 | 126 |
| 421 | 3300026088 | Ga0207641_10680208 | Ga0207641_106802082 | 126 |
| 422 | 3300026095 | Ga0207676_10033385 | Ga0207676_100333853 | 126 |
| 423 | 3300026095 | Ga0207676_10121944 | Ga0207676_101219443 | 126 |
| 424 | 3300026095 | Ga0207676_10122666 | Ga0207676_101226662 | 126 |
| 425 | 3300026095 | Ga0207676_10198383 | Ga0207676_101983832 | 126 |
| 426 | 3300026118 | Ga0207675_100027845 | Ga0207675_1000278457 | 126 |
| 427 | 3300026121 | Ga0207683_10103612 | Ga0207683_101036123 | 126 |
| 428 | 3300027907 | Ga0207428_10000081 | Ga0207428_1000008154 | 126 |
| 429 | 3300028379 | Ga0268266_10010137 | Ga0268266_100101374 | 126 |
| 430 | 3300028379 | Ga0268266_11268289 | Ga0268266_112682892 | 126 |
| 431 | 3300028380 | Ga0268265_10017818 | Ga0268265_100178186 | 126 |
| 432 | 3300028380 | Ga0268265_10056120 | Ga0268265_100561204 | 126 |
| 433 | 3300028381 | Ga0268264_10755686 | Ga0268264_107556862 | 126 |
| 434 | 3300031824 | Ga0307413_10082415 | Ga0307413_100824152 | 126 |
| 435 | 3300031852 | Ga0307410_10193153 | Ga0307410_101931532 | 126 |
| 436 | 3300031901 | Ga0307406_10142484 | Ga0307406_101424842 | 126 |
| 437 | 3300031903 | Ga0307407_10030810 | Ga0307407_100308102 | 126 |
| 438 | 3300031995 | Ga0307409_100069665 | Ga0307409_1000696652 | 126 |
| 439 | 3300032002 | Ga0307416_100512613 | Ga0307416_1005126132 | 126 |
| 440 | 3300032005 | Ga0307411_10004870 | Ga0307411_100048708 | 126 |
| 441 | 3300036401 | Ga0373937_0560659 | Ga0373937_0560659_267_653 | 126 |
| 442 | 3300046459 | Ga0495629_0609603 | Ga0495629_0609603_62_445 | 126 |
| 443 | 3300048907 | Ga0496104_1196640 | Ga0496104_1196640_197_583 | 126 |
| 444 | 3300048912 | Ga0496109_0240565 | Ga0496109_0240565_197_583 | 126 |
| 445 | 3300048914 | Ga0496111_0218254 | Ga0496111_0218254_128_514 | 126 |
| 446 | 3300048915 | Ga0496112_0000843 | Ga0496112_0000843_12908_13294 | 126 |
| 447 | 3300048915 | Ga0496112_0890253 | Ga0496112_0890253_388_774 | 126 |
| 448 | 3300048916 | Ga0496113_0112719 | Ga0496113_0112719_1249_1635 | 126 |
| 449 | 3300048917 | Ga0496114_0231958 | Ga0496114_0231958_1080_1463 | 126 |
| 450 | 3300050507 | nmdc:mga05p37_23855_c1 | nmdc:mga05p37_23855_c1_4197_4580 | 126 |
| 451 | 3300050508 | nmdc:mga09592_1332616_c1 | nmdc:mga09592_1332616_c1_157_540 | 126 |
| 452 | 3300050510 | nmdc:mga06r32_1120282_c1 | nmdc:mga06r32_1120282_c1_244_627 | 126 |
| 453 | 3300050510 | nmdc:mga06r32_1404303_c1 | nmdc:mga06r32_1404303_c1_14_397 | 126 |
| 454 | 3300050511 | nmdc:mga08y16_31_c1 | nmdc:mga08y16_31_c1_116429_116815 | 126 |
| 455 | 3300050515 | nmdc:mga0a205_249639_c1 | nmdc:mga0a205_249639_c1_1000_1386 | 126 |
| 456 | 3300059426 | Ga0590077_009215 | Ga0590077_009215_999_1385 | 126 |
| 457 | 3300005336 | Ga0070680_100110066 | Ga0070680_1001100662 | 127 |
| 458 | 3300005344 | Ga0070661_100309556 | Ga0070661_1003095561 | 127 |
| 459 | 3300005434 | Ga0070709_10157916 | Ga0070709_101579162 | 127 |
| 460 | 3300005436 | Ga0070713_100761686 | Ga0070713_1007616861 | 127 |
| 461 | 3300005439 | Ga0070711_100264466 | Ga0070711_1002644661 | 127 |
| 462 | 3300005458 | Ga0070681_10353651 | Ga0070681_103536512 | 127 |
| 463 | 3300005458 | Ga0070681_10840985 | Ga0070681_108409851 | 127 |
| 464 | 3300005467 | Ga0070706_100142185 | Ga0070706_1001421854 | 127 |
| 465 | 3300005468 | Ga0070707_100635284 | Ga0070707_1006352841 | 127 |
| 466 | 3300005471 | Ga0070698_100057238 | Ga0070698_1000572384 | 127 |
| 467 | 3300005518 | Ga0070699_100806266 | Ga0070699_1008062661 | 127 |
| 468 | 3300005530 | Ga0070679_100059945 | Ga0070679_1000599453 | 127 |
| 469 | 3300005539 | Ga0068853_100076922 | Ga0068853_1000769221 | 127 |
| 470 | 3300005539 | Ga0068853_100467410 | Ga0068853_1004674102 | 127 |
| 471 | 3300005577 | Ga0068857_101321657 | Ga0068857_1013216572 | 127 |
| 472 | 3300005614 | Ga0068856_100409436 | Ga0068856_1004094362 | 127 |
| 473 | 3300005618 | Ga0068864_101837956 | Ga0068864_1018379561 | 127 |
| 474 | 3300006173 | Ga0070716_100067535 | Ga0070716_1000675351 | 127 |
| 475 | 3300006175 | Ga0070712_100681750 | Ga0070712_1006817502 | 127 |
| 476 | 3300009094 | Ga0111539_10067648 | Ga0111539_100676484 | 127 |
| 477 | 3300009147 | Ga0114129_10243061 | Ga0114129_102430613 | 127 |
| 478 | 3300009147 | Ga0114129_10461701 | Ga0114129_104617012 | 127 |
| 479 | 3300009545 | Ga0105237_10586760 | Ga0105237_105867601 | 127 |
| 480 | 3300013100 | Ga0157373_10047428 | Ga0157373_100474283 | 127 |
| 481 | 3300013104 | Ga0157370_10039988 | Ga0157370_100399882 | 127 |
| 482 | 3300013105 | Ga0157369_12490289 | Ga0157369_124902891 | 127 |
| 483 | 3300013307 | Ga0157372_10066836 | Ga0157372_100668363 | 127 |
| 484 | 3300014325 | Ga0163163_10044224 | Ga0163163_100442242 | 127 |
| 485 | 3300025900 | Ga0207710_10636272 | Ga0207710_106362721 | 127 |
| 486 | 3300025906 | Ga0207699_10294031 | Ga0207699_102940312 | 127 |
| 487 | 3300025910 | Ga0207684_10113265 | Ga0207684_101132653 | 127 |
| 488 | 3300025912 | Ga0207707_10023534 | Ga0207707_100235344 | 127 |
| 489 | 3300025912 | Ga0207707_10283095 | Ga0207707_102830952 | 127 |
| 490 | 3300025914 | Ga0207671_11318228 | Ga0207671_113182281 | 127 |
| 491 | 3300025916 | Ga0207663_10221670 | Ga0207663_102216702 | 127 |
| 492 | 3300025917 | Ga0207660_10088234 | Ga0207660_100882343 | 127 |
| 493 | 3300025920 | Ga0207649_10262342 | Ga0207649_102623422 | 127 |
| 494 | 3300025924 | Ga0207694_10144832 | Ga0207694_101448322 | 127 |
| 495 | 3300025928 | Ga0207700_11291244 | Ga0207700_112912442 | 127 |
| 496 | 3300026035 | Ga0207703_11182983 | Ga0207703_111829831 | 127 |
| 497 | 3300026041 | Ga0207639_10246026 | Ga0207639_102460261 | 127 |
| 498 | 3300026041 | Ga0207639_10285339 | Ga0207639_102853392 | 127 |
| 499 | 3300026116 | Ga0207674_11260379 | Ga0207674_112603791 | 127 |
| 500 | 3300035111 | Ga0373923_0435081 | Ga0373923_0435081_140_535 | 127 |
| 501 | 3300035116 | Ga0373945_0329387 | Ga0373945_0329387_45_440 | 127 |
| 502 | 3300035172 | Ga0373955_0666352 | Ga0373955_0666352_199_594 | 127 |
| 503 | 3300035398 | Ga0316574_0002686 | Ga0316574_0002686_5139_5540 | 127 |
| 504 | 3300035695 | Ga0373927_0541238 | Ga0373927_0541238_224_619 | 127 |
| 505 | 3300036401 | Ga0373937_0136714 | Ga0373937_0136714_574_969 | 127 |
| 506 | 3300037068 | Ga0373925_0513597 | Ga0373925_0513597_351_746 | 127 |
| 507 | 3300044712 | Ga0453684_0795825 | Ga0453684_0795825_596_982 | 127 |
| 508 | 3300046520 | Ga0495637_0173211 | Ga0495637_0173211_145_528 | 127 |
| 509 | 3300049568 | Ga0501031_0287857 | Ga0501031_0287857_506_892 | 127 |
| 510 | 3300049569 | Ga0501032_0003557 | Ga0501032_0003557_1105_1491 | 127 |
| 511 | 3300049571 | Ga0501034_0087101 | Ga0501034_0087101_1359_1745 | 127 |
| 512 | 3300049574 | Ga0501038_0001368 | Ga0501038_0001368_807_1193 | 127 |
| 513 | 3300049579 | Ga0501043_0557901 | Ga0501043_0557901_192_578 | 127 |
| 514 | 3300049581 | Ga0501047_0022207 | Ga0501047_0022207_639_1025 | 127 |
| 515 | 3300049583 | Ga0501067_0030060 | Ga0501067_0030060_1071_1457 | 127 |
| 516 | 3300049584 | Ga0501068_0323233 | Ga0501068_0323233_33_419 | 127 |
| 517 | 3300049586 | Ga0501070_0000738 | Ga0501070_0000738_9372_9758 | 127 |
| 518 | 3300049588 | Ga0501072_0099590 | Ga0501072_0099590_650_1036 | 127 |
| 519 | 3300049589 | Ga0501073_0003208 | Ga0501073_0003208_8454_8840 | 127 |
| 520 | 3300049590 | Ga0501074_0061141 | Ga0501074_0061141_646_1032 | 127 |
| 521 | 3300049741 | Ga0501079_0147856 | Ga0501079_0147856_1410_1796 | 127 |
| 522 | 3300049742 | Ga0501080_0011550 | Ga0501080_0011550_5052_5438 | 127 |
| 523 | 3300049742 | Ga0501080_0124653 | Ga0501080_0124653_144_530 | 127 |
| 524 | 3300049744 | Ga0501083_0051750 | Ga0501083_0051750_2363_2749 | 127 |
| 525 | 3300049822 | Ga0501035_0042645 | Ga0501035_0042645_3171_3557 | 127 |
| 526 | 3300049822 | Ga0501035_0275203 | Ga0501035_0275203_234_620 | 127 |
| 527 | 3300049823 | Ga0501044_1088660 | Ga0501044_1088660_147_533 | 127 |
| 528 | 3300050507 | nmdc:mga05p37_712167_c1 | nmdc:mga05p37_712167_c1_655_1038 | 127 |
| 529 | 3300050509 | nmdc:mga0qj67_704542_c1 | nmdc:mga0qj67_704542_c1_406_789 | 127 |
| 530 | 3300050511 | nmdc:mga08y16_666496_c1 | nmdc:mga08y16_666496_c1_112_495 | 127 |
| 531 | 3300054114 | Ga0501084_0107241 | Ga0501084_0107241_533_919 | 127 |
| 532 | 3300060353 | Ga0501082_0174134 | Ga0501082_0174134_356_742 | 127 |
| 533 | 3300005937 | Ga0081455_10245942 | Ga0081455_102459422 | 128 |
| 534 | 3300046675 | Ga0495657_0079165 | Ga0495657_0079165_406_795 | 128 |
| 535 | 3300049568 | Ga0501031_0643872 | Ga0501031_0643872_88_483 | 128 |
| 536 | 3300049569 | Ga0501032_0013432 | Ga0501032_0013432_319_714 | 128 |
| 537 | 3300049571 | Ga0501034_1046964 | Ga0501034_1046964_252_647 | 128 |
| 538 | 3300049574 | Ga0501038_0205272 | Ga0501038_0205272_142_537 | 128 |
| 539 | 3300049575 | Ga0501039_0142075 | Ga0501039_0142075_1273_1668 | 128 |
| 540 | 3300049822 | Ga0501035_0458931 | Ga0501035_0458931_582_995 | 128 |
| 541 | 3300049822 | Ga0501035_0693068 | Ga0501035_0693068_279_674 | 128 |
| 542 | 3300006163 | Ga0070715_10063013 | Ga0070715_100630133 | 130 |
| 543 | 3300025905 | Ga0207685_10165822 | Ga0207685_101658222 | 130 |
| 544 | 3300003659 | JGI25404J52841_10012451 | JGI25404J52841_100124511 | 132 |
| 545 | 3300005341 | Ga0070691_10069010 | Ga0070691_100690102 | 132 |
| 546 | 3300005439 | Ga0070711_100400816 | Ga0070711_1004008162 | 132 |
| 547 | 3300005444 | Ga0070694_100028218 | Ga0070694_1000282182 | 132 |
| 548 | 3300005545 | Ga0070695_100025393 | Ga0070695_1000253934 | 132 |
| 549 | 3300005577 | Ga0068857_101064988 | Ga0068857_1010649881 | 132 |
| 550 | 3300005719 | Ga0068861_100010493 | Ga0068861_1000104933 | 132 |
| 551 | 3300005937 | Ga0081455_10040570 | Ga0081455_100405701 | 132 |
| 552 | 3300005983 | Ga0081540_1000689 | Ga0081540_100068927 | 132 |
| 553 | 3300005983 | Ga0081540_1062866 | Ga0081540_10628661 | 132 |
| 554 | 3300006173 | Ga0070716_100466568 | Ga0070716_1004665682 | 132 |
| 555 | 3300006358 | Ga0068871_102369069 | Ga0068871_1023690691 | 132 |
| 556 | 3300006844 | Ga0075428_100060102 | Ga0075428_1000601024 | 132 |
| 557 | 3300006844 | Ga0075428_100152732 | Ga0075428_1001527321 | 132 |
| 558 | 3300006847 | Ga0075431_100052301 | Ga0075431_1000523014 | 132 |
| 559 | 3300006847 | Ga0075431_100675198 | Ga0075431_1006751982 | 132 |
| 560 | 3300006852 | Ga0075433_10001112 | Ga0075433_1000111210 | 132 |
| 561 | 3300006852 | Ga0075433_11041446 | Ga0075433_110414461 | 132 |
| 562 | 3300006852 | Ga0075433_11603121 | Ga0075433_116031212 | 132 |
| 563 | 3300006871 | Ga0075434_100003189 | Ga0075434_1000031898 | 132 |
| 564 | 3300007076 | Ga0075435_100032237 | Ga0075435_1000322374 | 132 |
| 565 | 3300009094 | Ga0111539_10285013 | Ga0111539_102850133 | 132 |
| 566 | 3300009094 | Ga0111539_10398881 | Ga0111539_103988811 | 132 |
| 567 | 3300009094 | Ga0111539_12039158 | Ga0111539_120391581 | 132 |
| 568 | 3300009098 | Ga0105245_11414358 | Ga0105245_114143582 | 132 |
| 569 | 3300009147 | Ga0114129_10037458 | Ga0114129_100374585 | 132 |
| 570 | 3300025906 | Ga0207699_10290263 | Ga0207699_102902632 | 132 |
| 571 | 3300026118 | Ga0207675_100018267 | Ga0207675_1000182676 | 132 |
| 572 | 3300027907 | Ga0207428_10042174 | Ga0207428_100421743 | 132 |
| 573 | 3300027907 | Ga0207428_10161613 | Ga0207428_101616132 | 132 |
| 574 | 3300027907 | Ga0207428_10162704 | Ga0207428_101627041 | 132 |
| 575 | 3300034817 | Ga0373948_0044856 | Ga0373948_0044856_439_837 | 132 |
| 576 | 3300034818 | Ga0373950_0020873 | Ga0373950_0020873_176_574 | 132 |
| 577 | 3300034957 | Ga0373938_0153734 | Ga0373938_0153734_123_521 | 132 |
| 578 | 3300035084 | Ga0373928_0017588 | Ga0373928_0017588_493_891 | 132 |
| 579 | 3300035084 | Ga0373928_0040905 | Ga0373928_0040905_259_657 | 132 |
| 580 | 3300035088 | Ga0373940_0010193 | Ga0373940_0010193_1283_1681 | 132 |
| 581 | 3300035088 | Ga0373940_0084642 | Ga0373940_0084642_344_742 | 132 |
| 582 | 3300035088 | Ga0373940_0177261 | Ga0373940_0177261_31_429 | 132 |
| 583 | 3300035090 | Ga0373949_0072103 | Ga0373949_0072103_133_531 | 132 |
| 584 | 3300035092 | Ga0373952_0129598 | Ga0373952_0129598_226_624 | 132 |
| 585 | 3300035092 | Ga0373952_0209764 | Ga0373952_0209764_154_552 | 132 |
| 586 | 3300035112 | Ga0373932_0161951 | Ga0373932_0161951_321_719 | 132 |
| 587 | 3300035114 | Ga0373939_0044847 | Ga0373939_0044847_124_522 | 132 |
| 588 | 3300035207 | Ga0373942_0007862 | Ga0373942_0007862_380_778 | 132 |
| 589 | 3300035207 | Ga0373942_0088880 | Ga0373942_0088880_413_811 | 132 |
| 590 | 3300035241 | Ga0373961_0013564 | Ga0373961_0013564_1606_2004 | 132 |
| 591 | 3300035242 | Ga0373962_0198216 | Ga0373962_0198216_139_537 | 132 |
| 592 | 3300035242 | Ga0373962_0384434 | Ga0373962_0384434_43_441 | 132 |
| 593 | 3300035691 | Ga0373931_0002223 | Ga0373931_0002223_1955_2353 | 132 |
| 594 | 3300035691 | Ga0373931_0033622 | Ga0373931_0033622_1653_2051 | 132 |
| 595 | 3300035695 | Ga0373927_0085772 | Ga0373927_0085772_118_516 | 132 |
| 596 | 3300037068 | Ga0373925_0458322 | Ga0373925_0458322_563_961 | 132 |
| 597 | 3300046491 | Ga0495584_0360119 | Ga0495584_0360119_47_445 | 132 |
| 598 | 3300046517 | Ga0495630_0507527 | Ga0495630_0507527_390_788 | 132 |
| 599 | 3300046615 | Ga0495656_0426786 | Ga0495656_0426786_241_639 | 132 |
| 600 | 3300048912 | Ga0496109_0703462 | Ga0496109_0703462_376_774 | 132 |
| 601 | 3300048914 | Ga0496111_0452866 | Ga0496111_0452866_432_830 | 132 |
| 602 | 3300048917 | Ga0496114_0684005 | Ga0496114_0684005_411_854 | 132 |
| 603 | 3300049592 | Ga0501076_0749725 | Ga0501076_0749725_31_432 | 132 |
| 604 | 3300050507 | nmdc:mga05p37_212802_c1 | nmdc:mga05p37_212802_c1_218_616 | 132 |
| 605 | 3300050507 | nmdc:mga05p37_53721_c1 | nmdc:mga05p37_53721_c1_1958_2356 | 132 |
| 606 | 3300050510 | nmdc:mga06r32_110079_c1 | nmdc:mga06r32_110079_c1_2245_2643 | 132 |
| 607 | 3300050510 | nmdc:mga06r32_278091_c1 | nmdc:mga06r32_278091_c1_862_1260 | 132 |
| 608 | 3300050510 | nmdc:mga06r32_90299_c1 | nmdc:mga06r32_90299_c1_2436_2843 | 132 |
| 609 | 3300050511 | nmdc:mga08y16_229081_c1 | nmdc:mga08y16_229081_c1_322_720 | 132 |
| 610 | 3300050511 | nmdc:mga08y16_74519_c1 | nmdc:mga08y16_74519_c1_2420_2818 | 132 |
| 611 | 3300050512 | nmdc:mga0n895_4648_c1 | nmdc:mga0n895_4648_c1_9634_10032 | 132 |
| 612 | 3300050513 | nmdc:mga0rr50_9393_c1 | nmdc:mga0rr50_9393_c1_1986_2384 | 132 |
| 613 | 3300050515 | nmdc:mga0a205_1085114_c1 | nmdc:mga0a205_1085114_c1_194_592 | 132 |
| 614 | 3300050515 | nmdc:mga0a205_58448_c1 | nmdc:mga0a205_58448_c1_157_555 | 132 |
| 615 | 3300053085 | Ga0495619_0352685 | Ga0495619_0352685_133_531 | 132 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3zi1-assembly1.cif.gz_A | crystal structure of human glyoxalase domain-containing protein 4 (glod4) | 0.8282 | 8 | 121 |
| 2p7q-assembly4.cif.gz_D-2 | crystal structure of e126q mutant of genomically encoded fosfomycin resistance protein, fosx, from listeria monocytogenes complexed with mn(ii) and 1s,2s-dihydroxypropylphosphonic acid | 0.8163 | 2 | 121 |
| 4nb0-assembly1.cif.gz_A | crystal structure of fosb from staphylococcus aureus with bs-cys9 disulfide at 1.62 angstrom resolution | 0.8033 | 1 | 123 |
| 2p7l-assembly4.cif.gz_A | crystal structure of monoclinic form of genomically encoded fosfomycin resistance protein, fosx, from listeria monocytogenes at ph 5.75 | 0.8024 | 2 | 121 |
| 2p7m-assembly4.cif.gz_A | crystal structure of monoclinic form of genomically encoded fosfomycin resistance protein, fosx, from listeria monocytogenes at ph 6.5 | 0.8007 | 2 | 121 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q10FQ7_7_135_3.10.180.10 | Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 | 0.8511 | 7 | 121 | 3.10.180.10 |
| af_I1LTD0_10_138_3.10.180.10 | Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 | 0.8463 | 1 | 121 | 3.10.180.10 |
| af_P52096_9_128_3.10.180.10 | Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 | 0.8419 | 8 | 121 | 3.10.180.10 |
| af_Q4CQ87_202_421_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.8416 | 105 | 122 | 3.40.50.300 |
| 2p7kA00 | Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 | 0.8345 | 2 | 123 | 3.10.180.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3N5NKK6-F1-model_v4 | VOC domain-containing protein | 0.9723 | 1 | 129 |
|
| AF-A0A2N5C2L5-F1-model_v4 | Glyoxalase | 0.9457 | 1 | 130 |
|
| AF-A0A0F9WHE4-F1-model_v4 | VOC domain-containing protein | 0.9449 | 2 | 130 |
|
| AF-A0A3N5NKK6-F1-model_v4 | VOC domain-containing protein | 0.9436 | 1 | 129 |
|
| AF-A0A3M1G254-F1-model_v4 | Dioxygenase | 0.932 | 3 | 130 |
GO:0051213
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar