F469446

General Info

Members Datasets Scaffolds Average Seq Length
615 274 615 130

Family's Representative Sequence

Representative Sequence 3300025916|Ga0207663_10358236|Ga0207663_103582362
Length 149
Sequence VGCNGPLSLIDCADDAMPATAMNHFTILTDDVPATVRFYRELLGLADGPRPPLQFPGAWLYAGGSPILHVVGGRPADELKAGVIDHMAFSATDLSDTLAMLTSRNIEHTCRRQAGSGTWQVFFHDPNGARVELDFAADEPHHPKEAATR

Samples

Sample ID Description Type Environment
1 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
27 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
28 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
29 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
30 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
31 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
32 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
33 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
34 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
35 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
36 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
37 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
38 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
39 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
40 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
41 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
42 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
43 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
44 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
45 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
46 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
47 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
48 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
49 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
50 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
51 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
52 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
53 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
54 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
55 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
56 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
57 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
58 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
59 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
60 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
61 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
62 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
63 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
64 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
65 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
66 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
67 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
68 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
69 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
70 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
71 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
72 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
73 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
74 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
75 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
76 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
77 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
78 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
79 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
81 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
82 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
83 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
84 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
85 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
86 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
87 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
88 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
89 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
90 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
91 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
92 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
93 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
94 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
95 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
96 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
97 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
98 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
99 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
100 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
101 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
102 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
103 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
104 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
105 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
106 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
107 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
108 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
109 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
110 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
111 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
112 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
113 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
114 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
115 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
116 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
117 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
175 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
179 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
180 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
181 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
182 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
183 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
184 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
185 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
186 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
187 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
188 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
189 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
190 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
191 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
192 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
193 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
194 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
195 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
196 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
197 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
198 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
199 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
200 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
201 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
202 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
203 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
204 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
205 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
206 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
207 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
208 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
209 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
210 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
211 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
212 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
213 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
214 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
215 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
216 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
217 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
218 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
219 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
220 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
221 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
222 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
223 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
224 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
225 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
226 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
227 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
228 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
229 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
230 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
231 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
232 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
233 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
234 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
235 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
236 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
237 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
238 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
239 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
240 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
241 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
242 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
243 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
244 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
245 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
246 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
247 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
248 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
249 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
250 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
251 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
252 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
253 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
254 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
255 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
256 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
257 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
258 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
259 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
260 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
261 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
262 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
263 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
264 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
265 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
266 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
267 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
268 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
269 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
270 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
271 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
272 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
273 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
274 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.35
Metatranscriptomes 0.65
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.16
Nodule 0
Rhizoplane 2.11
Rhizosphere 97.72
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25404J52841_10012451 3300003659 Unclassified 1842
2 Ga0070658_10131831 3300005327 Unclassified 2083
3 Ga0070658_10184180 3300005327 Bacteria 1758
4 Ga0070658_10228101 3300005327 Unclassified 1576
5 Ga0070676_10351451 3300005328 Bacteria 1013
6 Ga0070683_100030094 3300005329 Bacteria 4924
7 Ga0070683_100109442 3300005329 Bacteria 2606
8 Ga0070683_100606557 3300005329 Unclassified 1048
9 Ga0070683_100916236 3300005329 Bacteria 841
10 Ga0070690_100021326 3300005330 Bacteria 3954
11 Ga0070690_101766116 3300005330 Unclassified 504
12 Ga0070670_100016039 3300005331 Bacteria 6429
13 Ga0070670_100017719 3300005331 Bacteria 6110
14 Ga0070670_100030694 3300005331 Bacteria 4628
15 Ga0070670_100073088 3300005331 Bacteria 2946
16 Ga0070670_100533647 3300005331 Unclassified 1046
17 Ga0070670_100553470 3300005331 Bacteria 1026
18 Ga0070677_10226025 3300005333 Unclassified 917
19 Ga0068869_100015730 3300005334 Bacteria 5083
20 Ga0068869_100117232 3300005334 Bacteria 2032
21 Ga0068869_101034802 3300005334 Bacteria 716
22 Ga0070666_10784153 3300005335 Unclassified 701
23 Ga0070680_100110066 3300005336 Bacteria 2293
24 Ga0070680_100171575 3300005336 Unclassified 1825
25 Ga0070680_100560931 3300005336 Bacteria 979
26 Ga0070680_100798877 3300005336 Unclassified 813
27 Ga0070680_101415430 3300005336 Bacteria 602
28 Ga0070682_100006581 3300005337 Bacteria 6518
29 Ga0068868_100575467 3300005338 Unclassified 995
30 Ga0068868_101604875 3300005338 Bacteria 611
31 Ga0070660_100074822 3300005339 Bacteria 2651
32 Ga0070660_100083449 3300005339 Bacteria 2510
33 Ga0070660_100116430 3300005339 Unclassified 2131
34 Ga0070660_100751133 3300005339 Bacteria 819
35 Ga0070689_100772089 3300005340 Bacteria 843
36 Ga0070691_10069010 3300005341 Bacteria 1712
37 Ga0070661_100004383 3300005344 Bacteria 9732
38 Ga0070661_100059040 3300005344 Unclassified 2812
39 Ga0070661_100095951 3300005344 Bacteria 2200
40 Ga0070661_100309556 3300005344 Bacteria 1231
41 Ga0070661_100808476 3300005344 Unclassified 770
42 Ga0070692_10024547 3300005345 Bacteria 2964
43 Ga0070692_10934002 3300005345 Unclassified 602
44 Ga0070668_100132512 3300005347 Bacteria 2001
45 Ga0070668_100216125 3300005347 Bacteria 1579
46 Ga0070668_100788404 3300005347 Bacteria 843
47 Ga0070669_100194598 3300005353 Unclassified 1592
48 Ga0070675_100008923 3300005354 Bacteria 7788
49 Ga0070675_100026327 3300005354 Bacteria 4668
50 Ga0070675_100414976 3300005354 Bacteria 1203
51 Ga0070675_101274279 3300005354 Unclassified 677
52 Ga0070671_100037619 3300005355 Bacteria 4014
53 Ga0070671_100066394 3300005355 Bacteria 3006
54 Ga0070671_100831820 3300005355 Bacteria 805
55 Ga0070671_101278973 3300005355 Bacteria 647
56 Ga0070671_101705110 3300005355 Unclassified 559
57 Ga0070671_101948687 3300005355 Unclassified 523
58 Ga0070674_100070820 3300005356 Bacteria 2465
59 Ga0070674_100216515 3300005356 Bacteria 1488
60 Ga0070674_100714626 3300005356 Bacteria 858
61 Ga0070673_100015316 3300005364 Bacteria 5381
62 Ga0070659_100005229 3300005366 Bacteria 9312
63 Ga0070659_100252463 3300005366 Bacteria 1462
64 Ga0070659_101784936 3300005366 Bacteria 551
65 Ga0070667_100246002 3300005367 Bacteria 1598
66 Ga0070667_100744729 3300005367 Bacteria 908
67 Ga0070667_100988836 3300005367 Unclassified 785
68 Ga0070709_10114820 3300005434 Bacteria 1815
69 Ga0070709_10157916 3300005434 Bacteria 1574
70 Ga0070709_10218638 3300005434 Bacteria 1358
71 Ga0070714_100009546 3300005435 Bacteria 7634
72 Ga0070714_100016715 3300005435 Bacteria 5932
73 Ga0070714_100557635 3300005435 Bacteria 1097
74 Ga0070713_100761686 3300005436 Bacteria 927
75 Ga0070713_101225203 3300005436 Unclassified 727
76 Ga0070710_10059970 3300005437 Bacteria 2163
77 Ga0070710_10548033 3300005437 Unclassified 798
78 Ga0070701_10078614 3300005438 Bacteria 1780
79 Ga0070701_10780902 3300005438 Bacteria 650
80 Ga0070711_100061572 3300005439 Bacteria 2613
81 Ga0070711_100254872 3300005439 Bacteria 1378
82 Ga0070711_100264466 3300005439 Bacteria 1355
83 Ga0070711_100400816 3300005439 Bacteria 1114
84 Ga0070705_100050646 3300005440 Bacteria 2417
85 Ga0070705_100559572 3300005440 Bacteria 878
86 Ga0070700_100169471 3300005441 Bacteria 1511
87 Ga0070700_100464481 3300005441 Bacteria 966
88 Ga0070694_100028218 3300005444 Bacteria 3650
89 Ga0070694_100283316 3300005444 Unclassified 1264
90 Ga0070708_100062093 3300005445 Unclassified 3340
91 Ga0070708_101060919 3300005445 Bacteria 759
92 Ga0070663_100013346 3300005455 Bacteria 5234
93 Ga0070663_100064699 3300005455 Bacteria 2644
94 Ga0070678_100672357 3300005456 Unclassified 930
95 Ga0070678_100738170 3300005456 Unclassified 890
96 Ga0070662_100212177 3300005457 Unclassified 1541
97 Ga0070662_101271960 3300005457 Unclassified 633
98 Ga0070662_101379886 3300005457 Unclassified 607
99 Ga0070681_10002557 3300005458 Bacteria 16703
100 Ga0070681_10017663 3300005458 Bacteria 7129
101 Ga0070681_10251868 3300005458 Unclassified 1678
102 Ga0070681_10353651 3300005458 Bacteria 1379
103 Ga0070681_10840985 3300005458 Bacteria 835
104 Ga0070681_11332216 3300005458 Bacteria 641
105 Ga0068867_100316526 3300005459 Unclassified 1291
106 Ga0070706_100142185 3300005467 Bacteria 2240
107 Ga0070707_100635284 3300005468 Bacteria 1030
108 Ga0070698_100025599 3300005471 Bacteria 6150
109 Ga0070698_100057238 3300005471 Bacteria 3946
110 Ga0070698_100299014 3300005471 Bacteria 1540
111 Ga0070699_100074642 3300005518 Bacteria 2951
112 Ga0070699_100099661 3300005518 Bacteria 2546
113 Ga0070699_100806266 3300005518 Bacteria 859
114 Ga0070699_101707736 3300005518 Unclassified 577
115 Ga0070679_100059945 3300005530 Bacteria 3792
116 Ga0070679_100138861 3300005530 Bacteria 2411
117 Ga0070679_100450072 3300005530 Unclassified 1232
118 Ga0070679_100989860 3300005530 Bacteria 785
119 Ga0070684_100003238 3300005535 Bacteria 12177
120 Ga0070684_100920162 3300005535 Unclassified 820
121 Ga0068853_100004451 3300005539 Bacteria 10856
122 Ga0068853_100076922 3300005539 Bacteria 2915
123 Ga0068853_100467410 3300005539 Unclassified 1188
124 Ga0068853_100522057 3300005539 Unclassified 1123
125 Ga0070672_100025743 3300005543 Bacteria 4369
126 Ga0070672_100148482 3300005543 Bacteria 1938
127 Ga0070672_101122800 3300005543 Bacteria 699
128 Ga0070686_101034081 3300005544 Bacteria 675
129 Ga0070695_100025393 3300005545 Bacteria 3658
130 Ga0070696_100009400 3300005546 Bacteria 6545
131 Ga0070696_100012892 3300005546 Bacteria 5611
132 Ga0070693_100112322 3300005547 Unclassified 1678
133 Ga0070693_100297914 3300005547 Unclassified 1086
134 Ga0070693_101195099 3300005547 Unclassified 584
135 Ga0070665_100918815 3300005548 Unclassified 888
136 Ga0070665_101449755 3300005548 Bacteria 695
137 Ga0070665_101576840 3300005548 Unclassified 665
138 Ga0070704_100396643 3300005549 Unclassified 1176
139 Ga0068855_100007207 3300005563 Bacteria 13495
140 Ga0068855_100262575 3300005563 Bacteria 1923
141 Ga0068855_100827129 3300005563 Unclassified 983
142 Ga0068855_101461795 3300005563 Bacteria 703
143 Ga0070664_100014442 3300005564 Bacteria 6438
144 Ga0070664_100063712 3300005564 Bacteria 3143
145 Ga0070664_100127526 3300005564 Bacteria 2233
146 Ga0070664_101850624 3300005564 Bacteria 572
147 Ga0068857_100037437 3300005577 Bacteria 4297
148 Ga0068857_101064988 3300005577 Bacteria 780
149 Ga0068857_101321657 3300005577 Bacteria 700
150 Ga0068854_100024769 3300005578 Bacteria 4112
151 Ga0068854_100293111 3300005578 Bacteria 1314
152 Ga0068856_100003385 3300005614 Bacteria 16148
153 Ga0068856_100006230 3300005614 Bacteria 11706
154 Ga0068856_100029868 3300005614 Bacteria 5327
155 Ga0068856_100409436 3300005614 Bacteria 1376
156 Ga0068856_100780751 3300005614 Unclassified 975
157 Ga0068856_101783214 3300005614 Unclassified 627
158 Ga0068856_102017300 3300005614 Unclassified 587
159 Ga0068852_100075176 3300005616 Bacteria 2979
160 Ga0068852_100134074 3300005616 Unclassified 2284
161 Ga0068852_102837392 3300005616 Unclassified 503
162 Ga0068859_100226616 3300005617 Bacteria 1957
163 Ga0068859_100267259 3300005617 Bacteria 1802
164 Ga0068859_100916544 3300005617 Unclassified 961
165 Ga0068859_102188805 3300005617 Unclassified 610
166 Ga0068864_100000841 3300005618 Bacteria 25890
167 Ga0068864_100114451 3300005618 Bacteria 2405
168 Ga0068864_100159951 3300005618 Bacteria 2047
169 Ga0068864_101821933 3300005618 Bacteria 614
170 Ga0068864_101837956 3300005618 Bacteria 611
171 Ga0068864_102024975 3300005618 Bacteria 582
172 Ga0068864_102364233 3300005618 Unclassified 538
173 Ga0068866_10325635 3300005718 Unclassified 968
174 Ga0068861_100010493 3300005719 Bacteria 6430
175 Ga0068861_100132229 3300005719 Unclassified 2026
176 Ga0068861_100205450 3300005719 Bacteria 1656
177 Ga0068851_10000457 3300005834 Bacteria 18129
178 Ga0068851_10549360 3300005834 Unclassified 698
179 Ga0068870_10006062 3300005840 Bacteria 5311
180 Ga0068870_10109265 3300005840 Unclassified 1576
181 Ga0068863_100027650 3300005841 Bacteria 5411
182 Ga0068863_100147927 3300005841 Unclassified 2247
183 Ga0068863_100229248 3300005841 Unclassified 1791
184 Ga0068858_100013104 3300005842 Bacteria 7818
185 Ga0068860_100014659 3300005843 Bacteria 7670
186 Ga0068862_100016324 3300005844 Bacteria 6179
187 Ga0068862_100036063 3300005844 Bacteria 4189
188 Ga0081455_10040570 3300005937 Bacteria 4103
189 Ga0081455_10245942 3300005937 Bacteria 1311
190 Ga0081538_10000830 3300005981 Bacteria 33520
191 Ga0081540_1000689 3300005983 Bacteria 31559
192 Ga0081540_1062866 3300005983 Bacteria 1760
193 Ga0070717_11778426 3300006028 Bacteria 557
194 Ga0070715_10063013 3300006163 Bacteria 1633
195 Ga0070716_100067535 3300006173 Bacteria 2089
196 Ga0070716_100466568 3300006173 Bacteria 924
197 Ga0070712_100563221 3300006175 Unclassified 961
198 Ga0070712_100681750 3300006175 Bacteria 875
199 Ga0070712_101124179 3300006175 Bacteria 682
200 Ga0075366_10062748 3300006195 Bacteria 2208
201 Ga0097621_100009171 3300006237 Bacteria 7172
202 Ga0097621_100256787 3300006237 Unclassified 1532
203 Ga0097621_100284598 3300006237 Unclassified 1456
204 Ga0068871_100026041 3300006358 Bacteria 4559
205 Ga0068871_100074190 3300006358 Unclassified 2806
206 Ga0068871_100327750 3300006358 Unclassified 1350
207 Ga0068871_100437974 3300006358 Unclassified 1170
208 Ga0068871_100456398 3300006358 Unclassified 1146
209 Ga0068871_102369069 3300006358 Bacteria 506
210 Ga0075428_100060102 3300006844 Bacteria 4161
211 Ga0075428_100152732 3300006844 Bacteria 2508
212 Ga0075430_100603733 3300006846 Unclassified 905
213 Ga0075431_100052301 3300006847 Bacteria 4211
214 Ga0075431_100675198 3300006847 Bacteria 1012
215 Ga0075431_100829331 3300006847 Bacteria 897
216 Ga0075433_10001112 3300006852 Bacteria 19430
217 Ga0075433_10223062 3300006852 Bacteria 1674
218 Ga0075433_11041446 3300006852 Unclassified 712
219 Ga0075433_11603121 3300006852 Unclassified 561
220 Ga0075434_100003189 3300006871 Bacteria 14630
221 Ga0075434_100375841 3300006871 Unclassified 1442
222 Ga0075434_101429951 3300006871 Unclassified 701
223 Ga0068865_100243368 3300006881 Unclassified 1416
224 Ga0075436_100614805 3300006914 Bacteria 801
225 Ga0097620_100226601 3300006931 Bacteria 1957
226 Ga0097620_100267247 3300006931 Bacteria 1802
227 Ga0097620_100916534 3300006931 Unclassified 961
228 Ga0097620_102189228 3300006931 Unclassified 610
229 Ga0075435_100032237 3300007076 Bacteria 4137
230 Ga0105251_10117670 3300009011 Bacteria 1208
231 Ga0105240_10012034 3300009093 Bacteria 11994
232 Ga0105240_10017559 3300009093 Bacteria 9640
233 Ga0105240_10517782 3300009093 Unclassified 1324
234 Ga0105240_11029126 3300009093 Unclassified 879
235 Ga0111539_10003831 3300009094 Bacteria 19809
236 Ga0111539_10067648 3300009094 Bacteria 4218
237 Ga0111539_10285013 3300009094 Bacteria 1922
238 Ga0111539_10398881 3300009094 Bacteria 1602
239 Ga0111539_12039158 3300009094 Unclassified 665
240 Ga0105245_11414358 3300009098 Bacteria 746
241 Ga0114129_10037458 3300009147 Bacteria 6846
242 Ga0114129_10243061 3300009147 Bacteria 2419
243 Ga0114129_10461701 3300009147 Bacteria 1664
244 Ga0114129_11530696 3300009147 Bacteria 819
245 Ga0105241_10012204 3300009174 Bacteria 6305
246 Ga0105241_10474295 3300009174 Unclassified 1111
247 Ga0105242_10068067 3300009176 Bacteria 2945
248 Ga0105242_10477497 3300009176 Bacteria 1181
249 Ga0105237_10586760 3300009545 Bacteria 1121
250 Ga0105238_10019514 3300009551 Bacteria 6904
251 Ga0105238_11622146 3300009551 Unclassified 677
252 Ga0105249_10017355 3300009553 Bacteria 6391
253 Ga0105239_10061727 3300010375 Bacteria 4114
254 Ga0157373_10002549 3300013100 Bacteria 13854
255 Ga0157373_10047428 3300013100 Bacteria 3064
256 Ga0157370_10039988 3300013104 Bacteria 4530
257 Ga0157370_10043896 3300013104 Bacteria 4300
258 Ga0157370_10096451 3300013104 Bacteria 2774
259 Ga0157370_10134545 3300013104 Bacteria 2305
260 Ga0157370_10192997 3300013104 Unclassified 1890
261 Ga0157370_10550113 3300013104 Bacteria 1058
262 Ga0157369_10002831 3300013105 Bacteria 20703
263 Ga0157369_10298023 3300013105 Bacteria 1678
264 Ga0157369_10697660 3300013105 Bacteria 1045
265 Ga0157369_10762026 3300013105 Bacteria 995
266 Ga0157369_11871603 3300013105 Unclassified 609
267 Ga0157369_12490289 3300013105 Unclassified 524
268 Ga0157374_10190184 3300013296 Bacteria 2008
269 Ga0157378_10032366 3300013297 Bacteria 4621
270 Ga0157378_10774702 3300013297 Unclassified 983
271 Ga0157378_10803016 3300013297 Unclassified 967
272 Ga0157378_11783025 3300013297 Bacteria 663
273 Ga0163162_10332794 3300013306 Bacteria 1651
274 Ga0163162_10406189 3300013306 Bacteria 1495
275 Ga0157372_10016270 3300013307 Bacteria 7983
276 Ga0157372_10066836 3300013307 Bacteria 4039
277 Ga0157372_10193129 3300013307 Bacteria 2358
278 Ga0157372_10204539 3300013307 Bacteria 2288
279 Ga0157372_10222084 3300013307 Unclassified 2190
280 Ga0157375_10767287 3300013308 Bacteria 1115
281 Ga0157375_11008296 3300013308 Bacteria 972
282 Ga0163163_10024385 3300014325 Bacteria 5757
283 Ga0163163_10044224 3300014325 Bacteria 4368
284 Ga0163163_11399267 3300014325 Unclassified 761
285 Ga0157380_10045652 3300014326 Bacteria 3439
286 Ga0157379_10160855 3300014968 Unclassified 2027
287 Ga0157379_10764361 3300014968 Bacteria 910
288 Ga0157376_10060630 3300014969 Bacteria 3178
289 Ga0157376_10481682 3300014969 Unclassified 1216
290 Ga0157376_12933235 3300014969 Bacteria 516
291 Ga0163161_10012763 3300017792 Bacteria 5835
292 Ga0163161_10017531 3300017792 Bacteria 5012
293 Ga0163161_11321444 3300017792 Bacteria 627
294 Ga0197907_10211369 3300020069 Unclassified 946
295 Ga0206354_10160873 3300020081 Unclassified 1216
296 Ga0206353_10584646 3300020082 Unclassified 694
297 Ga0206353_11840695 3300020082 Bacteria 2979
298 Ga0207656_10002389 3300025321 Bacteria 6315
299 Ga0207656_10003117 3300025321 Bacteria 5681
300 Ga0207682_10154474 3300025893 Bacteria 1037
301 Ga0207692_10146712 3300025898 Bacteria 1347
302 Ga0207710_10636272 3300025900 Bacteria 558
303 Ga0207680_10090608 3300025903 Unclassified 1944
304 Ga0207680_10195095 3300025903 Unclassified 1377
305 Ga0207680_10500692 3300025903 Bacteria 865
306 Ga0207685_10165822 3300025905 Unclassified 1012
307 Ga0207699_10107838 3300025906 Unclassified 1780
308 Ga0207699_10290263 3300025906 Bacteria 1139
309 Ga0207699_10294031 3300025906 Bacteria 1132
310 Ga0207645_10289787 3300025907 Bacteria 1088
311 Ga0207645_10593312 3300025907 Unclassified 752
312 Ga0207643_10009557 3300025908 Bacteria 5209
313 Ga0207643_10021345 3300025908 Bacteria 3557
314 Ga0207705_10320220 3300025909 Bacteria 1191
315 Ga0207705_10658968 3300025909 Bacteria 814
316 Ga0207705_10754153 3300025909 Unclassified 756
317 Ga0207684_10113265 3300025910 Bacteria 2322
318 Ga0207654_10108462 3300025911 Unclassified 1723
319 Ga0207707_10023534 3300025912 Bacteria 5387
320 Ga0207707_10041401 3300025912 Unclassified 4023
321 Ga0207707_10098180 3300025912 Bacteria 2560
322 Ga0207707_10101262 3300025912 Unclassified 2518
323 Ga0207707_10283095 3300025912 Viruses 1436
324 Ga0207707_10331402 3300025912 Bacteria 1313
325 Ga0207695_10004525 3300025913 Bacteria 18922
326 Ga0207695_10029883 3300025913 Bacteria 6011
327 Ga0207695_10810506 3300025913 Unclassified 816
328 Ga0207671_11318228 3300025914 Bacteria 562
329 Ga0207663_10221670 3300025916 Bacteria 1376
330 Ga0207663_10306983 3300025916 Bacteria 1188
331 Ga0207663_10358236 3300025916 Bacteria 1106
332 Ga0207660_10031547 3300025917 Bacteria 3651
333 Ga0207660_10088234 3300025917 Bacteria 2293
334 Ga0207660_10220570 3300025917 Bacteria 1488
335 Ga0207660_10345555 3300025917 Bacteria 1192
336 Ga0207660_10501780 3300025917 Unclassified 984
337 Ga0207657_10000160 3300025919 Bacteria 69252
338 Ga0207657_10086192 3300025919 Bacteria 2629
339 Ga0207657_10428516 3300025919 Bacteria 1039
340 Ga0207657_10764853 3300025919 Unclassified 748
341 Ga0207649_10051967 3300025920 Bacteria 2540
342 Ga0207649_10262342 3300025920 Bacteria 1249
343 Ga0207649_10411138 3300025920 Bacteria 1014
344 Ga0207649_10521067 3300025920 Unclassified 906
345 Ga0207652_10036527 3300025921 Bacteria 4153
346 Ga0207652_10136059 3300025921 Bacteria 2194
347 Ga0207681_10002595 3300025923 Bacteria 11448
348 Ga0207681_10109902 3300025923 Unclassified 2003
349 Ga0207681_10189621 3300025923 Bacteria 1572
350 Ga0207694_10144832 3300025924 Bacteria 1912
351 Ga0207694_10211388 3300025924 Unclassified 1580
352 Ga0207694_10776029 3300025924 Bacteria 809
353 Ga0207650_10016678 3300025925 Bacteria 5135
354 Ga0207650_10059256 3300025925 Bacteria 2853
355 Ga0207650_10386277 3300025925 Unclassified 1157
356 Ga0207650_10401915 3300025925 Bacteria 1134
357 Ga0207650_10478083 3300025925 Unclassified 1039
358 Ga0207650_10505370 3300025925 Unclassified 1010
359 Ga0207659_10241241 3300025926 Unclassified 1462
360 Ga0207659_10452027 3300025926 Bacteria 1082
361 Ga0207659_10756398 3300025926 Unclassified 834
362 Ga0207659_11761141 3300025926 Unclassified 527
363 Ga0207687_10512663 3300025927 Bacteria 1002
364 Ga0207700_11291244 3300025928 Bacteria 650
365 Ga0207664_10053693 3300025929 Bacteria 3191
366 Ga0207664_10213063 3300025929 Bacteria 1672
367 Ga0207664_10297747 3300025929 Bacteria 1419
368 Ga0207644_10003913 3300025931 Bacteria 9660
369 Ga0207644_10080502 3300025931 Unclassified 2406
370 Ga0207644_10176282 3300025931 Bacteria 1673
371 Ga0207644_10446830 3300025931 Bacteria 1062
372 Ga0207644_10826260 3300025931 Bacteria 775
373 Ga0207706_11193811 3300025933 Unclassified 632
374 Ga0207686_10018972 3300025934 Bacteria 3902
375 Ga0207670_10343299 3300025936 Unclassified 1180
376 Ga0207670_10392897 3300025936 Unclassified 1107
377 Ga0207669_10015637 3300025937 Bacteria 3832
378 Ga0207669_10049903 3300025937 Bacteria 2498
379 Ga0207669_10630346 3300025937 Bacteria 875
380 Ga0207704_11078606 3300025938 Unclassified 682
381 Ga0207691_10000368 3300025940 Bacteria 45434
382 Ga0207691_10002837 3300025940 Bacteria 16878
383 Ga0207691_10075030 3300025940 Bacteria 3050
384 Ga0207691_10786805 3300025940 Bacteria 800
385 Ga0207691_10959472 3300025940 Bacteria 714
386 Ga0207711_10428898 3300025941 Unclassified 1230
387 Ga0207711_11035971 3300025941 Bacteria 761
388 Ga0207689_10001809 3300025942 Bacteria 20177
389 Ga0207689_10344669 3300025942 Unclassified 1238
390 Ga0207661_10197849 3300025944 Bacteria 1765
391 Ga0207661_11416675 3300025944 Bacteria 638
392 Ga0207679_10128494 3300025945 Unclassified 2029
393 Ga0207679_10260646 3300025945 Bacteria 1478
394 Ga0207679_11591037 3300025945 Bacteria 599
395 Ga0207667_10001999 3300025949 Bacteria 25585
396 Ga0207667_10025368 3300025949 Bacteria 6488
397 Ga0207667_10281114 3300025949 Bacteria 1701
398 Ga0207667_10301974 3300025949 Unclassified 1636
399 Ga0207667_10631838 3300025949 Bacteria 1077
400 Ga0207667_11901319 3300025949 Unclassified 557
401 Ga0207651_10286000 3300025960 Bacteria 1365
402 Ga0207651_12017190 3300025960 Unclassified 518
403 Ga0207712_10051585 3300025961 Unclassified 2878
404 Ga0207668_10001959 3300025972 Bacteria 12049
405 Ga0207668_10055267 3300025972 Bacteria 2759
406 Ga0207668_10426472 3300025972 Bacteria 1127
407 Ga0207668_11008545 3300025972 Bacteria 744
408 Ga0207640_10331775 3300025981 Unclassified 1215
409 Ga0207640_10549413 3300025981 Bacteria 970
410 Ga0207640_10846921 3300025981 Unclassified 795
411 Ga0207658_10019724 3300025986 Bacteria 4663
412 Ga0207658_10230020 3300025986 Bacteria 1565
413 Ga0207658_10640273 3300025986 Unclassified 958
414 Ga0207677_10145037 3300026023 Unclassified 1823
415 Ga0207677_10160316 3300026023 Unclassified 1747
416 Ga0207677_10190310 3300026023 Bacteria 1622
417 Ga0207677_10647757 3300026023 Unclassified 932
418 Ga0207677_11338168 3300026023 Bacteria 658
419 Ga0207703_10009047 3300026035 Bacteria 7844
420 Ga0207703_10157782 3300026035 Unclassified 1985
421 Ga0207703_10553498 3300026035 Bacteria 1085
422 Ga0207703_10629642 3300026035 Unclassified 1016
423 Ga0207703_11182983 3300026035 Bacteria 735
424 Ga0207703_11888989 3300026035 Unclassified 573
425 Ga0207639_10038616 3300026041 Bacteria 3552
426 Ga0207639_10246026 3300026041 Bacteria 1557
427 Ga0207639_10285339 3300026041 Bacteria 1453
428 Ga0207678_10000797 3300026067 Bacteria 28895
429 Ga0207678_10061500 3300026067 Bacteria 3230
430 Ga0207678_10343877 3300026067 Unclassified 1286
431 Ga0207708_10021861 3300026075 Bacteria 4827
432 Ga0207708_10401935 3300026075 Unclassified 1133
433 Ga0207702_10024608 3300026078 Unclassified 4997
434 Ga0207702_10224100 3300026078 Bacteria 1753
435 Ga0207641_10000735 3300026088 Bacteria 35180
436 Ga0207641_10014305 3300026088 Bacteria 6501
437 Ga0207641_10087438 3300026088 Bacteria 2719
438 Ga0207641_10217122 3300026088 Bacteria 1771
439 Ga0207641_10680208 3300026088 Unclassified 1012
440 Ga0207641_11628651 3300026088 Bacteria 647
441 Ga0207648_10000089 3300026089 Bacteria 86359
442 Ga0207676_10033385 3300026095 Bacteria 3887
443 Ga0207676_10121944 3300026095 Bacteria 2200
444 Ga0207676_10122666 3300026095 Unclassified 2194
445 Ga0207676_10198383 3300026095 Unclassified 1771
446 Ga0207676_10221732 3300026095 Bacteria 1684
447 Ga0207676_10792625 3300026095 Bacteria 924
448 Ga0207676_11635064 3300026095 Unclassified 642
449 Ga0207674_10000236 3300026116 Bacteria 68955
450 Ga0207674_11260379 3300026116 Bacteria 709
451 Ga0207675_100018267 3300026118 Bacteria 6538
452 Ga0207675_100027845 3300026118 Bacteria 5265
453 Ga0207675_100132150 3300026118 Bacteria 2367
454 Ga0207683_10103612 3300026121 Bacteria 2542
455 Ga0207683_10590606 3300026121 Unclassified 1027
456 Ga0207698_10015841 3300026142 Bacteria 5065
457 Ga0207428_10000081 3300027907 Bacteria 136049
458 Ga0207428_10042174 3300027907 Bacteria 3690
459 Ga0207428_10161613 3300027907 Bacteria 1700
460 Ga0207428_10162704 3300027907 Bacteria 1694
461 Ga0268266_10010137 3300028379 Bacteria 8259
462 Ga0268266_10244487 3300028379 Bacteria 1657
463 Ga0268266_10400374 3300028379 Bacteria 1298
464 Ga0268266_11268289 3300028379 Bacteria 712
465 Ga0268265_10017818 3300028380 Bacteria 4910
466 Ga0268265_10056120 3300028380 Unclassified 2995
467 Ga0268264_10755686 3300028381 Bacteria 969
468 Ga0265330_10000580 3300031235 Bacteria 23800
469 Ga0265332_10000141 3300031238 Bacteria 59136
470 Ga0265325_10020311 3300031241 Bacteria 3662
471 Ga0265329_10001151 3300031242 Bacteria 13007
472 Ga0265339_10025885 3300031249 Bacteria 3363
473 Ga0265331_10000298 3300031250 Bacteria 54129
474 Ga0265327_10003686 3300031251 Bacteria 14323
475 Ga0265316_10072482 3300031344 Bacteria 2653
476 Ga0265314_10003464 3300031711 Bacteria 15244
477 Ga0265342_10004733 3300031712 Bacteria 10597
478 Ga0307405_11742641 3300031731 Unclassified 553
479 Ga0307413_10082415 3300031824 Bacteria 2066
480 Ga0307410_10193153 3300031852 Bacteria 1549
481 Ga0307406_10142484 3300031901 Bacteria 1699
482 Ga0307407_10030810 3300031903 Bacteria 2898
483 Ga0307409_100069665 3300031995 Bacteria 2788
484 Ga0307416_100512613 3300032002 Bacteria 1266
485 Ga0307416_102702324 3300032002 Bacteria 593
486 Ga0307411_10004870 3300032005 Bacteria 6520
487 Ga0373948_0044856 3300034817 Bacteria 935
488 Ga0373950_0020873 3300034818 Bacteria 1155
489 Ga0373938_0153734 3300034957 Unclassified 614
490 Ga0373928_0017588 3300035084 Bacteria 1472
491 Ga0373928_0040905 3300035084 Unclassified 1064
492 Ga0373940_0010193 3300035088 Bacteria 2204
493 Ga0373940_0084642 3300035088 Unclassified 942
494 Ga0373940_0177261 3300035088 Bacteria 691
495 Ga0373949_0072103 3300035090 Unclassified 906
496 Ga0373952_0129598 3300035092 Unclassified 691
497 Ga0373952_0209764 3300035092 Bacteria 574
498 Ga0373923_0435081 3300035111 Bacteria 635
499 Ga0373923_0526608 3300035111 Bacteria 578
500 Ga0373932_0120971 3300035112 Bacteria 873
501 Ga0373932_0161951 3300035112 Bacteria 774
502 Ga0373936_0415734 3300035113 Unclassified 619
503 Ga0373939_0044847 3300035114 Bacteria 1347
504 Ga0373945_0329387 3300035116 Bacteria 659
505 Ga0373954_0109349 3300035118 Bacteria 1337
506 Ga0373956_0228119 3300035119 Bacteria 884
507 Ga0373946_0300691 3300035171 Unclassified 793
508 Ga0373955_0666352 3300035172 Bacteria 638
509 Ga0373955_0679034 3300035172 Unclassified 632
510 Ga0373942_0007862 3300035207 Bacteria 2478
511 Ga0373942_0088880 3300035207 Unclassified 928
512 Ga0373961_0013564 3300035241 Bacteria 2057
513 Ga0373962_0198216 3300035242 Bacteria 678
514 Ga0373962_0384434 3300035242 Unclassified 513
515 Ga0316574_0002686 3300035398 Bacteria 8988
516 Ga0373924_0350575 3300035410 Unclassified 658
517 Ga0373924_0477288 3300035410 Bacteria 560
518 Ga0373931_0002223 3300035691 Bacteria 8573
519 Ga0373931_0033622 3300035691 Bacteria 2658
520 Ga0373931_0065223 3300035691 Bacteria 1973
521 Ga0373931_0529800 3300035691 Bacteria 763
522 Ga0373927_0085772 3300035695 Bacteria 2044
523 Ga0373927_0222428 3300035695 Bacteria 1240
524 Ga0373927_0541238 3300035695 Bacteria 770
525 Ga0373937_0136714 3300036401 Bacteria 2292
526 Ga0373937_0228903 3300036401 Bacteria 1750
527 Ga0373937_0560659 3300036401 Bacteria 1085
528 Ga0373937_1909064 3300036401 Bacteria 540
529 Ga0373925_0458322 3300037068 Bacteria 1045
530 Ga0373925_0513597 3300037068 Bacteria 984
531 Ga0395900_0327314 3300037418 Unclassified 1511
532 Ga0395905_0049771 3300037471 Bacteria 3928
533 Ga0466963_0053523 3300044694 Bacteria 2680
534 Ga0453684_0795825 3300044712 Unclassified 1020
535 Ga0466967_0789352 3300045976 Unclassified 943
536 Ga0466967_0978058 3300045976 Bacteria 842
537 Ga0495629_0609603 3300046459 Bacteria 730
538 Ga0495580_0749333 3300046472 Unclassified 636
539 Ga0495584_0360119 3300046491 Unclassified 739
540 Ga0495630_0507527 3300046517 Bacteria 925
541 Ga0495637_0173211 3300046520 Unclassified 804
542 Ga0495656_0426786 3300046615 Unclassified 696
543 Ga0495635_0499446 3300046663 Unclassified 801
544 Ga0495635_0663622 3300046663 Bacteria 678
545 Ga0495657_0079165 3300046675 Bacteria 2129
546 Ga0495647_0455161 3300046681 Unclassified 593
547 Ga0495658_0736028 3300046683 Unclassified 632
548 Ga0496104_1196640 3300048907 Bacteria 663
549 Ga0496106_0193552 3300048909 Bacteria 1617
550 Ga0496109_0240565 3300048912 Bacteria 1704
551 Ga0496109_0537474 3300048912 Unclassified 1103
552 Ga0496109_0703462 3300048912 Bacteria 948
553 Ga0496111_0218254 3300048914 Unclassified 1417
554 Ga0496111_0452866 3300048914 Bacteria 947
555 Ga0496112_0000843 3300048915 Bacteria 21885
556 Ga0496112_0890253 3300048915 Unclassified 812
557 Ga0496113_0112719 3300048916 Unclassified 2119
558 Ga0496113_0235467 3300048916 Bacteria 1461
559 Ga0496114_0231958 3300048917 Bacteria 1622
560 Ga0496114_0684005 3300048917 Bacteria 901
561 Ga0501031_0287857 3300049568 Bacteria 1065
562 Ga0501031_0487216 3300049568 Bacteria 796
563 Ga0501031_0643872 3300049568 Bacteria 681
564 Ga0501032_0003557 3300049569 Bacteria 11879
565 Ga0501032_0013432 3300049569 Bacteria 5824
566 Ga0501034_0087101 3300049571 Bacteria 3123
567 Ga0501034_1046964 3300049571 Bacteria 698
568 Ga0501038_0001368 3300049574 Bacteria 22255
569 Ga0501038_0205272 3300049574 Bacteria 1579
570 Ga0501039_0142075 3300049575 Bacteria 1885
571 Ga0501043_0557901 3300049579 Bacteria 850
572 Ga0501047_0022207 3300049581 Bacteria 6097
573 Ga0501067_0030060 3300049583 Bacteria 3012
574 Ga0501068_0323233 3300049584 Bacteria 989
575 Ga0501070_0000738 3300049586 Bacteria 29944
576 Ga0501072_0099590 3300049588 Bacteria 2310
577 Ga0501073_0003208 3300049589 Bacteria 12278
578 Ga0501074_0061141 3300049590 Bacteria 2714
579 Ga0501076_0749725 3300049592 Bacteria 806
580 Ga0501079_0147856 3300049741 Bacteria 1831
581 Ga0501080_0011550 3300049742 Bacteria 8087
582 Ga0501080_0124653 3300049742 Bacteria 2386
583 Ga0501083_0051750 3300049744 Bacteria 2761
584 Ga0501035_0042645 3300049822 Bacteria 4092
585 Ga0501035_0275203 3300049822 Bacteria 1424
586 Ga0501035_0458931 3300049822 Bacteria 1053
587 Ga0501035_0693068 3300049822 Bacteria 822
588 Ga0501044_1088660 3300049823 Bacteria 669
589 nmdc:mga05p37_212802_c1 3300050507 Bacteria 2336
590 nmdc:mga05p37_23855_c1 3300050507 Bacteria 7429
591 nmdc:mga05p37_53721_c1 3300050507 Bacteria 4955
592 nmdc:mga05p37_712167_c1 3300050507 Bacteria 1113
593 nmdc:mga09592_1332616_c1 3300050508 Unclassified 589
594 nmdc:mga0qj67_704542_c1 3300050509 Unclassified 803
595 nmdc:mga06r32_110079_c1 3300050510 Bacteria 2709
596 nmdc:mga06r32_1120282_c1 3300050510 Bacteria 735
597 nmdc:mga06r32_1404303_c1 3300050510 Bacteria 640
598 nmdc:mga06r32_278091_c1 3300050510 Bacteria 1661
599 nmdc:mga06r32_90299_c1 3300050510 Bacteria 2992
600 nmdc:mga08y16_229081_c1 3300050511 Bacteria 1922
601 nmdc:mga08y16_31_c1 3300050511 Bacteria 195124
602 nmdc:mga08y16_666496_c1 3300050511 Unclassified 1043
603 nmdc:mga08y16_74519_c1 3300050511 Bacteria 3537
604 nmdc:mga0n895_2090713_c1 3300050512 Unclassified 523
605 nmdc:mga0n895_4648_c1 3300050512 Bacteria 11325
606 nmdc:mga0rr50_9393_c1 3300050513 Bacteria 6144
607 nmdc:mga0a205_1085114_c1 3300050515 Unclassified 648
608 nmdc:mga0a205_249639_c1 3300050515 Bacteria 1654
609 nmdc:mga0a205_58448_c1 3300050515 Bacteria 3725
610 Ga0495595_0072245 3300053084 Bacteria 1632
611 Ga0495619_0352685 3300053085 Bacteria 1018
612 Ga0495619_0985415 3300053085 Bacteria 564
613 Ga0501084_0107241 3300054114 Bacteria 2347
614 Ga0590077_009215 3300059426 Bacteria 2022
615 Ga0501082_0174134 3300060353 Bacteria 1871

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009093 Ga0105240_10017559 Ga0105240_100175594 119
2 3300009174 Ga0105241_10012204 Ga0105241_100122044 119
3 3300009551 Ga0105238_10019514 Ga0105238_100195142 119
4 3300010375 Ga0105239_10061727 Ga0105239_100617273 119
5 3300013100 Ga0157373_10002549 Ga0157373_1000254912 119
6 3300013104 Ga0157370_10192997 Ga0157370_101929973 119
7 3300013105 Ga0157369_10762026 Ga0157369_107620262 119
8 3300035113 Ga0373936_0415734 Ga0373936_0415734_245_607 119
9 3300035171 Ga0373946_0300691 Ga0373946_0300691_278_640 119
10 3300035172 Ga0373955_0679034 Ga0373955_0679034_59_421 119
11 3300035410 Ga0373924_0350575 Ga0373924_0350575_142_504 119
12 3300035410 Ga0373924_0477288 Ga0373924_0477288_153_515 119
13 3300035695 Ga0373927_0222428 Ga0373927_0222428_17_379 119
14 3300037418 Ga0395900_0327314 Ga0395900_0327314_490_888 119
15 3300046472 Ga0495580_0749333 Ga0495580_0749333_142_504 119
16 3300046681 Ga0495647_0455161 Ga0495647_0455161_59_421 119
17 3300048916 Ga0496113_0235467 Ga0496113_0235467_699_1097 119
18 3300050512 nmdc:mga0n895_2090713_c1 nmdc:mga0n895_2090713_c1_44_406 119
19 3300005438 Ga0070701_10078614 Ga0070701_100786144 120
20 3300006195 Ga0075366_10062748 Ga0075366_100627483 120
21 3300009011 Ga0105251_10117670 Ga0105251_101176702 121
22 3300009174 Ga0105241_10474295 Ga0105241_104742952 121
23 3300009176 Ga0105242_10068067 Ga0105242_100680673 121
24 3300009553 Ga0105249_10017355 Ga0105249_100173552 121
25 3300013297 Ga0157378_10032366 Ga0157378_100323663 121
26 3300013308 Ga0157375_11008296 Ga0157375_110082962 121
27 3300014325 Ga0163163_10024385 Ga0163163_100243853 121
28 3300014326 Ga0157380_10045652 Ga0157380_100456524 121
29 3300014968 Ga0157379_10160855 Ga0157379_101608551 121
30 3300014969 Ga0157376_12933235 Ga0157376_129332351 121
31 3300048912 Ga0496109_0537474 Ga0496109_0537474_677_1051 121
32 3300046663 Ga0495635_0663622 Ga0495635_0663622_14_394 122
33 3300005327 Ga0070658_10228101 Ga0070658_102281011 123
34 3300005329 Ga0070683_100606557 Ga0070683_1006065572 123
35 3300005330 Ga0070690_101766116 Ga0070690_1017661161 123
36 3300005333 Ga0070677_10226025 Ga0070677_102260252 123
37 3300005345 Ga0070692_10934002 Ga0070692_109340022 123
38 3300005355 Ga0070671_101278973 Ga0070671_1012789731 123
39 3300005355 Ga0070671_101948687 Ga0070671_1019486871 123
40 3300005367 Ga0070667_100246002 Ga0070667_1002460022 123
41 3300005539 Ga0068853_100522057 Ga0068853_1005220572 123
42 3300005543 Ga0070672_101122800 Ga0070672_1011228002 123
43 3300005548 Ga0070665_101576840 Ga0070665_1015768402 123
44 3300005564 Ga0070664_101850624 Ga0070664_1018506242 123
45 3300005614 Ga0068856_102017300 Ga0068856_1020173001 123
46 3300005616 Ga0068852_102837392 Ga0068852_1028373921 123
47 3300005617 Ga0068859_102188805 Ga0068859_1021888052 123
48 3300005618 Ga0068864_101821933 Ga0068864_1018219332 123
49 3300005834 Ga0068851_10549360 Ga0068851_105493602 123
50 3300006931 Ga0097620_102189228 Ga0097620_1021892282 123
51 3300013104 Ga0157370_10550113 Ga0157370_105501132 123
52 3300025919 Ga0207657_10764853 Ga0207657_107648531 123
53 3300025920 Ga0207649_10521067 Ga0207649_105210672 123
54 3300025925 Ga0207650_10401915 Ga0207650_104019152 123
55 3300025931 Ga0207644_10176282 Ga0207644_101762822 123
56 3300025940 Ga0207691_10786805 Ga0207691_107868052 123
57 3300025941 Ga0207711_11035971 Ga0207711_110359712 123
58 3300025960 Ga0207651_10286000 Ga0207651_102860002 123
59 3300025986 Ga0207658_10640273 Ga0207658_106402732 123
60 3300026023 Ga0207677_10647757 Ga0207677_106477572 123
61 3300026067 Ga0207678_10061500 Ga0207678_100615002 123
62 3300026095 Ga0207676_10792625 Ga0207676_107926251 123
63 3300049568 Ga0501031_0487216 Ga0501031_0487216_91_465 123
64 3300005327 Ga0070658_10131831 Ga0070658_101318312 124
65 3300005327 Ga0070658_10184180 Ga0070658_101841802 124
66 3300005329 Ga0070683_100030094 Ga0070683_1000300943 124
67 3300005329 Ga0070683_100109442 Ga0070683_1001094423 124
68 3300005329 Ga0070683_100916236 Ga0070683_1009162361 124
69 3300005331 Ga0070670_100016039 Ga0070670_1000160393 124
70 3300005331 Ga0070670_100017719 Ga0070670_1000177193 124
71 3300005331 Ga0070670_100533647 Ga0070670_1005336471 124
72 3300005336 Ga0070680_100171575 Ga0070680_1001715752 124
73 3300005336 Ga0070680_100560931 Ga0070680_1005609312 124
74 3300005336 Ga0070680_100798877 Ga0070680_1007988771 124
75 3300005336 Ga0070680_101415430 Ga0070680_1014154301 124
76 3300005337 Ga0070682_100006581 Ga0070682_1000065816 124
77 3300005338 Ga0068868_100575467 Ga0068868_1005754672 124
78 3300005338 Ga0068868_101604875 Ga0068868_1016048752 124
79 3300005339 Ga0070660_100074822 Ga0070660_1000748223 124
80 3300005339 Ga0070660_100083449 Ga0070660_1000834492 124
81 3300005339 Ga0070660_100116430 Ga0070660_1001164303 124
82 3300005339 Ga0070660_100751133 Ga0070660_1007511332 124
83 3300005344 Ga0070661_100004383 Ga0070661_1000043832 124
84 3300005344 Ga0070661_100059040 Ga0070661_1000590404 124
85 3300005344 Ga0070661_100095951 Ga0070661_1000959513 124
86 3300005344 Ga0070661_100808476 Ga0070661_1008084762 124
87 3300005345 Ga0070692_10024547 Ga0070692_100245473 124
88 3300005356 Ga0070674_100216515 Ga0070674_1002165152 124
89 3300005366 Ga0070659_100005229 Ga0070659_1000052295 124
90 3300005366 Ga0070659_100252463 Ga0070659_1002524632 124
91 3300005366 Ga0070659_101784936 Ga0070659_1017849361 124
92 3300005434 Ga0070709_10114820 Ga0070709_101148202 124
93 3300005434 Ga0070709_10218638 Ga0070709_102186382 124
94 3300005435 Ga0070714_100009546 Ga0070714_1000095464 124
95 3300005435 Ga0070714_100016715 Ga0070714_1000167155 124
96 3300005435 Ga0070714_100557635 Ga0070714_1005576352 124
97 3300005436 Ga0070713_101225203 Ga0070713_1012252032 124
98 3300005437 Ga0070710_10059970 Ga0070710_100599701 124
99 3300005439 Ga0070711_100061572 Ga0070711_1000615723 124
100 3300005455 Ga0070663_100013346 Ga0070663_1000133464 124
101 3300005455 Ga0070663_100064699 Ga0070663_1000646992 124
102 3300005456 Ga0070678_100738170 Ga0070678_1007381702 124
103 3300005457 Ga0070662_100212177 Ga0070662_1002121772 124
104 3300005457 Ga0070662_101379886 Ga0070662_1013798861 124
105 3300005458 Ga0070681_10002557 Ga0070681_1000255710 124
106 3300005458 Ga0070681_10017663 Ga0070681_100176638 124
107 3300005458 Ga0070681_10251868 Ga0070681_102518682 124
108 3300005458 Ga0070681_11332216 Ga0070681_113322162 124
109 3300005471 Ga0070698_100025599 Ga0070698_1000255992 124
110 3300005518 Ga0070699_100099661 Ga0070699_1000996612 124
111 3300005518 Ga0070699_101707736 Ga0070699_1017077362 124
112 3300005530 Ga0070679_100138861 Ga0070679_1001388613 124
113 3300005530 Ga0070679_100450072 Ga0070679_1004500722 124
114 3300005530 Ga0070679_100989860 Ga0070679_1009898602 124
115 3300005535 Ga0070684_100003238 Ga0070684_1000032382 124
116 3300005539 Ga0068853_100004451 Ga0068853_1000044512 124
117 3300005546 Ga0070696_100012892 Ga0070696_1000128921 124
118 3300005547 Ga0070693_100112322 Ga0070693_1001123222 124
119 3300005547 Ga0070693_100297914 Ga0070693_1002979142 124
120 3300005548 Ga0070665_100918815 Ga0070665_1009188152 124
121 3300005563 Ga0068855_100007207 Ga0068855_1000072077 124
122 3300005563 Ga0068855_100262575 Ga0068855_1002625753 124
123 3300005563 Ga0068855_100827129 Ga0068855_1008271291 124
124 3300005563 Ga0068855_101461795 Ga0068855_1014617952 124
125 3300005564 Ga0070664_100014442 Ga0070664_1000144425 124
126 3300005564 Ga0070664_100063712 Ga0070664_1000637124 124
127 3300005564 Ga0070664_100127526 Ga0070664_1001275264 124
128 3300005577 Ga0068857_100037437 Ga0068857_1000374374 124
129 3300005578 Ga0068854_100024769 Ga0068854_1000247692 124
130 3300005578 Ga0068854_100293111 Ga0068854_1002931112 124
131 3300005614 Ga0068856_100003385 Ga0068856_10000338511 124
132 3300005614 Ga0068856_100006230 Ga0068856_1000062306 124
133 3300005614 Ga0068856_100029868 Ga0068856_1000298684 124
134 3300005614 Ga0068856_100780751 Ga0068856_1007807512 124
135 3300005616 Ga0068852_100075176 Ga0068852_1000751763 124
136 3300005616 Ga0068852_100134074 Ga0068852_1001340742 124
137 3300005618 Ga0068864_102364233 Ga0068864_1023642332 124
138 3300005834 Ga0068851_10000457 Ga0068851_1000045715 124
139 3300005840 Ga0068870_10109265 Ga0068870_101092651 124
140 3300005841 Ga0068863_100229248 Ga0068863_1002292482 124
141 3300006028 Ga0070717_11778426 Ga0070717_117784262 124
142 3300006175 Ga0070712_100563221 Ga0070712_1005632212 124
143 3300006237 Ga0097621_100284598 Ga0097621_1002845982 124
144 3300006358 Ga0068871_100327750 Ga0068871_1003277502 124
145 3300006358 Ga0068871_100456398 Ga0068871_1004563982 124
146 3300006914 Ga0075436_100614805 Ga0075436_1006148052 124
147 3300009093 Ga0105240_10012034 Ga0105240_1001203410 124
148 3300009093 Ga0105240_10517782 Ga0105240_105177822 124
149 3300009093 Ga0105240_11029126 Ga0105240_110291262 124
150 3300009147 Ga0114129_11530696 Ga0114129_115306962 124
151 3300009551 Ga0105238_11622146 Ga0105238_116221462 124
152 3300013104 Ga0157370_10043896 Ga0157370_100438965 124
153 3300013104 Ga0157370_10096451 Ga0157370_100964512 124
154 3300013104 Ga0157370_10134545 Ga0157370_101345454 124
155 3300013105 Ga0157369_10002831 Ga0157369_100028315 124
156 3300013105 Ga0157369_10298023 Ga0157369_102980232 124
157 3300013105 Ga0157369_10697660 Ga0157369_106976602 124
158 3300013105 Ga0157369_11871603 Ga0157369_118716032 124
159 3300013296 Ga0157374_10190184 Ga0157374_101901843 124
160 3300013307 Ga0157372_10016270 Ga0157372_100162704 124
161 3300013307 Ga0157372_10193129 Ga0157372_101931293 124
162 3300013307 Ga0157372_10204539 Ga0157372_102045393 124
163 3300013307 Ga0157372_10222084 Ga0157372_102220844 124
164 3300014325 Ga0163163_11399267 Ga0163163_113992672 124
165 3300017792 Ga0163161_10012763 Ga0163161_100127632 124
166 3300020069 Ga0197907_10211369 Ga0197907_102113692 124
167 3300020081 Ga0206354_10160873 Ga0206354_101608732 124
168 3300020082 Ga0206353_10584646 Ga0206353_105846462 124
169 3300020082 Ga0206353_11840695 Ga0206353_118406954 124
170 3300025321 Ga0207656_10002389 Ga0207656_100023893 124
171 3300025321 Ga0207656_10003117 Ga0207656_100031173 124
172 3300025893 Ga0207682_10154474 Ga0207682_101544742 124
173 3300025898 Ga0207692_10146712 Ga0207692_101467122 124
174 3300025903 Ga0207680_10500692 Ga0207680_105006922 124
175 3300025906 Ga0207699_10107838 Ga0207699_101078382 124
176 3300025908 Ga0207643_10021345 Ga0207643_100213455 124
177 3300025909 Ga0207705_10320220 Ga0207705_103202202 124
178 3300025909 Ga0207705_10658968 Ga0207705_106589682 124
179 3300025909 Ga0207705_10754153 Ga0207705_107541532 124
180 3300025911 Ga0207654_10108462 Ga0207654_101084622 124
181 3300025912 Ga0207707_10041401 Ga0207707_100414015 124
182 3300025912 Ga0207707_10098180 Ga0207707_100981803 124
183 3300025912 Ga0207707_10101262 Ga0207707_101012623 124
184 3300025912 Ga0207707_10331402 Ga0207707_103314022 124
185 3300025913 Ga0207695_10004525 Ga0207695_1000452518 124
186 3300025913 Ga0207695_10029883 Ga0207695_100298835 124
187 3300025913 Ga0207695_10810506 Ga0207695_108105061 124
188 3300025916 Ga0207663_10358236 Ga0207663_103582362 124
189 3300025917 Ga0207660_10031547 Ga0207660_100315472 124
190 3300025917 Ga0207660_10220570 Ga0207660_102205703 124
191 3300025917 Ga0207660_10345555 Ga0207660_103455552 124
192 3300025917 Ga0207660_10501780 Ga0207660_105017802 124
193 3300025919 Ga0207657_10000160 Ga0207657_1000016039 124
194 3300025919 Ga0207657_10086192 Ga0207657_100861923 124
195 3300025919 Ga0207657_10428516 Ga0207657_104285162 124
196 3300025920 Ga0207649_10051967 Ga0207649_100519672 124
197 3300025920 Ga0207649_10411138 Ga0207649_104111382 124
198 3300025921 Ga0207652_10036527 Ga0207652_100365273 124
199 3300025921 Ga0207652_10136059 Ga0207652_101360592 124
200 3300025923 Ga0207681_10002595 Ga0207681_100025952 124
201 3300025924 Ga0207694_10211388 Ga0207694_102113883 124
202 3300025924 Ga0207694_10776029 Ga0207694_107760292 124
203 3300025925 Ga0207650_10386277 Ga0207650_103862772 124
204 3300025925 Ga0207650_10505370 Ga0207650_105053701 124
205 3300025926 Ga0207659_10756398 Ga0207659_107563981 124
206 3300025927 Ga0207687_10512663 Ga0207687_105126632 124
207 3300025929 Ga0207664_10053693 Ga0207664_100536934 124
208 3300025929 Ga0207664_10213063 Ga0207664_102130632 124
209 3300025929 Ga0207664_10297747 Ga0207664_102977473 124
210 3300025931 Ga0207644_10003913 Ga0207644_100039132 124
211 3300025933 Ga0207706_11193811 Ga0207706_111938111 124
212 3300025936 Ga0207670_10392897 Ga0207670_103928971 124
213 3300025937 Ga0207669_10015637 Ga0207669_100156373 124
214 3300025940 Ga0207691_10000368 Ga0207691_1000036817 124
215 3300025944 Ga0207661_10197849 Ga0207661_101978493 124
216 3300025944 Ga0207661_11416675 Ga0207661_114166751 124
217 3300025945 Ga0207679_10128494 Ga0207679_101284942 124
218 3300025945 Ga0207679_11591037 Ga0207679_115910371 124
219 3300025949 Ga0207667_10001999 Ga0207667_1000199920 124
220 3300025949 Ga0207667_10025368 Ga0207667_100253684 124
221 3300025949 Ga0207667_10281114 Ga0207667_102811143 124
222 3300025949 Ga0207667_10301974 Ga0207667_103019743 124
223 3300025949 Ga0207667_10631838 Ga0207667_106318382 124
224 3300025949 Ga0207667_11901319 Ga0207667_119013191 124
225 3300025972 Ga0207668_10001959 Ga0207668_100019593 124
226 3300025981 Ga0207640_10331775 Ga0207640_103317752 124
227 3300025981 Ga0207640_10549413 Ga0207640_105494132 124
228 3300025981 Ga0207640_10846921 Ga0207640_108469212 124
229 3300025986 Ga0207658_10019724 Ga0207658_100197243 124
230 3300026023 Ga0207677_10145037 Ga0207677_101450372 124
231 3300026023 Ga0207677_10190310 Ga0207677_101903101 124
232 3300026023 Ga0207677_11338168 Ga0207677_113381682 124
233 3300026035 Ga0207703_10009047 Ga0207703_100090473 124
234 3300026041 Ga0207639_10038616 Ga0207639_100386164 124
235 3300026067 Ga0207678_10000797 Ga0207678_1000079713 124
236 3300026067 Ga0207678_10343877 Ga0207678_103438772 124
237 3300026078 Ga0207702_10024608 Ga0207702_100246084 124
238 3300026078 Ga0207702_10224100 Ga0207702_102241002 124
239 3300026088 Ga0207641_10000735 Ga0207641_100007355 124
240 3300026088 Ga0207641_11628651 Ga0207641_116286512 124
241 3300026089 Ga0207648_10000089 Ga0207648_1000008931 124
242 3300026095 Ga0207676_10221732 Ga0207676_102217322 124
243 3300026095 Ga0207676_11635064 Ga0207676_116350642 124
244 3300026116 Ga0207674_10000236 Ga0207674_1000023623 124
245 3300026118 Ga0207675_100132150 Ga0207675_1001321503 124
246 3300026121 Ga0207683_10590606 Ga0207683_105906062 124
247 3300026142 Ga0207698_10015841 Ga0207698_100158414 124
248 3300028379 Ga0268266_10244487 Ga0268266_102444871 124
249 3300028379 Ga0268266_10400374 Ga0268266_104003742 124
250 3300031731 Ga0307405_11742641 Ga0307405_117426411 124
251 3300032002 Ga0307416_102702324 Ga0307416_1027023241 124
252 3300035112 Ga0373932_0120971 Ga0373932_0120971_21_422 124
253 3300035118 Ga0373954_0109349 Ga0373954_0109349_374_772 124
254 3300035119 Ga0373956_0228119 Ga0373956_0228119_354_752 124
255 3300035691 Ga0373931_0065223 Ga0373931_0065223_104_505 124
256 3300035691 Ga0373931_0529800 Ga0373931_0529800_299_685 124
257 3300036401 Ga0373937_0228903 Ga0373937_0228903_195_593 124
258 3300037471 Ga0395905_0049771 Ga0395905_0049771_1399_1812 124
259 3300044694 Ga0466963_0053523 Ga0466963_0053523_1975_2361 124
260 3300045976 Ga0466967_0978058 Ga0466967_0978058_343_744 124
261 3300046683 Ga0495658_0736028 Ga0495658_0736028_203_589 124
262 3300048909 Ga0496106_0193552 Ga0496106_0193552_1120_1518 124
263 3300053085 Ga0495619_0985415 Ga0495619_0985415_75_473 124
264 3300005437 Ga0070710_10548033 Ga0070710_105480332 125
265 3300005439 Ga0070711_100254872 Ga0070711_1002548722 125
266 3300005445 Ga0070708_100062093 Ga0070708_1000620932 125
267 3300005471 Ga0070698_100299014 Ga0070698_1002990142 125
268 3300006871 Ga0075434_101429951 Ga0075434_1014299512 125
269 3300025916 Ga0207663_10306983 Ga0207663_103069832 125
270 3300031235 Ga0265330_10000580 Ga0265330_1000058010 125
271 3300031238 Ga0265332_10000141 Ga0265332_100001418 125
272 3300031241 Ga0265325_10020311 Ga0265325_100203114 125
273 3300031242 Ga0265329_10001151 Ga0265329_100011517 125
274 3300031249 Ga0265339_10025885 Ga0265339_100258852 125
275 3300031250 Ga0265331_10000298 Ga0265331_1000029834 125
276 3300031251 Ga0265327_10003686 Ga0265327_1000368613 125
277 3300031344 Ga0265316_10072482 Ga0265316_100724823 125
278 3300031711 Ga0265314_10003464 Ga0265314_100034648 125
279 3300031712 Ga0265342_10004733 Ga0265342_100047333 125
280 3300035111 Ga0373923_0526608 Ga0373923_0526608_81_473 125
281 3300036401 Ga0373937_1909064 Ga0373937_1909064_97_489 125
282 3300045976 Ga0466967_0789352 Ga0466967_0789352_327_719 125
283 3300046663 Ga0495635_0499446 Ga0495635_0499446_16_402 125
284 3300053084 Ga0495595_0072245 Ga0495595_0072245_950_1336 125
285 3300005328 Ga0070676_10351451 Ga0070676_103514512 126
286 3300005330 Ga0070690_100021326 Ga0070690_1000213265 126
287 3300005331 Ga0070670_100030694 Ga0070670_1000306943 126
288 3300005331 Ga0070670_100073088 Ga0070670_1000730883 126
289 3300005331 Ga0070670_100553470 Ga0070670_1005534702 126
290 3300005334 Ga0068869_100015730 Ga0068869_1000157304 126
291 3300005334 Ga0068869_100117232 Ga0068869_1001172323 126
292 3300005334 Ga0068869_101034802 Ga0068869_1010348021 126
293 3300005335 Ga0070666_10784153 Ga0070666_107841532 126
294 3300005340 Ga0070689_100772089 Ga0070689_1007720892 126
295 3300005347 Ga0070668_100132512 Ga0070668_1001325122 126
296 3300005347 Ga0070668_100216125 Ga0070668_1002161252 126
297 3300005347 Ga0070668_100788404 Ga0070668_1007884041 126
298 3300005353 Ga0070669_100194598 Ga0070669_1001945982 126
299 3300005354 Ga0070675_100008923 Ga0070675_1000089237 126
300 3300005354 Ga0070675_100026327 Ga0070675_1000263276 126
301 3300005354 Ga0070675_100414976 Ga0070675_1004149762 126
302 3300005354 Ga0070675_101274279 Ga0070675_1012742791 126
303 3300005355 Ga0070671_100037619 Ga0070671_1000376191 126
304 3300005355 Ga0070671_100066394 Ga0070671_1000663943 126
305 3300005355 Ga0070671_100831820 Ga0070671_1008318202 126
306 3300005355 Ga0070671_101705110 Ga0070671_1017051102 126
307 3300005356 Ga0070674_100070820 Ga0070674_1000708202 126
308 3300005356 Ga0070674_100714626 Ga0070674_1007146261 126
309 3300005364 Ga0070673_100015316 Ga0070673_1000153167 126
310 3300005367 Ga0070667_100744729 Ga0070667_1007447292 126
311 3300005367 Ga0070667_100988836 Ga0070667_1009888361 126
312 3300005438 Ga0070701_10780902 Ga0070701_107809021 126
313 3300005440 Ga0070705_100050646 Ga0070705_1000506463 126
314 3300005440 Ga0070705_100559572 Ga0070705_1005595722 126
315 3300005441 Ga0070700_100169471 Ga0070700_1001694712 126
316 3300005441 Ga0070700_100464481 Ga0070700_1004644811 126
317 3300005444 Ga0070694_100283316 Ga0070694_1002833162 126
318 3300005445 Ga0070708_101060919 Ga0070708_1010609192 126
319 3300005456 Ga0070678_100672357 Ga0070678_1006723572 126
320 3300005457 Ga0070662_101271960 Ga0070662_1012719602 126
321 3300005459 Ga0068867_100316526 Ga0068867_1003165262 126
322 3300005518 Ga0070699_100074642 Ga0070699_1000746423 126
323 3300005535 Ga0070684_100920162 Ga0070684_1009201622 126
324 3300005543 Ga0070672_100025743 Ga0070672_1000257432 126
325 3300005543 Ga0070672_100148482 Ga0070672_1001484822 126
326 3300005544 Ga0070686_101034081 Ga0070686_1010340812 126
327 3300005546 Ga0070696_100009400 Ga0070696_1000094006 126
328 3300005547 Ga0070693_101195099 Ga0070693_1011950991 126
329 3300005548 Ga0070665_101449755 Ga0070665_1014497552 126
330 3300005549 Ga0070704_100396643 Ga0070704_1003966432 126
331 3300005614 Ga0068856_101783214 Ga0068856_1017832142 126
332 3300005617 Ga0068859_100226616 Ga0068859_1002266162 126
333 3300005617 Ga0068859_100267259 Ga0068859_1002672594 126
334 3300005617 Ga0068859_100916544 Ga0068859_1009165442 126
335 3300005618 Ga0068864_100000841 Ga0068864_10000084115 126
336 3300005618 Ga0068864_100114451 Ga0068864_1001144512 126
337 3300005618 Ga0068864_100159951 Ga0068864_1001599512 126
338 3300005618 Ga0068864_102024975 Ga0068864_1020249751 126
339 3300005718 Ga0068866_10325635 Ga0068866_103256352 126
340 3300005719 Ga0068861_100132229 Ga0068861_1001322292 126
341 3300005719 Ga0068861_100205450 Ga0068861_1002054502 126
342 3300005840 Ga0068870_10006062 Ga0068870_100060622 126
343 3300005841 Ga0068863_100027650 Ga0068863_1000276504 126
344 3300005841 Ga0068863_100147927 Ga0068863_1001479272 126
345 3300005842 Ga0068858_100013104 Ga0068858_1000131048 126
346 3300005843 Ga0068860_100014659 Ga0068860_1000146592 126
347 3300005844 Ga0068862_100016324 Ga0068862_1000163243 126
348 3300005844 Ga0068862_100036063 Ga0068862_1000360632 126
349 3300005981 Ga0081538_10000830 Ga0081538_1000083025 126
350 3300006175 Ga0070712_101124179 Ga0070712_1011241792 126
351 3300006237 Ga0097621_100009171 Ga0097621_1000091714 126
352 3300006237 Ga0097621_100256787 Ga0097621_1002567872 126
353 3300006358 Ga0068871_100026041 Ga0068871_1000260413 126
354 3300006358 Ga0068871_100074190 Ga0068871_1000741902 126
355 3300006358 Ga0068871_100437974 Ga0068871_1004379742 126
356 3300006846 Ga0075430_100603733 Ga0075430_1006037332 126
357 3300006847 Ga0075431_100829331 Ga0075431_1008293312 126
358 3300006852 Ga0075433_10223062 Ga0075433_102230623 126
359 3300006871 Ga0075434_100375841 Ga0075434_1003758412 126
360 3300006881 Ga0068865_100243368 Ga0068865_1002433683 126
361 3300006931 Ga0097620_100226601 Ga0097620_1002266012 126
362 3300006931 Ga0097620_100267247 Ga0097620_1002672471 126
363 3300006931 Ga0097620_100916534 Ga0097620_1009165342 126
364 3300009094 Ga0111539_10003831 Ga0111539_1000383116 126
365 3300009176 Ga0105242_10477497 Ga0105242_104774971 126
366 3300013297 Ga0157378_10774702 Ga0157378_107747022 126
367 3300013297 Ga0157378_10803016 Ga0157378_108030162 126
368 3300013297 Ga0157378_11783025 Ga0157378_117830252 126
369 3300013306 Ga0163162_10332794 Ga0163162_103327942 126
370 3300013306 Ga0163162_10406189 Ga0163162_104061892 126
371 3300013308 Ga0157375_10767287 Ga0157375_107672872 126
372 3300014968 Ga0157379_10764361 Ga0157379_107643611 126
373 3300014969 Ga0157376_10060630 Ga0157376_100606305 126
374 3300014969 Ga0157376_10481682 Ga0157376_104816822 126
375 3300017792 Ga0163161_10017531 Ga0163161_100175312 126
376 3300017792 Ga0163161_11321444 Ga0163161_113214442 126
377 3300025903 Ga0207680_10090608 Ga0207680_100906082 126
378 3300025903 Ga0207680_10195095 Ga0207680_101950952 126
379 3300025907 Ga0207645_10289787 Ga0207645_102897872 126
380 3300025907 Ga0207645_10593312 Ga0207645_105933122 126
381 3300025908 Ga0207643_10009557 Ga0207643_100095577 126
382 3300025923 Ga0207681_10109902 Ga0207681_101099023 126
383 3300025923 Ga0207681_10189621 Ga0207681_101896213 126
384 3300025925 Ga0207650_10016678 Ga0207650_100166783 126
385 3300025925 Ga0207650_10059256 Ga0207650_100592565 126
386 3300025925 Ga0207650_10478083 Ga0207650_104780832 126
387 3300025926 Ga0207659_10241241 Ga0207659_102412413 126
388 3300025926 Ga0207659_10452027 Ga0207659_104520271 126
389 3300025926 Ga0207659_11761141 Ga0207659_117611411 126
390 3300025931 Ga0207644_10080502 Ga0207644_100805024 126
391 3300025931 Ga0207644_10446830 Ga0207644_104468302 126
392 3300025931 Ga0207644_10826260 Ga0207644_108262602 126
393 3300025934 Ga0207686_10018972 Ga0207686_100189722 126
394 3300025936 Ga0207670_10343299 Ga0207670_103432992 126
395 3300025937 Ga0207669_10049903 Ga0207669_100499032 126
396 3300025937 Ga0207669_10630346 Ga0207669_106303461 126
397 3300025938 Ga0207704_11078606 Ga0207704_110786062 126
398 3300025940 Ga0207691_10002837 Ga0207691_1000283714 126
399 3300025940 Ga0207691_10075030 Ga0207691_100750302 126
400 3300025940 Ga0207691_10959472 Ga0207691_109594722 126
401 3300025941 Ga0207711_10428898 Ga0207711_104288982 126
402 3300025942 Ga0207689_10001809 Ga0207689_1000180911 126
403 3300025942 Ga0207689_10344669 Ga0207689_103446692 126
404 3300025945 Ga0207679_10260646 Ga0207679_102606462 126
405 3300025960 Ga0207651_12017190 Ga0207651_120171901 126
406 3300025961 Ga0207712_10051585 Ga0207712_100515852 126
407 3300025972 Ga0207668_10055267 Ga0207668_100552672 126
408 3300025972 Ga0207668_10426472 Ga0207668_104264722 126
409 3300025972 Ga0207668_11008545 Ga0207668_110085452 126
410 3300025986 Ga0207658_10230020 Ga0207658_102300203 126
411 3300026023 Ga0207677_10160316 Ga0207677_101603162 126
412 3300026035 Ga0207703_10157782 Ga0207703_101577822 126
413 3300026035 Ga0207703_10553498 Ga0207703_105534982 126
414 3300026035 Ga0207703_10629642 Ga0207703_106296421 126
415 3300026035 Ga0207703_11888989 Ga0207703_118889892 126
416 3300026075 Ga0207708_10021861 Ga0207708_100218614 126
417 3300026075 Ga0207708_10401935 Ga0207708_104019352 126
418 3300026088 Ga0207641_10014305 Ga0207641_100143056 126
419 3300026088 Ga0207641_10087438 Ga0207641_100874382 126
420 3300026088 Ga0207641_10217122 Ga0207641_102171223 126
421 3300026088 Ga0207641_10680208 Ga0207641_106802082 126
422 3300026095 Ga0207676_10033385 Ga0207676_100333853 126
423 3300026095 Ga0207676_10121944 Ga0207676_101219443 126
424 3300026095 Ga0207676_10122666 Ga0207676_101226662 126
425 3300026095 Ga0207676_10198383 Ga0207676_101983832 126
426 3300026118 Ga0207675_100027845 Ga0207675_1000278457 126
427 3300026121 Ga0207683_10103612 Ga0207683_101036123 126
428 3300027907 Ga0207428_10000081 Ga0207428_1000008154 126
429 3300028379 Ga0268266_10010137 Ga0268266_100101374 126
430 3300028379 Ga0268266_11268289 Ga0268266_112682892 126
431 3300028380 Ga0268265_10017818 Ga0268265_100178186 126
432 3300028380 Ga0268265_10056120 Ga0268265_100561204 126
433 3300028381 Ga0268264_10755686 Ga0268264_107556862 126
434 3300031824 Ga0307413_10082415 Ga0307413_100824152 126
435 3300031852 Ga0307410_10193153 Ga0307410_101931532 126
436 3300031901 Ga0307406_10142484 Ga0307406_101424842 126
437 3300031903 Ga0307407_10030810 Ga0307407_100308102 126
438 3300031995 Ga0307409_100069665 Ga0307409_1000696652 126
439 3300032002 Ga0307416_100512613 Ga0307416_1005126132 126
440 3300032005 Ga0307411_10004870 Ga0307411_100048708 126
441 3300036401 Ga0373937_0560659 Ga0373937_0560659_267_653 126
442 3300046459 Ga0495629_0609603 Ga0495629_0609603_62_445 126
443 3300048907 Ga0496104_1196640 Ga0496104_1196640_197_583 126
444 3300048912 Ga0496109_0240565 Ga0496109_0240565_197_583 126
445 3300048914 Ga0496111_0218254 Ga0496111_0218254_128_514 126
446 3300048915 Ga0496112_0000843 Ga0496112_0000843_12908_13294 126
447 3300048915 Ga0496112_0890253 Ga0496112_0890253_388_774 126
448 3300048916 Ga0496113_0112719 Ga0496113_0112719_1249_1635 126
449 3300048917 Ga0496114_0231958 Ga0496114_0231958_1080_1463 126
450 3300050507 nmdc:mga05p37_23855_c1 nmdc:mga05p37_23855_c1_4197_4580 126
451 3300050508 nmdc:mga09592_1332616_c1 nmdc:mga09592_1332616_c1_157_540 126
452 3300050510 nmdc:mga06r32_1120282_c1 nmdc:mga06r32_1120282_c1_244_627 126
453 3300050510 nmdc:mga06r32_1404303_c1 nmdc:mga06r32_1404303_c1_14_397 126
454 3300050511 nmdc:mga08y16_31_c1 nmdc:mga08y16_31_c1_116429_116815 126
455 3300050515 nmdc:mga0a205_249639_c1 nmdc:mga0a205_249639_c1_1000_1386 126
456 3300059426 Ga0590077_009215 Ga0590077_009215_999_1385 126
457 3300005336 Ga0070680_100110066 Ga0070680_1001100662 127
458 3300005344 Ga0070661_100309556 Ga0070661_1003095561 127
459 3300005434 Ga0070709_10157916 Ga0070709_101579162 127
460 3300005436 Ga0070713_100761686 Ga0070713_1007616861 127
461 3300005439 Ga0070711_100264466 Ga0070711_1002644661 127
462 3300005458 Ga0070681_10353651 Ga0070681_103536512 127
463 3300005458 Ga0070681_10840985 Ga0070681_108409851 127
464 3300005467 Ga0070706_100142185 Ga0070706_1001421854 127
465 3300005468 Ga0070707_100635284 Ga0070707_1006352841 127
466 3300005471 Ga0070698_100057238 Ga0070698_1000572384 127
467 3300005518 Ga0070699_100806266 Ga0070699_1008062661 127
468 3300005530 Ga0070679_100059945 Ga0070679_1000599453 127
469 3300005539 Ga0068853_100076922 Ga0068853_1000769221 127
470 3300005539 Ga0068853_100467410 Ga0068853_1004674102 127
471 3300005577 Ga0068857_101321657 Ga0068857_1013216572 127
472 3300005614 Ga0068856_100409436 Ga0068856_1004094362 127
473 3300005618 Ga0068864_101837956 Ga0068864_1018379561 127
474 3300006173 Ga0070716_100067535 Ga0070716_1000675351 127
475 3300006175 Ga0070712_100681750 Ga0070712_1006817502 127
476 3300009094 Ga0111539_10067648 Ga0111539_100676484 127
477 3300009147 Ga0114129_10243061 Ga0114129_102430613 127
478 3300009147 Ga0114129_10461701 Ga0114129_104617012 127
479 3300009545 Ga0105237_10586760 Ga0105237_105867601 127
480 3300013100 Ga0157373_10047428 Ga0157373_100474283 127
481 3300013104 Ga0157370_10039988 Ga0157370_100399882 127
482 3300013105 Ga0157369_12490289 Ga0157369_124902891 127
483 3300013307 Ga0157372_10066836 Ga0157372_100668363 127
484 3300014325 Ga0163163_10044224 Ga0163163_100442242 127
485 3300025900 Ga0207710_10636272 Ga0207710_106362721 127
486 3300025906 Ga0207699_10294031 Ga0207699_102940312 127
487 3300025910 Ga0207684_10113265 Ga0207684_101132653 127
488 3300025912 Ga0207707_10023534 Ga0207707_100235344 127
489 3300025912 Ga0207707_10283095 Ga0207707_102830952 127
490 3300025914 Ga0207671_11318228 Ga0207671_113182281 127
491 3300025916 Ga0207663_10221670 Ga0207663_102216702 127
492 3300025917 Ga0207660_10088234 Ga0207660_100882343 127
493 3300025920 Ga0207649_10262342 Ga0207649_102623422 127
494 3300025924 Ga0207694_10144832 Ga0207694_101448322 127
495 3300025928 Ga0207700_11291244 Ga0207700_112912442 127
496 3300026035 Ga0207703_11182983 Ga0207703_111829831 127
497 3300026041 Ga0207639_10246026 Ga0207639_102460261 127
498 3300026041 Ga0207639_10285339 Ga0207639_102853392 127
499 3300026116 Ga0207674_11260379 Ga0207674_112603791 127
500 3300035111 Ga0373923_0435081 Ga0373923_0435081_140_535 127
501 3300035116 Ga0373945_0329387 Ga0373945_0329387_45_440 127
502 3300035172 Ga0373955_0666352 Ga0373955_0666352_199_594 127
503 3300035398 Ga0316574_0002686 Ga0316574_0002686_5139_5540 127
504 3300035695 Ga0373927_0541238 Ga0373927_0541238_224_619 127
505 3300036401 Ga0373937_0136714 Ga0373937_0136714_574_969 127
506 3300037068 Ga0373925_0513597 Ga0373925_0513597_351_746 127
507 3300044712 Ga0453684_0795825 Ga0453684_0795825_596_982 127
508 3300046520 Ga0495637_0173211 Ga0495637_0173211_145_528 127
509 3300049568 Ga0501031_0287857 Ga0501031_0287857_506_892 127
510 3300049569 Ga0501032_0003557 Ga0501032_0003557_1105_1491 127
511 3300049571 Ga0501034_0087101 Ga0501034_0087101_1359_1745 127
512 3300049574 Ga0501038_0001368 Ga0501038_0001368_807_1193 127
513 3300049579 Ga0501043_0557901 Ga0501043_0557901_192_578 127
514 3300049581 Ga0501047_0022207 Ga0501047_0022207_639_1025 127
515 3300049583 Ga0501067_0030060 Ga0501067_0030060_1071_1457 127
516 3300049584 Ga0501068_0323233 Ga0501068_0323233_33_419 127
517 3300049586 Ga0501070_0000738 Ga0501070_0000738_9372_9758 127
518 3300049588 Ga0501072_0099590 Ga0501072_0099590_650_1036 127
519 3300049589 Ga0501073_0003208 Ga0501073_0003208_8454_8840 127
520 3300049590 Ga0501074_0061141 Ga0501074_0061141_646_1032 127
521 3300049741 Ga0501079_0147856 Ga0501079_0147856_1410_1796 127
522 3300049742 Ga0501080_0011550 Ga0501080_0011550_5052_5438 127
523 3300049742 Ga0501080_0124653 Ga0501080_0124653_144_530 127
524 3300049744 Ga0501083_0051750 Ga0501083_0051750_2363_2749 127
525 3300049822 Ga0501035_0042645 Ga0501035_0042645_3171_3557 127
526 3300049822 Ga0501035_0275203 Ga0501035_0275203_234_620 127
527 3300049823 Ga0501044_1088660 Ga0501044_1088660_147_533 127
528 3300050507 nmdc:mga05p37_712167_c1 nmdc:mga05p37_712167_c1_655_1038 127
529 3300050509 nmdc:mga0qj67_704542_c1 nmdc:mga0qj67_704542_c1_406_789 127
530 3300050511 nmdc:mga08y16_666496_c1 nmdc:mga08y16_666496_c1_112_495 127
531 3300054114 Ga0501084_0107241 Ga0501084_0107241_533_919 127
532 3300060353 Ga0501082_0174134 Ga0501082_0174134_356_742 127
533 3300005937 Ga0081455_10245942 Ga0081455_102459422 128
534 3300046675 Ga0495657_0079165 Ga0495657_0079165_406_795 128
535 3300049568 Ga0501031_0643872 Ga0501031_0643872_88_483 128
536 3300049569 Ga0501032_0013432 Ga0501032_0013432_319_714 128
537 3300049571 Ga0501034_1046964 Ga0501034_1046964_252_647 128
538 3300049574 Ga0501038_0205272 Ga0501038_0205272_142_537 128
539 3300049575 Ga0501039_0142075 Ga0501039_0142075_1273_1668 128
540 3300049822 Ga0501035_0458931 Ga0501035_0458931_582_995 128
541 3300049822 Ga0501035_0693068 Ga0501035_0693068_279_674 128
542 3300006163 Ga0070715_10063013 Ga0070715_100630133 130
543 3300025905 Ga0207685_10165822 Ga0207685_101658222 130
544 3300003659 JGI25404J52841_10012451 JGI25404J52841_100124511 132
545 3300005341 Ga0070691_10069010 Ga0070691_100690102 132
546 3300005439 Ga0070711_100400816 Ga0070711_1004008162 132
547 3300005444 Ga0070694_100028218 Ga0070694_1000282182 132
548 3300005545 Ga0070695_100025393 Ga0070695_1000253934 132
549 3300005577 Ga0068857_101064988 Ga0068857_1010649881 132
550 3300005719 Ga0068861_100010493 Ga0068861_1000104933 132
551 3300005937 Ga0081455_10040570 Ga0081455_100405701 132
552 3300005983 Ga0081540_1000689 Ga0081540_100068927 132
553 3300005983 Ga0081540_1062866 Ga0081540_10628661 132
554 3300006173 Ga0070716_100466568 Ga0070716_1004665682 132
555 3300006358 Ga0068871_102369069 Ga0068871_1023690691 132
556 3300006844 Ga0075428_100060102 Ga0075428_1000601024 132
557 3300006844 Ga0075428_100152732 Ga0075428_1001527321 132
558 3300006847 Ga0075431_100052301 Ga0075431_1000523014 132
559 3300006847 Ga0075431_100675198 Ga0075431_1006751982 132
560 3300006852 Ga0075433_10001112 Ga0075433_1000111210 132
561 3300006852 Ga0075433_11041446 Ga0075433_110414461 132
562 3300006852 Ga0075433_11603121 Ga0075433_116031212 132
563 3300006871 Ga0075434_100003189 Ga0075434_1000031898 132
564 3300007076 Ga0075435_100032237 Ga0075435_1000322374 132
565 3300009094 Ga0111539_10285013 Ga0111539_102850133 132
566 3300009094 Ga0111539_10398881 Ga0111539_103988811 132
567 3300009094 Ga0111539_12039158 Ga0111539_120391581 132
568 3300009098 Ga0105245_11414358 Ga0105245_114143582 132
569 3300009147 Ga0114129_10037458 Ga0114129_100374585 132
570 3300025906 Ga0207699_10290263 Ga0207699_102902632 132
571 3300026118 Ga0207675_100018267 Ga0207675_1000182676 132
572 3300027907 Ga0207428_10042174 Ga0207428_100421743 132
573 3300027907 Ga0207428_10161613 Ga0207428_101616132 132
574 3300027907 Ga0207428_10162704 Ga0207428_101627041 132
575 3300034817 Ga0373948_0044856 Ga0373948_0044856_439_837 132
576 3300034818 Ga0373950_0020873 Ga0373950_0020873_176_574 132
577 3300034957 Ga0373938_0153734 Ga0373938_0153734_123_521 132
578 3300035084 Ga0373928_0017588 Ga0373928_0017588_493_891 132
579 3300035084 Ga0373928_0040905 Ga0373928_0040905_259_657 132
580 3300035088 Ga0373940_0010193 Ga0373940_0010193_1283_1681 132
581 3300035088 Ga0373940_0084642 Ga0373940_0084642_344_742 132
582 3300035088 Ga0373940_0177261 Ga0373940_0177261_31_429 132
583 3300035090 Ga0373949_0072103 Ga0373949_0072103_133_531 132
584 3300035092 Ga0373952_0129598 Ga0373952_0129598_226_624 132
585 3300035092 Ga0373952_0209764 Ga0373952_0209764_154_552 132
586 3300035112 Ga0373932_0161951 Ga0373932_0161951_321_719 132
587 3300035114 Ga0373939_0044847 Ga0373939_0044847_124_522 132
588 3300035207 Ga0373942_0007862 Ga0373942_0007862_380_778 132
589 3300035207 Ga0373942_0088880 Ga0373942_0088880_413_811 132
590 3300035241 Ga0373961_0013564 Ga0373961_0013564_1606_2004 132
591 3300035242 Ga0373962_0198216 Ga0373962_0198216_139_537 132
592 3300035242 Ga0373962_0384434 Ga0373962_0384434_43_441 132
593 3300035691 Ga0373931_0002223 Ga0373931_0002223_1955_2353 132
594 3300035691 Ga0373931_0033622 Ga0373931_0033622_1653_2051 132
595 3300035695 Ga0373927_0085772 Ga0373927_0085772_118_516 132
596 3300037068 Ga0373925_0458322 Ga0373925_0458322_563_961 132
597 3300046491 Ga0495584_0360119 Ga0495584_0360119_47_445 132
598 3300046517 Ga0495630_0507527 Ga0495630_0507527_390_788 132
599 3300046615 Ga0495656_0426786 Ga0495656_0426786_241_639 132
600 3300048912 Ga0496109_0703462 Ga0496109_0703462_376_774 132
601 3300048914 Ga0496111_0452866 Ga0496111_0452866_432_830 132
602 3300048917 Ga0496114_0684005 Ga0496114_0684005_411_854 132
603 3300049592 Ga0501076_0749725 Ga0501076_0749725_31_432 132
604 3300050507 nmdc:mga05p37_212802_c1 nmdc:mga05p37_212802_c1_218_616 132
605 3300050507 nmdc:mga05p37_53721_c1 nmdc:mga05p37_53721_c1_1958_2356 132
606 3300050510 nmdc:mga06r32_110079_c1 nmdc:mga06r32_110079_c1_2245_2643 132
607 3300050510 nmdc:mga06r32_278091_c1 nmdc:mga06r32_278091_c1_862_1260 132
608 3300050510 nmdc:mga06r32_90299_c1 nmdc:mga06r32_90299_c1_2436_2843 132
609 3300050511 nmdc:mga08y16_229081_c1 nmdc:mga08y16_229081_c1_322_720 132
610 3300050511 nmdc:mga08y16_74519_c1 nmdc:mga08y16_74519_c1_2420_2818 132
611 3300050512 nmdc:mga0n895_4648_c1 nmdc:mga0n895_4648_c1_9634_10032 132
612 3300050513 nmdc:mga0rr50_9393_c1 nmdc:mga0rr50_9393_c1_1986_2384 132
613 3300050515 nmdc:mga0a205_1085114_c1 nmdc:mga0a205_1085114_c1_194_592 132
614 3300050515 nmdc:mga0a205_58448_c1 nmdc:mga0a205_58448_c1_157_555 132
615 3300053085 Ga0495619_0352685 Ga0495619_0352685_133_531 132

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

21

133

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
3zi1-assembly1.cif.gz_A crystal structure of human glyoxalase domain-containing protein 4 (glod4) 0.8282 8 121
2p7q-assembly4.cif.gz_D-2 crystal structure of e126q mutant of genomically encoded fosfomycin resistance protein, fosx, from listeria monocytogenes complexed with mn(ii) and 1s,2s-dihydroxypropylphosphonic acid 0.8163 2 121
4nb0-assembly1.cif.gz_A crystal structure of fosb from staphylococcus aureus with bs-cys9 disulfide at 1.62 angstrom resolution 0.8033 1 123
2p7l-assembly4.cif.gz_A crystal structure of monoclinic form of genomically encoded fosfomycin resistance protein, fosx, from listeria monocytogenes at ph 5.75 0.8024 2 121
2p7m-assembly4.cif.gz_A crystal structure of monoclinic form of genomically encoded fosfomycin resistance protein, fosx, from listeria monocytogenes at ph 6.5 0.8007 2 121
ID Description Score Start End Superfamily
af_Q10FQ7_7_135_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8511 7 121 3.10.180.10
af_I1LTD0_10_138_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8463 1 121 3.10.180.10
af_P52096_9_128_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8419 8 121 3.10.180.10
af_Q4CQ87_202_421_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8416 105 122 3.40.50.300
2p7kA00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8345 2 123 3.10.180.10
ID Description Score Start End GO Terms
AF-A0A3N5NKK6-F1-model_v4 VOC domain-containing protein 0.9723 1 129
AF-A0A2N5C2L5-F1-model_v4 Glyoxalase 0.9457 1 130
AF-A0A0F9WHE4-F1-model_v4 VOC domain-containing protein 0.9449 2 130
AF-A0A3N5NKK6-F1-model_v4 VOC domain-containing protein 0.9436 1 129
AF-A0A3M1G254-F1-model_v4 Dioxygenase 0.932 3 130 GO:0051213

Feature Viewer

pLDDT pTM Quality
90.9 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map