F469108

General Info

Members Datasets Scaffolds Average Seq Length
611 282 457 229

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2919543075|2919547119
Length 226
Sequence FVLVAPARAPNVGAAARAMKTMGFDAMRLVASRVHEEEEASWVAHGAQEILTQAEAFDTLPEALADMDLVIATTARQRGRYQHYLTPGEIRDQIRAKPFLNKVAIVFGCEESGLSNEQLAHADLLSYLPLKVSYPSLNLGQAIMLYAYEMSQLLDEPQAVAENFDSVGQVRVLKHKTAEILGELGVSQDEKLHQWVMDRVPMLPQRDLNMLHLLCKDLARRFGKEV

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2506520007 Serratia plymuthica AS9 Isolate Rhizosphere
3 2506520008 Serratia plymuthica AS12 Isolate Unclassified
4 2508501071 Serratia proteamaculans S4 Isolate Rhizosphere
5 2511231025 Pantoea sp. YR343 Isolate Rhizosphere
6 2511231035 Pantoea sp. GM01 Isolate Rhizosphere
7 2537561728 Pectobacterium wasabiae CFBP 3304 Isolate Rhizoplane
8 2547132181 Kosakonia sacchari SP1 Isolate Stem
9 2547132416 Enterobacter sp. MR1 Isolate Rhizoplane
10 2554235234 Klebsiella michiganensis SA2 Isolate Unclassified
11 2561511199 Enterobacter sp. R4-368 Isolate Nodule
12 2585427591 Rahnella aquatilis OV744 Isolate Rhizosphere
13 2585427592 Rahnella aquatilis OV588 Isolate Rhizosphere
14 2599185169 Klebsiella quasipneumoniae NFPP35 Isolate Rhizoplane
15 2599185299 Pantoea ananatis NFR11 Isolate Rhizoplane
16 2600255254 Klebsiella quasipneumoniae NFIX15 Isolate Rhizoplane
17 2600255255 Klebsiella quasipneumoniae NFIX23 Isolate Rhizoplane
18 2600255256 Enterobacter sp. NFIX08 Isolate Rhizoplane
19 2600255257 Enterobacter sp. NFIX03 Isolate Rhizoplane
20 2600255280 Klebsiella quasipneumoniae NFIX42 Isolate Rhizoplane
21 2600255281 Klebsiella quasipneumoniae NFIX43 Isolate Rhizoplane
22 2600255287 Klebsiella quasipneumoniae NFIX11 Isolate Rhizoplane
23 2600255288 Klebsiella quasipneumoniae NFIX14 Isolate Rhizoplane
24 2600255289 Klebsiella quasipneumoniae NFIX16 Isolate Rhizoplane
25 2600255290 Klebsiella quasipneumoniae NFIX17 Isolate Rhizoplane
26 2600255291 Klebsiella quasipneumoniae NFIX19 Isolate Rhizoplane
27 2600255298 Klebsiella quasipneumoniae NFIX21 Isolate Rhizoplane
28 2600255299 Klebsiella quasipneumoniae NFIX22 Isolate Rhizoplane
29 2600255300 Klebsiella quasipneumoniae NFIX30 Isolate Rhizoplane
30 2600255301 Klebsiella quasipneumoniae NFIX33 Isolate Rhizoplane
31 2600255302 Klebsiella quasipneumoniae NFIX35 Isolate Rhizoplane
32 2600255303 Klebsiella quasipneumoniae NFIX36 Isolate Rhizoplane
33 2600255304 Klebsiella quasipneumoniae NFIX37 Isolate Rhizoplane
34 2600255305 Klebsiella quasipneumoniae NFIX41 Isolate Rhizoplane
35 2600255306 Klebsiella quasipneumoniae NFIX44 Isolate Rhizoplane
36 2600255307 Klebsiella quasipneumoniae NFIX56 Isolate Rhizoplane
37 2600255309 Klebsiella sp. NFIX53 Isolate Rhizoplane
38 2600255310 Enterobacter sp. NFIX06 Isolate Rhizoplane
39 2600255311 Enterobacter sp. NFIX04 Isolate Rhizoplane
40 2600255392 Klebsiella quasipneumoniae NFIX54 Isolate Rhizoplane
41 2602042046 Enterobacter sp. NFIX09 Isolate Rhizoplane
42 2602042047 Enterobacter sp. NFIX59 Isolate Rhizoplane
43 2602042052 Klebsiella quasipneumoniae NFIX18 Isolate Rhizoplane
44 2602042053 Klebsiella quasipneumoniae NFIX12 Isolate Rhizoplane
45 2602042066 Enterobacter sp. NFIX45 Isolate Rhizoplane
46 2602042067 Enterobacter sp. NFIX58 Isolate Rhizoplane
47 2602042103 Klebsiella quasipneumoniae NFIX29 Isolate Rhizoplane
48 2602042104 Klebsiella quasipneumoniae NFIX26 Isolate Rhizoplane
49 2602042105 Klebsiella quasipneumoniae NFIX25 Isolate Rhizoplane
50 2602042106 Klebsiella quasipneumoniae NFIX13 Isolate Rhizoplane
51 2602042109 Klebsiella aerogenes NFIX39 Isolate Rhizoplane
52 2602042110 Klebsiella quasipneumoniae NFIX40 Isolate Rhizoplane
53 2602042111 Klebsiella quasipneumoniae NFIX20 Isolate Rhizoplane
54 2603880178 Klebsiella quasipneumoniae NFIX34 Isolate Rhizoplane
55 2603880184 Klebsiella quasipneumoniae NFIX27 Isolate Rhizoplane
56 2603880202 Klebsiella quasipneumoniae NFIX38 Isolate Rhizoplane
57 2603880211 Klebsiella quasipneumoniae NFIX24 Isolate Rhizoplane
58 2608642108 Pantoea agglomerans NFPP29 Isolate Rhizoplane
59 2609459761 Enterobacter sp. NFR05 Isolate Rhizoplane
60 2636415599 Klebsiella variicola DX120E Isolate Unclassified
61 2648501693 Pantoea ananatis B1-9 Isolate Rhizosphere
62 2654587920 Serratia plymuthica HRO-C48 Isolate Rhizosphere
63 2667528172 Enterobacteriaceae bacterium NFIX31 Isolate Rhizoplane
64 2667528173 Rahnella sp. NFIX50 Isolate Rhizoplane
65 2671180115 Cedecea sp. NFIX57 Isolate Rhizoplane
66 2675903046 Klebsiella quasipneumoniae NFIX52 Isolate Rhizoplane
67 2681812866 Enterobacter asburiae NFIX55 Isolate Rhizoplane
68 2681812869 Enterobacter ludwigii NFPP41 Isolate Rhizoplane
69 2684622997 Pantoea ananatis NFIX48 Isolate Rhizoplane
70 2687453601 Serratia plymuthica 3Rp8 Isolate Unclassified
71 2706794495 Dickeya zeae ZJU1202 Isolate Unclassified
72 2711768156 Atlantibacter hermannii DDE1 Isolate Unclassified
73 2751185917 Enterobacter sp. HK169 Isolate Unclassified
74 2765235842 Enterobacter ludwigii AA4 Isolate Unclassified
75 2772190666 Serratia surfactantfaciens YD25 Isolate Unclassified
76 2775506706 Enterobacter asburiae 1216 Isolate Unclassified
77 2775507074 Klebsiella sp. D5A Isolate Unclassified
78 2791354903 Mangrovibacter phragmitis MP23 Isolate Unclassified
79 2791355010 Kosakonia pseudosacchari NN143 Isolate Unclassified
80 2791355275 Enterobacter sp. Sa187 Isolate Unclassified
81 2806310673 Serratia quinivorans NCTC 13189 Isolate Rhizosphere
82 2808606414 Pantoea sp. SJZ147 Isolate Rhizosphere
83 2811995292 Kosakonia oryzae Ola 51 Isolate Unclassified
84 2814123068 Kosakonia radicincitans GXGL-4A Isolate Rhizosphere
85 2821118458 Enterobacter asburiae 609 Isolate Unclassified
86 2823373977 Enterobacter ludwigii NCR3 Isolate Rhizosphere
87 2844425489 Enterobacter cloacae SBP-8 Isolate Rhizosphere
88 2844528606 Pantoea sp. R-72498 v. 2 Isolate Unclassified
89 2847085930 Erwinia persicina B64 Isolate Bulb
90 2847797336 Pantoea ananatis NN08200 Isolate Unclassified
91 2852103415 Edaphovirga cremea DSM 105170 Isolate Rhizosphere
92 2854601825 Dickeya dianthicola SS70 Isolate Stem Tuber
93 2855195626 Pectobacterium atrosepticum SS26 Isolate Stem Tuber
94 2858466076 Pectobacterium polaris SS28 Isolate Stem Tuber
95 2865014394 Pantoea sp. R-71966 Isolate Unclassified
96 2869551831 Serratia inhibens PRI-2C Isolate Rhizosphere
97 2871272651 Pectobacterium carotovorum SS96 Isolate Stem Tuber
98 2871282230 Pectobacterium parmentieri SS90 Isolate Stem Tuber
99 2876601092 Pantoea endophytica 596 Isolate Unclassified
100 2881609920 Pantoea sp. ARC607 Isolate Rhizosphere
101 2884086401 Kluyvera sp. PO2S7 Isolate Rhizosphere
102 2888366609 Serratia sp. NGAS9 Isolate Rhizosphere
103 2888373701 Serratia rhizosphaerae KUDC3025 Isolate Rhizosphere
104 2900051742 Pectobacterium zantedeschiae 2M Isolate Stem Tuber
105 2904474040 Rahnella aquatilis 4485 Isolate Rhizosphere
106 2904504865 Serratia marcescens 1822 Isolate Unclassified
107 2904513164 Klebsiella variicola 1431 Isolate Rhizosphere
108 2908669403 Pantoea coffeiphila 1480 Isolate Rhizosphere
109 2919108558 Klebsiella sp. 1400 Isolate Rhizosphere
110 2919150387 Rahnella aceris 1817 Isolate Unclassified
111 2919493220 Aeromonas salmonicida salmonicida 3466 Isolate Unclassified
112 2919543075 Aeromonas salmonicida masoucida 4076 Isolate Unclassified
113 2923525760 Aeromonas caviae SLBN-129 Isolate Rhizosphere
114 2923634449 Enterobacter kobei SLBN-76 Isolate Rhizosphere
115 2927143783 Rahnella sp. 2050 Isolate Unclassified
116 2927833300 Enterobacter sp. SLBN-59 Isolate Rhizosphere
117 2932406140 Serratia sp. 2723 Isolate Rhizosphere
118 2935625433 Kosakonia sp. 1610 Isolate Rhizosphere
119 2937539931 Pantoea sp. LS15 Isolate Unclassified
120 2937967321 Serratia sp. YC16 Isolate Unclassified
121 2939568625 Lelliottia sp. 489 Isolate Rhizosphere
122 2939573065 Citrobacter sp. 506 Isolate Rhizosphere
123 2939577877 Serratia sp. 509 Isolate Rhizosphere
124 2939602548 Pantoea dispersa 1175 Isolate Rhizosphere
125 2939607340 Leclercia sp. 1548 Isolate Rhizosphere
126 2939617950 Kosakonia cowanii 2056 Isolate Rhizosphere
127 2939642701 Lelliottia nimipressuralis 2756 Isolate Rhizosphere
128 2945874760 Phytobacter diazotrophicus UAEU22 Isolate Rhizosphere
129 2945951305 Pantoea agglomerans W2I1 Isolate Rhizosphere
130 2969079654 Klebsiella variicola E57-7 Isolate Unclassified
131 2971820967 Klebsiella sp. MPUS7 Isolate Rhizosphere
132 2974310843 Enterobacter sp. SORGH_AS 287 Isolate Unclassified
133 2974435778 Kosakonia cowanii SORGH_AS 304 Isolate Unclassified
134 2978975091 Pantoea anthophila SORGH_AS 797 Isolate Unclassified
135 2984494565 Pantoea ananatis SORGH_AS197 Isolate Aerial Root
136 2984559226 Klebsiella variicola SORGH_AS834 Isolate Aerial Root
137 2984595703 Klebsiella variicola SORGH_AS1070 Isolate Aerial Root
138 2990261002 Pantoea ananatis SORGH_AS213 Isolate Aerial Root
139 3000376612 Enterobacteriaceae bacterium 4M9 Isolate Rhizosphere
140 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
141 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
142 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
143 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
144 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
145 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
146 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
147 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
148 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
149 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
150 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
151 3300005272 Switchgrass rhizosphere microbial communities from Buena Vista Grasslands Wildlife Area, Michigan, USA - BV2.1 v1 Metagenome Rhizosphere
152 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
153 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
154 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
155 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
156 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
157 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
158 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
159 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
160 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
161 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
162 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
163 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
164 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
165 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
166 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
167 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
168 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
169 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
170 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
171 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
172 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
173 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
174 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
175 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
176 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
177 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
178 3300015679 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.4_F08 Metagenome Unclassified
179 3300015680 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.2_H03 Metagenome Rhizosphere
180 3300015685 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 Metagenome Unclassified
181 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
182 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
183 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
184 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
185 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
186 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
187 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
188 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
189 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
190 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
191 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
192 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
193 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
205 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
206 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
208 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
209 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
210 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
211 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
212 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
213 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
214 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
215 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
216 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
217 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
218 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
219 3300044669 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2E Metagenome Unclassified
220 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
221 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
222 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
223 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
224 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
225 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
226 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
227 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
228 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
229 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
230 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
231 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
232 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
233 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
234 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
235 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
236 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
237 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
238 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
239 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
240 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
241 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
242 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
243 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
244 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
245 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
246 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
247 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
248 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
249 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
250 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
251 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
252 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
253 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
254 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
255 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
256 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
257 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
258 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
259 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
260 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
261 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
262 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
263 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
264 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
265 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
266 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
267 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
268 640753048 Serratia proteamaculans 568 Isolate Endosphere
269 8004592986 Serratia sp. S119 Isolate Unclassified
270 8015394850 Serratia sp. PGPR-27 Isolate Rhizosphere
271 8016733728 Pantoea sp. SORGH_AS 659 Isolate Unclassified
272 8018221730 Enterobacter sp. CM29 Isolate Unclassified
273 8018405270 Enterobacter sp. 198 Isolate Rhizosphere
274 8019499862 Kluyvera sp. 1366 Isolate Rhizosphere
275 8019504834 Atlantibacter hermannii 1903 Isolate Rhizosphere
276 8054844752 Dryocola boscaweniae H18W14 Isolate Rhizosphere
277 8054849141 Dryocola clanedunensis H11S18 Isolate Rhizosphere
278 8055087960 Silvania hatchlandensis H19S6 Isolate Rhizosphere
279 8055092621 Silvania confinis H4N4 Isolate Rhizosphere
280 8055097453 Leclercia tamurae H6W5 Isolate Rhizosphere
281 8055693939 Hafnia alvei A23BA Isolate Rhizosphere
282 8057304971 Scandinavium manionii H17S15 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 74.8
Metatranscriptomes 0
Isolates 25.2

Biome Distribution

Category Percentage (%)
Aerial Root 0.65
Bulb 0.16
Endosphere 3.76
Nodule 3.44
Rhizoplane 10.8
Rhizosphere 52.86
Stem 0.16
Stem Tuber 0.98
Unclassified 27.17

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1878050 2162886007 Bacteria 1803
2 SwRhRL2b_contig_1918651 2162886007 Bacteria 1346
3 SwRhRL2b_contig_2152720 2162886007 Bacteria 1160
4 SwRhRL2b_contig_479778 2162886007 Bacteria 945
5 JGI24739J22299_10000206 3300001989 Bacteria 19601
6 JGI24737J22298_10015208 3300001990 Bacteria 2492
7 JGI25162J39368_1000006 3300002737 Bacteria 405267
8 JGI25163J39215_1000001 3300002771 Bacteria 314282
9 JGI25164J39214_1000001 3300002772 Bacteria 477015
10 Ga0055538_1000004 3300003751 Bacteria 615646
11 Ga0055539_1000004 3300003752 Bacteria 615646
12 Ga0055533_1000007 3300003756 Bacteria 615646
13 Ga0055525_1000007 3300003759 Bacteria 615646
14 Ga0055541_1000004 3300003841 Bacteria 615646
15 Ga0058692_1000154 3300003856 Bacteria 43640
16 Ga0058692_1000730 3300003856 Bacteria 13319
17 Ga0058692_1003875 3300003856 Bacteria 4539
18 Ga0058692_1004184 3300003856 Bacteria 4313
19 Ga0058692_1009120 3300003856 Bacteria 2520
20 Ga0058692_1011439 3300003856 Bacteria 2144
21 Ga0065703_1020895 3300005272 Bacteria 1497
22 Ga0065704_10000047 3300005289 Bacteria 72432
23 Ga0065704_10001077 3300005289 Bacteria 9733
24 Ga0065704_10002473 3300005289 Bacteria 9305
25 Ga0065704_10013721 3300005289 Bacteria 2044
26 Ga0065704_10125968 3300005289 Bacteria 1670
27 Ga0070668_100111015 3300005347 Bacteria 2182
28 Ga0070659_100251652 3300005366 Bacteria 1464
29 Ga0070665_100005453 3300005548 Bacteria 13113
30 Ga0070665_100010581 3300005548 Bacteria 9339
31 Ga0070665_100446505 3300005548 Bacteria 1303
32 Ga0068851_10014555 3300005834 Bacteria 3737
33 Ga0075364_10005769 3300006051 Bacteria 7222
34 Ga0075366_10007518 3300006195 Bacteria 6023
35 Ga0079104_1000099 3300006946 Bacteria 126954
36 Ga0079104_1000629 3300006946 Bacteria 34402
37 Ga0079104_1001515 3300006946 Bacteria 15400
38 Ga0079104_1002852 3300006946 Bacteria 8658
39 Ga0079104_1007498 3300006946 Bacteria 3944
40 Ga0079104_1023737 3300006946 Bacteria 1626
41 Ga0079104_1025471 3300006946 Bacteria 1543
42 Ga0079104_1026911 3300006946 Bacteria 1479
43 Ga0079104_1050024 3300006946 Bacteria 934
44 Ga0105251_10003295 3300009011 Bacteria 11819
45 Ga0105251_10004575 3300009011 Bacteria 9355
46 Ga0105251_10011037 3300009011 Bacteria 5185
47 Ga0105251_10011049 3300009011 Bacteria 5181
48 Ga0105251_10011139 3300009011 Bacteria 5155
49 Ga0105251_10046148 3300009011 Bacteria 2097
50 Ga0105251_10074109 3300009011 Bacteria 1581
51 Ga0105251_10091383 3300009011 Bacteria 1398
52 Ga0105251_10097748 3300009011 Bacteria 1344
53 Ga0105251_10105550 3300009011 Bacteria 1286
54 Ga0105251_10106225 3300009011 Bacteria 1281
55 Ga0105251_10115412 3300009011 Bacteria 1221
56 Ga0105244_10000023 3300009036 Bacteria 233110
57 Ga0105244_10000247 3300009036 Bacteria 55392
58 Ga0105244_10000255 3300009036 Bacteria 54462
59 Ga0105244_10000615 3300009036 Bacteria 31587
60 Ga0105244_10000704 3300009036 Bacteria 29004
61 Ga0105244_10002529 3300009036 Bacteria 13733
62 Ga0105244_10005545 3300009036 Bacteria 8362
63 Ga0105244_10009277 3300009036 Bacteria 6062
64 Ga0105244_10090437 3300009036 Bacteria 1506
65 Ga0105244_10092988 3300009036 Bacteria 1482
66 Ga0105244_10095053 3300009036 Bacteria 1462
67 Ga0105244_10113760 3300009036 Bacteria 1314
68 Ga0105244_10113761 3300009036 Bacteria 1314
69 Ga0105244_10115540 3300009036 Bacteria 1303
70 Ga0105244_10115701 3300009036 Bacteria 1302
71 Ga0105244_10117261 3300009036 Bacteria 1291
72 Ga0105250_10000028 3300009092 Bacteria 204198
73 Ga0105250_10000045 3300009092 Bacteria 127333
74 Ga0105250_10000223 3300009092 Bacteria 47350
75 Ga0105250_10001201 3300009092 Bacteria 14447
76 Ga0105250_10001583 3300009092 Bacteria 12205
77 Ga0105250_10010397 3300009092 Bacteria 3879
78 Ga0105250_10024115 3300009092 Bacteria 2451
79 Ga0105250_10040556 3300009092 Bacteria 1867
80 Ga0105250_10047496 3300009092 Bacteria 1721
81 Ga0105250_10053673 3300009092 Bacteria 1617
82 Ga0105250_10086629 3300009092 Bacteria 1272
83 Ga0105250_10123770 3300009092 Bacteria 1064
84 Ga0105240_10199007 3300009093 Bacteria 2350
85 Ga0105247_10000387 3300009101 Bacteria 37452
86 Ga0105243_10003177 3300009148 Bacteria 13461
87 Ga0105243_10410555 3300009148 Bacteria 1260
88 Ga0105241_10000008 3300009174 Bacteria 334281
89 Ga0105237_10164799 3300009545 Bacteria 2215
90 Ga0105246_10035295 3300011119 Bacteria 3341
91 Ga0105246_10064597 3300011119 Bacteria 2557
92 Ga0105246_10065538 3300011119 Bacteria 2540
93 Ga0105246_10113087 3300011119 Bacteria 1998
94 Ga0105246_10173249 3300011119 Bacteria 1654
95 Ga0157373_10001774 3300013100 Bacteria 16416
96 Ga0157373_10009572 3300013100 Bacteria 7154
97 Ga0157373_10027994 3300013100 Bacteria 4067
98 Ga0157371_10000020 3300013102 Bacteria 304987
99 Ga0157371_10000267 3300013102 Bacteria 71120
100 Ga0157371_10001526 3300013102 Bacteria 23861
101 Ga0157371_10003239 3300013102 Bacteria 14941
102 Ga0157371_10013175 3300013102 Bacteria 6293
103 Ga0157371_10144869 3300013102 Bacteria 1692
104 Ga0157371_10157455 3300013102 Bacteria 1622
105 Ga0157371_10269957 3300013102 Bacteria 1227
106 Ga0157370_10000276 3300013104 Bacteria 65208
107 Ga0157370_10004198 3300013104 Bacteria 16670
108 Ga0157370_10293143 3300013104 Bacteria 1502
109 Ga0157370_10407224 3300013104 Bacteria 1251
110 Ga0157369_10000183 3300013105 Bacteria 86986
111 Ga0157369_10318352 3300013105 Bacteria 1617
112 Ga0163162_10043133 3300013306 Bacteria 4516
113 Ga0163162_10225240 3300013306 Bacteria 2005
114 Ga0157372_10001322 3300013307 Bacteria 26834
115 Ga0157372_10005871 3300013307 Bacteria 13067
116 Ga0157372_10410889 3300013307 Bacteria 1577
117 Ga0157372_10574062 3300013307 Bacteria 1314
118 Ga0157372_10574063 3300013307 Bacteria 1314
119 Ga0182008_10012826 3300014497 Bacteria 4417
120 Ga0182008_10015151 3300014497 Bacteria 4028
121 Ga0182006_1000025 3300015261 Bacteria 255969
122 Ga0182006_1001790 3300015261 Bacteria 12391
123 Ga0182007_10004369 3300015262 Bacteria 6419
124 Ga0183366_1003 3300015679 Bacteria 453474
125 Ga0183370_1003 3300015680 Bacteria 454044
126 Ga0183369_1005 3300015685 Bacteria 453680
127 Ga0183368_1006 3300015687 Bacteria 551576
128 Ga0163161_10000002 3300017792 Bacteria 411983
129 Ga0163161_10008601 3300017792 Bacteria 7055
130 Ga0163161_10197413 3300017792 Bacteria 1549
131 Ga0163161_10261632 3300017792 Bacteria 1351
132 Ga0213876_10000132 3300021384 Bacteria 81285
133 Ga0209760_100063 3300025207 Bacteria 92173
134 Ga0209784_100001 3300025224 Bacteria 3600592
135 Ga0209566_100001 3300025225 Bacteria 3600765
136 Ga0209674_100002 3300025226 Bacteria 3600592
137 Ga0209563_100008 3300025230 Bacteria 1554545
138 Ga0207427_100002 3300025231 Bacteria 1355321
139 Ga0209437_100046 3300025233 Bacteria 405293
140 Ga0209437_100063 3300025233 Bacteria 335477
141 Ga0209677_100004 3300025253 Bacteria 1554545
142 Ga0209129_1000008 3300025258 Bacteria 640959
143 Ga0207696_1000009 3300025711 Bacteria 564405
144 Ga0207696_1000027 3300025711 Bacteria 412783
145 Ga0207696_1000093 3300025711 Bacteria 184278
146 Ga0207696_1000140 3300025711 Bacteria 127393
147 Ga0207696_1000142 3300025711 Bacteria 123519
148 Ga0207696_1000761 3300025711 Bacteria 21277
149 Ga0207696_1001106 3300025711 Bacteria 15723
150 Ga0207696_1001210 3300025711 Bacteria 14669
151 Ga0207696_1004737 3300025711 Bacteria 5793
152 Ga0207696_1016557 3300025711 Bacteria 2462
153 Ga0207696_1051871 3300025711 Bacteria 1171
154 Ga0207696_1070420 3300025711 Bacteria 973
155 Ga0207655_1000017 3300025728 Bacteria 544403
156 Ga0207655_1000024 3300025728 Bacteria 459774
157 Ga0207655_1000026 3300025728 Bacteria 445528
158 Ga0207655_1000054 3300025728 Bacteria 281894
159 Ga0207655_1000056 3300025728 Bacteria 279166
160 Ga0207655_1000101 3300025728 Bacteria 185883
161 Ga0207655_1000146 3300025728 Bacteria 132221
162 Ga0207655_1001632 3300025728 Bacteria 19908
163 Ga0207655_1002118 3300025728 Bacteria 16607
164 Ga0207655_1005112 3300025728 Bacteria 9044
165 Ga0207655_1010976 3300025728 Bacteria 5439
166 Ga0207655_1013098 3300025728 Bacteria 4784
167 Ga0207655_1014466 3300025728 Bacteria 4457
168 Ga0207655_1019220 3300025728 Bacteria 3583
169 Ga0207655_1034979 3300025728 Bacteria 2251
170 Ga0207655_1058106 3300025728 Bacteria 1515
171 Ga0207655_1063424 3300025728 Bacteria 1415
172 Ga0207655_1105043 3300025728 Bacteria 965
173 Ga0207713_1000007 3300025735 Bacteria 564979
174 Ga0207713_1000034 3300025735 Bacteria 266214
175 Ga0207713_1000046 3300025735 Bacteria 232796
176 Ga0207713_1000110 3300025735 Bacteria 135907
177 Ga0207713_1000419 3300025735 Bacteria 45136
178 Ga0207713_1000500 3300025735 Bacteria 40370
179 Ga0207713_1016451 3300025735 Bacteria 3751
180 Ga0207713_1038876 3300025735 Bacteria 2014
181 Ga0207713_1039154 3300025735 Bacteria 2003
182 Ga0207713_1048219 3300025735 Bacteria 1717
183 Ga0207713_1075562 3300025735 Bacteria 1229
184 Ga0207710_10000015 3300025900 Bacteria 393018
185 Ga0207654_10000009 3300025911 Bacteria 334291
186 Ga0207695_10094050 3300025913 Bacteria 3006
187 Ga0207671_10286041 3300025914 Bacteria 1301
188 Ga0207690_10219203 3300025932 Bacteria 1455
189 Ga0207709_10007353 3300025935 Bacteria 6136
190 Ga0207709_10089191 3300025935 Bacteria 2010
191 Ga0207709_10301638 3300025935 Bacteria 1191
192 Ga0207668_10002127 3300025972 Bacteria 11553
193 Ga0207668_10213356 3300025972 Bacteria 1545
194 Ga0207674_10000009 3300026116 Bacteria 202730
195 Ga0209281_1000054 3300027111 Bacteria 309505
196 Ga0209281_1000058 3300027111 Bacteria 300244
197 Ga0209281_1000060 3300027111 Bacteria 295683
198 Ga0209281_1000120 3300027111 Bacteria 206692
199 Ga0209281_1000648 3300027111 Bacteria 37573
200 Ga0209281_1000822 3300027111 Bacteria 28039
201 Ga0209281_1000854 3300027111 Bacteria 26809
202 Ga0209281_1001185 3300027111 Bacteria 17897
203 Ga0209281_1007172 3300027111 Bacteria 2817
204 Ga0209281_1014574 3300027111 Bacteria 1659
205 Ga0209281_1021606 3300027111 Bacteria 1242
206 Ga0209371_1000030 3300027312 Bacteria 423605
207 Ga0209371_1000053 3300027312 Bacteria 264616
208 Ga0209371_1000054 3300027312 Bacteria 259676
209 Ga0209371_1000111 3300027312 Bacteria 140093
210 Ga0209371_1000438 3300027312 Bacteria 42301
211 Ga0209371_1000495 3300027312 Bacteria 38270
212 Ga0209371_1000544 3300027312 Bacteria 35405
213 Ga0209371_1000655 3300027312 Bacteria 30194
214 Ga0209371_1001916 3300027312 Bacteria 12706
215 Ga0209371_1002048 3300027312 Bacteria 12053
216 Ga0209371_1002190 3300027312 Bacteria 11391
217 Ga0209371_1002345 3300027312 Bacteria 10767
218 Ga0209371_1003753 3300027312 Bacteria 7097
219 Ga0209371_1005744 3300027312 Bacteria 4823
220 Ga0209371_1007953 3300027312 Bacteria 3598
221 Ga0209371_1027988 3300027312 Bacteria 1262
222 Ga0268266_10000290 3300028379 Bacteria 82154
223 Ga0268266_10024985 3300028379 Bacteria 5085
224 Ga0268266_10118516 3300028379 Bacteria 2353
225 Ga0268256_1000012 3300030500 Bacteria 794553
226 Ga0268256_1000021 3300030500 Bacteria 542735
227 Ga0268256_1000025 3300030500 Bacteria 484317
228 Ga0268256_1000053 3300030500 Bacteria 264616
229 Ga0268256_1000095 3300030500 Bacteria 139698
230 Ga0268256_1000426 3300030500 Bacteria 38063
231 Ga0268256_1000462 3300030500 Bacteria 35405
232 Ga0268256_1000560 3300030500 Bacteria 30194
233 Ga0268256_1001180 3300030500 Bacteria 16761
234 Ga0268256_1001858 3300030500 Bacteria 11711
235 Ga0268256_1001950 3300030500 Bacteria 11283
236 Ga0268256_1002082 3300030500 Bacteria 10767
237 Ga0268256_1004037 3300030500 Bacteria 6305
238 Ga0268256_1004508 3300030500 Bacteria 5760
239 Ga0268256_1005793 3300030500 Bacteria 4754
240 Ga0268256_1006066 3300030500 Bacteria 4578
241 Ga0268256_1007914 3300030500 Bacteria 3712
242 Ga0268256_1028405 3300030500 Bacteria 1381
243 Ga0268256_1031819 3300030500 Bacteria 1262
244 Ga0268256_1033766 3300030500 Bacteria 1205
245 Ga0268256_1053571 3300030500 Bacteria 838
246 Ga0439438_000677 3300041405 Bacteria 15284
247 Ga0439438_001019 3300041405 Bacteria 12497
248 Ga0439438_015809 3300041405 Bacteria 2208
249 Ga0439447_000341 3300041407 Bacteria 16808
250 Ga0439447_000968 3300041407 Bacteria 10478
251 Ga0439447_002365 3300041407 Bacteria 6891
252 Ga0439466_0000002 3300041411 Bacteria 494198
253 Ga0451853_2824457 3300041512 Bacteria 4834
254 Ga0439432_002050 3300042006 Bacteria 7626
255 Ga0439432_002366 3300042006 Bacteria 7124
256 Ga0439432_029985 3300042006 Bacteria 1765
257 Ga0439452_000004 3300042010 Bacteria 764268
258 Ga0439452_000005 3300042010 Bacteria 646919
259 Ga0439452_000007 3300042010 Bacteria 613625
260 Ga0439452_000056 3300042010 Bacteria 106151
261 Ga0439452_001035 3300042010 Bacteria 12296
262 Ga0439452_003977 3300042010 Bacteria 5049
263 Ga0439463_001114 3300042016 Bacteria 7205
264 Ga0450900_001762 3300042136 Bacteria 2188
265 Ga0450907_000284 3300042146 Bacteria 17144
266 Ga0439464_0000295 3300042439 Bacteria 9446
267 Ga0439464_0005852 3300042439 Bacteria 3192
268 Ga0450893_0008208 3300042532 Bacteria 1699
269 Ga0466981_0000014 3300044669 Bacteria 109658
270 Ga0495617_008933 3300046452 Bacteria 3447
271 Ga0495627_000042 3300046453 Bacteria 189845
272 Ga0495591_000024 3300046458 Bacteria 191134
273 Ga0495591_000231 3300046458 Bacteria 54648
274 Ga0495591_009447 3300046458 Bacteria 3873
275 Ga0495591_018920 3300046458 Bacteria 2321
276 Ga0495638_0008135 3300046460 Bacteria 7459
277 Ga0495650_0000004 3300046471 Bacteria 779487
278 Ga0495650_0000028 3300046471 Bacteria 473012
279 Ga0495650_0000113 3300046471 Bacteria 196536
280 Ga0495605_0065601 3300046474 Bacteria 1726
281 Ga0495584_0007379 3300046491 Bacteria 5735
282 Ga0495607_0004107 3300046501 Bacteria 10876
283 Ga0495606_0001088 3300046507 Bacteria 38905
284 Ga0495616_0027953 3300046513 Bacteria 2989
285 Ga0495620_0001603 3300046515 Bacteria 13396
286 Ga0495620_0108206 3300046515 Bacteria 1103
287 Ga0495632_0017209 3300046519 Bacteria 3998
288 Ga0495643_0074273 3300046522 Bacteria 1781
289 Ga0495644_0008589 3300046523 Bacteria 3933
290 Ga0495648_0008024 3300046524 Bacteria 8364
291 Ga0495648_0023431 3300046524 Bacteria 4227
292 Ga0495654_0000031 3300046530 Bacteria 206800
293 Ga0495654_0000342 3300046530 Bacteria 40679
294 Ga0495654_0000390 3300046530 Bacteria 37861
295 Ga0495654_0047366 3300046530 Bacteria 2113
296 Ga0495597_0000548 3300046542 Bacteria 31172
297 Ga0495625_0004340 3300046660 Bacteria 13464
298 Ga0495671_0001418 3300046692 Bacteria 16112
299 Ga0495649_0046353 3300046694 Bacteria 2367
300 Ga0495649_0097667 3300046694 Bacteria 1562
301 Ga0495649_0172902 3300046694 Bacteria 1129
302 Ga0495589_0000005 3300046794 Bacteria 405112
303 Ga0495589_0198543 3300046794 Bacteria 947
304 Ga0495660_0000013 3300046810 Bacteria 350283
305 Ga0495660_0000034 3300046810 Bacteria 201261
306 Ga0495672_0000029 3300047320 Bacteria 305231
307 Ga0495672_0000051 3300047320 Bacteria 237883
308 Ga0495672_0000054 3300047320 Bacteria 230777
309 Ga0495683_0034625 3300047323 Bacteria 2567
310 Ga0495679_000014 3300047446 Bacteria 292767
311 Ga0495679_002205 3300047446 Bacteria 10161
312 Ga0495679_009550 3300047446 Bacteria 3874
313 Ga0495679_078053 3300047446 Bacteria 944
314 Ga0495673_0000047 3300047469 Bacteria 266522
315 Ga0495673_0000820 3300047469 Bacteria 29164
316 Ga0495681_0042288 3300047470 Bacteria 2206
317 Ga0496100_0016906 3300048903 Bacteria 4293
318 Ga0496101_0008506 3300048904 Bacteria 6707
319 Ga0496102_0004986 3300048905 Bacteria 11244
320 Ga0496103_0061548 3300048906 Bacteria 2335
321 Ga0496104_0000302 3300048907 Bacteria 43843
322 Ga0496104_0001413 3300048907 Bacteria 20804
323 Ga0496104_0460305 3300048907 Bacteria 1183
324 Ga0496104_0661447 3300048907 Bacteria 953
325 Ga0496105_0085801 3300048908 Bacteria 2601
326 Ga0496105_0130329 3300048908 Bacteria 2073
327 Ga0496105_0485457 3300048908 Bacteria 971
328 Ga0496116_0000015 3300048919 Bacteria 560702
329 Ga0496116_0000016 3300048919 Bacteria 555146
330 Ga0496116_0000715 3300048919 Bacteria 42503
331 Ga0496116_0001156 3300048919 Bacteria 31157
332 Ga0496116_0008145 3300048919 Bacteria 9155
333 Ga0496116_0008871 3300048919 Bacteria 8651
334 Ga0496116_0010355 3300048919 Bacteria 7829
335 Ga0496116_0015021 3300048919 Bacteria 6141
336 Ga0496116_0038103 3300048919 Bacteria 3342
337 Ga0496116_0096129 3300048919 Bacteria 1785
338 Ga0496116_0218799 3300048919 Bacteria 978
339 Ga0496117_0000103 3300048920 Bacteria 189316
340 Ga0496117_0000238 3300048920 Bacteria 104303
341 Ga0496117_0002432 3300048920 Bacteria 23541
342 Ga0496117_0003210 3300048920 Bacteria 19333
343 Ga0496117_0007956 3300048920 Bacteria 10183
344 Ga0496117_0010933 3300048920 Bacteria 8180
345 Ga0496117_0013561 3300048920 Bacteria 7101
346 Ga0496117_0068976 3300048920 Bacteria 2383
347 Ga0496117_0115109 3300048920 Bacteria 1665
348 Ga0496117_0153841 3300048920 Bacteria 1357
349 Ga0496117_0169188 3300048920 Bacteria 1270
350 Ga0496117_0252612 3300048920 Bacteria 960
351 Ga0496117_0252614 3300048920 Bacteria 960
352 Ga0496118_0000046 3300048921 Bacteria 271783
353 Ga0496118_0000959 3300048921 Bacteria 45037
354 Ga0496118_0001062 3300048921 Bacteria 42938
355 Ga0496118_0002877 3300048921 Bacteria 22448
356 Ga0496118_0007962 3300048921 Bacteria 11082
357 Ga0496118_0010449 3300048921 Bacteria 9195
358 Ga0496118_0011468 3300048921 Bacteria 8644
359 Ga0496118_0013917 3300048921 Bacteria 7565
360 Ga0496118_0112685 3300048921 Bacteria 1799
361 Ga0496118_0189757 3300048921 Bacteria 1230
362 Ga0496118_0193512 3300048921 Bacteria 1213
363 Ga0496118_0250681 3300048921 Bacteria 1006
364 Ga0496118_0258495 3300048921 Bacteria 984
365 Ga0496118_0258497 3300048921 Bacteria 984
366 Ga0496119_0000026 3300048922 Bacteria 254759
367 Ga0496119_0000031 3300048922 Bacteria 239685
368 Ga0496119_0001418 3300048922 Bacteria 29010
369 Ga0496119_0005727 3300048922 Bacteria 11775
370 Ga0496119_0007715 3300048922 Bacteria 9621
371 Ga0496119_0008301 3300048922 Bacteria 9155
372 Ga0496119_0016334 3300048922 Bacteria 5654
373 Ga0496119_0036526 3300048922 Bacteria 3205
374 Ga0496119_0060191 3300048922 Bacteria 2275
375 Ga0496119_0127513 3300048922 Bacteria 1390
376 Ga0496119_0138441 3300048922 Bacteria 1317
377 Ga0496119_0238310 3300048922 Bacteria 922
378 Ga0496120_0000017 3300048923 Bacteria 269222
379 Ga0496120_0000344 3300048923 Bacteria 76805
380 Ga0496120_0001012 3300048923 Bacteria 37715
381 Ga0496120_0001279 3300048923 Bacteria 31425
382 Ga0496120_0001280 3300048923 Bacteria 31420
383 Ga0496120_0002535 3300048923 Bacteria 18240
384 Ga0496120_0004434 3300048923 Bacteria 11774
385 Ga0496120_0006998 3300048923 Bacteria 8483
386 Ga0496120_0011752 3300048923 Bacteria 6000
387 Ga0496120_0036845 3300048923 Bacteria 2906
388 Ga0496120_0041252 3300048923 Bacteria 2705
389 Ga0496120_0104908 3300048923 Bacteria 1486
390 Ga0496120_0203086 3300048923 Bacteria 958
391 Ga0496121_0001130 3300048924 Bacteria 46848
392 Ga0496121_0004701 3300048924 Bacteria 18089
393 Ga0496121_0007313 3300048924 Bacteria 13353
394 Ga0496121_0018542 3300048924 Bacteria 7010
395 Ga0496121_0180193 3300048924 Bacteria 1525
396 Ga0496121_0284847 3300048924 Bacteria 1128
397 Ga0496121_0384334 3300048924 Bacteria 924
398 Ga0496121_0406089 3300048924 Bacteria 890
399 Ga0496122_0000075 3300048925 Bacteria 219099
400 Ga0496122_0000125 3300048925 Bacteria 179659
401 Ga0496122_0001095 3300048925 Bacteria 46975
402 Ga0496122_0002193 3300048925 Bacteria 28526
403 Ga0496122_0008894 3300048925 Bacteria 10702
404 Ga0496122_0046002 3300048925 Bacteria 3385
405 Ga0496122_0052149 3300048925 Bacteria 3101
406 Ga0496122_0067808 3300048925 Bacteria 2566
407 Ga0496122_0127465 3300048925 Bacteria 1625
408 Ga0496122_0151386 3300048925 Bacteria 1431
409 Ga0496122_0197808 3300048925 Bacteria 1178
410 Ga0496122_0209014 3300048925 Bacteria 1132
411 Ga0496122_0251235 3300048925 Bacteria 988
412 Ga0496123_0000019 3300048926 Bacteria 400216
413 Ga0496123_0000092 3300048926 Bacteria 179551
414 Ga0496123_0000377 3300048926 Bacteria 83811
415 Ga0496123_0000774 3300048926 Bacteria 51762
416 Ga0496123_0001657 3300048926 Bacteria 29899
417 Ga0496123_0003347 3300048926 Bacteria 18138
418 Ga0496123_0008703 3300048926 Bacteria 9272
419 Ga0496123_0022397 3300048926 Bacteria 4870
420 Ga0496123_0110705 3300048926 Bacteria 1570
421 Ga0496123_0187191 3300048926 Bacteria 1074
422 Ga0496123_0187686 3300048926 Bacteria 1072
423 Ga0496123_0199835 3300048926 Bacteria 1025
424 Ga0496123_0231010 3300048926 Bacteria 925
425 Ga0496124_0000058 3300048927 Bacteria 242191
426 Ga0496124_0000142 3300048927 Bacteria 147311
427 Ga0496124_0000238 3300048927 Bacteria 106881
428 Ga0496124_0000528 3300048927 Bacteria 65079
429 Ga0496124_0000965 3300048927 Bacteria 45797
430 Ga0496124_0006756 3300048927 Bacteria 12399
431 Ga0496124_0016519 3300048927 Bacteria 7009
432 Ga0496124_0027757 3300048927 Bacteria 5073
433 Ga0496124_0043456 3300048927 Bacteria 3863
434 Ga0496124_0067154 3300048927 Bacteria 2984
435 Ga0496124_0076976 3300048927 Bacteria 2752
436 Ga0496124_0160833 3300048927 Bacteria 1750
437 Ga0496124_0184809 3300048927 Bacteria 1600
438 Ga0496124_0285434 3300048927 Bacteria 1201
439 Ga0496124_0416986 3300048927 Bacteria 926
440 Ga0496125_0000032 3300048928 Bacteria 354078
441 Ga0496125_0000384 3300048928 Bacteria 82197
442 Ga0496125_0011357 3300048928 Bacteria 8916
443 Ga0496125_0015148 3300048928 Bacteria 7472
444 Ga0496125_0037736 3300048928 Bacteria 4196
445 Ga0496125_0193044 3300048928 Bacteria 1342
446 Ga0496125_0282358 3300048928 Bacteria 1027
447 Ga0496126_0000109 3300048929 Bacteria 196717
448 Ga0496126_0036712 3300048929 Bacteria 4579
449 Ga0496126_0050965 3300048929 Bacteria 3771
450 Ga0496126_0061296 3300048929 Bacteria 3380
451 Ga0496126_0083323 3300048929 Bacteria 2822
452 Ga0496126_0303053 3300048929 Bacteria 1317
453 Ga0496126_0372754 3300048929 Bacteria 1163
454 Ga0495678_000607 3300049459 Bacteria 33697
455 Ga0495682_0000003 3300049460 Bacteria 515787
456 nmdc:mga00v17_229400_c1 3300050491 Bacteria 1203
457 Ga0500621_000006 3300053126 Bacteria 245480

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048919 Ga0496116_0001156 Ga0496116_0001156_20109_20813 210
2 3300048922 Ga0496119_0007715 Ga0496119_0007715_7778_8482 210
3 3300048923 Ga0496120_0002535 Ga0496120_0002535_10273_10977 210
4 3300046491 Ga0495584_0007379 Ga0495584_0007379_2256_2957 215
5 3300046523 Ga0495644_0008589 Ga0495644_0008589_2503_3204 215
6 3300049459 Ga0495678_000607 Ga0495678_000607_1110_1811 215
7 3300042010 Ga0439452_000004 Ga0439452_000004_562747_563451 218
8 3300048922 Ga0496119_0000031 Ga0496119_0000031_115560_116246 218
9 3300048923 Ga0496120_0000017 Ga0496120_0000017_219929_220615 218
10 iso_pu_bacteria 2919493220 2919495342 222
11 iso_pu_bacteria 2919543075 2919547119 222
12 iso_pu_bacteria 2923525760 2923529275 223
13 iso_pu_bacteria 2506520007 2506576657 224
14 iso_pu_bacteria 2506520008 2506581795 224
15 iso_pu_bacteria 2508501071 2508850600 224
16 iso_pu_bacteria 2511231025 2511381904 224
17 iso_pu_bacteria 2511231035 2511432756 224
18 iso_pu_bacteria 2547132181 2547696545 224
19 iso_pu_bacteria 2547132416 2548650866 224
20 iso_pu_bacteria 2554235234 2555261999 224
21 iso_pu_bacteria 2561511199 2562465913 224
22 iso_pu_bacteria 2585427591 2585826199 224
23 iso_pu_bacteria 2585427592 2585830771 224
24 iso_pu_bacteria 2599185169 2599412875 224
25 iso_pu_bacteria 2599185299 2599928143 224
26 iso_pu_bacteria 2600255254 2601525654 224
27 iso_pu_bacteria 2600255255 2601530737 224
28 iso_pu_bacteria 2600255256 2601533953 224
29 iso_pu_bacteria 2600255257 2601540121 224
30 iso_pu_bacteria 2600255280 2601617774 224
31 iso_pu_bacteria 2600255281 2601622809 224
32 iso_pu_bacteria 2600255287 2601644646 224
33 iso_pu_bacteria 2600255288 2601651082 224
34 iso_pu_bacteria 2600255289 2601656131 224
35 iso_pu_bacteria 2600255290 2601661055 224
36 iso_pu_bacteria 2600255291 2601664811 224
37 iso_pu_bacteria 2600255298 2601697321 224
38 iso_pu_bacteria 2600255299 2601702709 224
39 iso_pu_bacteria 2600255300 2601708897 224
40 iso_pu_bacteria 2600255301 2601713935 224
41 iso_pu_bacteria 2600255302 2601718980 224
42 iso_pu_bacteria 2600255303 2601722632 224
43 iso_pu_bacteria 2600255304 2601728899 224
44 iso_pu_bacteria 2600255305 2601733926 224
45 iso_pu_bacteria 2600255306 2601738902 224
46 iso_pu_bacteria 2600255307 2601743290 224
47 iso_pu_bacteria 2600255309 2601754416 224
48 iso_pu_bacteria 2600255310 2601758896 224
49 iso_pu_bacteria 2600255311 2601762754 224
50 iso_pu_bacteria 2600255392 2602021357 224
51 iso_pu_bacteria 2602042046 2603640606 224
52 iso_pu_bacteria 2602042047 2603644608 224
53 iso_pu_bacteria 2602042052 2603662872 224
54 iso_pu_bacteria 2602042053 2603667769 224
55 iso_pu_bacteria 2602042066 2603700463 224
56 iso_pu_bacteria 2602042067 2603705927 224
57 iso_pu_bacteria 2602042103 2603841451 224
58 iso_pu_bacteria 2602042104 2603846420 224
59 iso_pu_bacteria 2602042105 2603851495 224
60 iso_pu_bacteria 2602042106 2603856664 224
61 iso_pu_bacteria 2602042109 2603868513 224
62 iso_pu_bacteria 2602042110 2603874142 224
63 iso_pu_bacteria 2602042111 2603878578 224
64 iso_pu_bacteria 2603880178 2606051423 224
65 iso_pu_bacteria 2603880184 2606072300 224
66 iso_pu_bacteria 2603880202 2606149109 224
67 iso_pu_bacteria 2603880211 2606179213 224
68 iso_pu_bacteria 2609459761 2609911989 224
69 iso_pu_bacteria 2636415599 2637227172 224
70 iso_pu_bacteria 2648501693 2650900201 224
71 iso_pu_bacteria 2654587920 2656276446 224
72 iso_pu_bacteria 2667528172 2671103716 224
73 iso_pu_bacteria 2667528173 2671106508 224
74 iso_pu_bacteria 2671180115 2671586854 224
75 iso_pu_bacteria 2675903046 2676409863 224
76 iso_pu_bacteria 2681812866 2681996839 224
77 iso_pu_bacteria 2681812869 2682008620 224
78 iso_pu_bacteria 2684622997 2686354440 224
79 iso_pu_bacteria 2687453601 2689443035 224
80 iso_pu_bacteria 2706794495 2707098372 224
81 iso_pu_bacteria 2711768156 2712470885 224
82 iso_pu_bacteria 2711768156 2712471219 224
83 iso_pu_bacteria 2751185917 2753854558 224
84 iso_pu_bacteria 2765235842 2765587417 224
85 iso_pu_bacteria 2772190666 2772437193 224
86 iso_pu_bacteria 2775506706 2775540805 224
87 iso_pu_bacteria 2775507074 2777021570 224
88 iso_pu_bacteria 2791354903 2791924240 224
89 iso_pu_bacteria 2791355010 2792313320 224
90 iso_pu_bacteria 2791355275 2793406934 224
91 iso_pu_bacteria 2806310673 2807177946 224
92 iso_pu_bacteria 2808606414 2809124272 224
93 iso_pu_bacteria 2811995292 2813730633 224
94 iso_pu_bacteria 2814123068 2814698240 224
95 iso_pu_bacteria 2821118458 2821121418 224
96 iso_pu_bacteria 2823373977 2823377464 224
97 iso_pu_bacteria 2844425489 2844426108 224
98 iso_pu_bacteria 2844528606 2844532596 224
99 iso_pu_bacteria 2847085930 2847089118 224
100 iso_pu_bacteria 2847797336 2847801293 224
101 iso_pu_bacteria 2852103415 2852106168 224
102 iso_pu_bacteria 2854601825 2854601942 224
103 iso_pu_bacteria 2855195626 2855195792 224
104 iso_pu_bacteria 2858466076 2858469542 224
105 iso_pu_bacteria 2865014394 2865018602 224
106 iso_pu_bacteria 2869551831 2869552439 224
107 iso_pu_bacteria 2871272651 2871273536 224
108 iso_pu_bacteria 2871282230 2871286897 224
109 iso_pu_bacteria 2876601092 2876605739 224
110 iso_pu_bacteria 2881609920 2881613730 224
111 iso_pu_bacteria 2884086401 2884090537 224
112 iso_pu_bacteria 2888366609 2888367241 224
113 iso_pu_bacteria 2888373701 2888375096 224
114 iso_pu_bacteria 2900051742 2900053731 224
115 iso_pu_bacteria 2904474040 2904474344 224
116 iso_pu_bacteria 2904504865 2904507067 224
117 iso_pu_bacteria 2904513164 2904516105 224
118 iso_pu_bacteria 2908669403 2908673109 224
119 iso_pu_bacteria 2919108558 2919112820 224
120 iso_pu_bacteria 2919150387 2919150691 224
121 iso_pu_bacteria 2923634449 2923637947 224
122 iso_pu_bacteria 2927143783 2927145564 224
123 iso_pu_bacteria 2927833300 2927835614 224
124 iso_pu_bacteria 2932406140 2932406541 224
125 iso_pu_bacteria 2935625433 2935627911 224
126 iso_pu_bacteria 2937539931 2937540076 224
127 iso_pu_bacteria 2937967321 2937970761 224
128 iso_pu_bacteria 2939568625 2939571598 224
129 iso_pu_bacteria 2939573065 2939576014 224
130 iso_pu_bacteria 2939577877 2939578037 224
131 iso_pu_bacteria 2939602548 2939607252 224
132 iso_pu_bacteria 2939607340 2939609510 224
133 iso_pu_bacteria 2939617950 2939619669 224
134 iso_pu_bacteria 2939642701 2939645995 224
135 iso_pu_bacteria 2945874760 2945879814 224
136 iso_pu_bacteria 2945951305 2945954327 224
137 iso_pu_bacteria 2969079654 2969084186 224
138 iso_pu_bacteria 2971820967 2971825693 224
139 iso_pu_bacteria 2974310843 2974313652 224
140 iso_pu_bacteria 2974435778 2974436939 224
141 iso_pu_bacteria 2978975091 2978976811 224
142 iso_pu_bacteria 2984494565 2984498124 224
143 iso_pu_bacteria 2984559226 2984561265 224
144 iso_pu_bacteria 2984595703 2984599336 224
145 iso_pu_bacteria 2990261002 2990265178 224
146 iso_pu_bacteria 3000376612 3000380549 224
147 iso_pu_bacteria 640753048 640936193 224
148 iso_pu_bacteria 8004592986 8004597856 224
149 iso_pu_bacteria 8015394850 8015396119 224
150 iso_pu_bacteria 8016733728 8016737268 224
151 iso_pu_bacteria 8018221730 8018223466 224
152 iso_pu_bacteria 8018405270 8018410005 224
153 iso_pu_bacteria 8019499862 8019502469 224
154 iso_pu_bacteria 8019504834 8019506809 224
155 iso_pu_bacteria 8054844752 8054848636 224
156 iso_pu_bacteria 8054849141 8054850059 224
157 iso_pu_bacteria 8055087960 8055091478 224
158 iso_pu_bacteria 8055092621 8055092820 224
159 iso_pu_bacteria 8055097453 8055100693 224
160 iso_pu_bacteria 8055693939 8055697606 224
161 iso_pu_bacteria 8057304971 8057307372 224
162 3300009036 Ga0105244_10009277 Ga0105244_100092773 226
163 2162886007 SwRhRL2b_contig_1878050 SwRhRL2b_0011.00000380 228
164 2162886007 SwRhRL2b_contig_1918651 SwRhRL2b_0714.00003180 228
165 2162886007 SwRhRL2b_contig_2152720 SwRhRL2b_0856.00000870 228
166 2162886007 SwRhRL2b_contig_479778 SwRhRL2b_0184.00001860 228
167 3300001989 JGI24739J22299_10000206 JGI24739J22299_100002069 228
168 3300001990 JGI24737J22298_10015208 JGI24737J22298_100152083 228
169 3300002737 JGI25162J39368_1000006 JGI25162J39368_1000006112 228
170 3300002771 JGI25163J39215_1000001 JGI25163J39215_1000001245 228
171 3300002772 JGI25164J39214_1000001 JGI25164J39214_1000001183 228
172 3300003751 Ga0055538_1000004 Ga0055538_1000004313 228
173 3300003752 Ga0055539_1000004 Ga0055539_1000004245 228
174 3300003756 Ga0055533_1000007 Ga0055533_1000007313 228
175 3300003759 Ga0055525_1000007 Ga0055525_1000007313 228
176 3300003841 Ga0055541_1000004 Ga0055541_1000004313 228
177 3300003856 Ga0058692_1000154 Ga0058692_100015425 228
178 3300003856 Ga0058692_1000730 Ga0058692_100073011 228
179 3300003856 Ga0058692_1003875 Ga0058692_10038755 228
180 3300003856 Ga0058692_1004184 Ga0058692_10041842 228
181 3300003856 Ga0058692_1009120 Ga0058692_10091202 228
182 3300003856 Ga0058692_1011439 Ga0058692_10114391 228
183 3300005272 Ga0065703_1020895 Ga0065703_10208952 228
184 3300005289 Ga0065704_10000047 Ga0065704_1000004759 228
185 3300005289 Ga0065704_10001077 Ga0065704_100010771 228
186 3300005289 Ga0065704_10002473 Ga0065704_100024738 228
187 3300005289 Ga0065704_10013721 Ga0065704_100137212 228
188 3300005289 Ga0065704_10125968 Ga0065704_101259682 228
189 3300005347 Ga0070668_100111015 Ga0070668_1001110152 228
190 3300005366 Ga0070659_100251652 Ga0070659_1002516522 228
191 3300005548 Ga0070665_100005453 Ga0070665_1000054538 228
192 3300005548 Ga0070665_100010581 Ga0070665_1000105818 228
193 3300005548 Ga0070665_100446505 Ga0070665_1004465051 228
194 3300005834 Ga0068851_10014555 Ga0068851_100145552 228
195 3300006051 Ga0075364_10005769 Ga0075364_100057696 228
196 3300006195 Ga0075366_10007518 Ga0075366_100075184 228
197 3300006946 Ga0079104_1000099 Ga0079104_100009916 228
198 3300006946 Ga0079104_1000629 Ga0079104_100062928 228
199 3300006946 Ga0079104_1001515 Ga0079104_100151514 228
200 3300006946 Ga0079104_1002852 Ga0079104_10028527 228
201 3300006946 Ga0079104_1007498 Ga0079104_10074981 228
202 3300006946 Ga0079104_1023737 Ga0079104_10237372 228
203 3300006946 Ga0079104_1025471 Ga0079104_10254712 228
204 3300006946 Ga0079104_1026911 Ga0079104_10269112 228
205 3300006946 Ga0079104_1050024 Ga0079104_10500241 228
206 3300009011 Ga0105251_10003295 Ga0105251_100032952 228
207 3300009011 Ga0105251_10004575 Ga0105251_100045752 228
208 3300009011 Ga0105251_10011037 Ga0105251_100110371 228
209 3300009011 Ga0105251_10011049 Ga0105251_100110491 228
210 3300009011 Ga0105251_10011139 Ga0105251_100111393 228
211 3300009011 Ga0105251_10046148 Ga0105251_100461482 228
212 3300009011 Ga0105251_10074109 Ga0105251_100741092 228
213 3300009011 Ga0105251_10091383 Ga0105251_100913832 228
214 3300009011 Ga0105251_10097748 Ga0105251_100977481 228
215 3300009011 Ga0105251_10105550 Ga0105251_101055502 228
216 3300009011 Ga0105251_10106225 Ga0105251_101062251 228
217 3300009011 Ga0105251_10115412 Ga0105251_101154122 228
218 3300009036 Ga0105244_10000023 Ga0105244_1000002356 228
219 3300009036 Ga0105244_10000247 Ga0105244_100002472 228
220 3300009036 Ga0105244_10000255 Ga0105244_1000025545 228
221 3300009036 Ga0105244_10000615 Ga0105244_1000061524 228
222 3300009036 Ga0105244_10000704 Ga0105244_1000070412 228
223 3300009036 Ga0105244_10002529 Ga0105244_1000252913 228
224 3300009036 Ga0105244_10005545 Ga0105244_100055457 228
225 3300009036 Ga0105244_10090437 Ga0105244_100904372 228
226 3300009036 Ga0105244_10092988 Ga0105244_100929882 228
227 3300009036 Ga0105244_10095053 Ga0105244_100950531 228
228 3300009036 Ga0105244_10113760 Ga0105244_101137601 228
229 3300009036 Ga0105244_10113761 Ga0105244_101137611 228
230 3300009036 Ga0105244_10115540 Ga0105244_101155401 228
231 3300009036 Ga0105244_10115701 Ga0105244_101157011 228
232 3300009036 Ga0105244_10117261 Ga0105244_101172611 228
233 3300009092 Ga0105250_10000028 Ga0105250_1000002890 228
234 3300009092 Ga0105250_10000045 Ga0105250_10000045121 228
235 3300009092 Ga0105250_10000223 Ga0105250_100002232 228
236 3300009092 Ga0105250_10001201 Ga0105250_100012012 228
237 3300009092 Ga0105250_10001583 Ga0105250_100015832 228
238 3300009092 Ga0105250_10010397 Ga0105250_100103971 228
239 3300009092 Ga0105250_10024115 Ga0105250_100241151 228
240 3300009092 Ga0105250_10040556 Ga0105250_100405563 228
241 3300009092 Ga0105250_10047496 Ga0105250_100474961 228
242 3300009092 Ga0105250_10053673 Ga0105250_100536732 228
243 3300009092 Ga0105250_10086629 Ga0105250_100866291 228
244 3300009092 Ga0105250_10123770 Ga0105250_101237701 228
245 3300009093 Ga0105240_10199007 Ga0105240_101990072 228
246 3300009101 Ga0105247_10000387 Ga0105247_1000038719 228
247 3300009148 Ga0105243_10003177 Ga0105243_1000317713 228
248 3300009148 Ga0105243_10410555 Ga0105243_104105551 228
249 3300009174 Ga0105241_10000008 Ga0105241_10000008114 228
250 3300009545 Ga0105237_10164799 Ga0105237_101647992 228
251 3300011119 Ga0105246_10035295 Ga0105246_100352952 228
252 3300011119 Ga0105246_10064597 Ga0105246_100645972 228
253 3300011119 Ga0105246_10065538 Ga0105246_100655383 228
254 3300011119 Ga0105246_10113087 Ga0105246_101130871 228
255 3300011119 Ga0105246_10173249 Ga0105246_101732491 228
256 3300013100 Ga0157373_10001774 Ga0157373_100017744 228
257 3300013100 Ga0157373_10009572 Ga0157373_100095728 228
258 3300013100 Ga0157373_10027994 Ga0157373_100279944 228
259 3300013102 Ga0157371_10000020 Ga0157371_10000020127 228
260 3300013102 Ga0157371_10000267 Ga0157371_1000026721 228
261 3300013102 Ga0157371_10001526 Ga0157371_100015262 228
262 3300013102 Ga0157371_10003239 Ga0157371_1000323910 228
263 3300013102 Ga0157371_10013175 Ga0157371_100131752 228
264 3300013102 Ga0157371_10144869 Ga0157371_101448692 228
265 3300013102 Ga0157371_10157455 Ga0157371_101574551 228
266 3300013102 Ga0157371_10269957 Ga0157371_102699572 228
267 3300013104 Ga0157370_10000276 Ga0157370_1000027627 228
268 3300013104 Ga0157370_10004198 Ga0157370_100041985 228
269 3300013104 Ga0157370_10293143 Ga0157370_102931431 228
270 3300013104 Ga0157370_10407224 Ga0157370_104072241 228
271 3300013105 Ga0157369_10000183 Ga0157369_1000018367 228
272 3300013105 Ga0157369_10318352 Ga0157369_103183521 228
273 3300013306 Ga0163162_10043133 Ga0163162_100431332 228
274 3300013306 Ga0163162_10225240 Ga0163162_102252401 228
275 3300013307 Ga0157372_10001322 Ga0157372_100013225 228
276 3300013307 Ga0157372_10005871 Ga0157372_1000587110 228
277 3300013307 Ga0157372_10410889 Ga0157372_104108892 228
278 3300013307 Ga0157372_10574062 Ga0157372_105740621 228
279 3300013307 Ga0157372_10574063 Ga0157372_105740631 228
280 3300014497 Ga0182008_10012826 Ga0182008_100128261 228
281 3300014497 Ga0182008_10015151 Ga0182008_100151513 228
282 3300015261 Ga0182006_1000025 Ga0182006_1000025176 228
283 3300015261 Ga0182006_1001790 Ga0182006_100179010 228
284 3300015262 Ga0182007_10004369 Ga0182007_100043692 228
285 3300015679 Ga0183366_1003 Ga0183366_1003185 228
286 3300015680 Ga0183370_1003 Ga0183370_1003235 228
287 3300015685 Ga0183369_1005 Ga0183369_1005235 228
288 3300015687 Ga0183368_1006 Ga0183368_1006184 228
289 3300017792 Ga0163161_10000002 Ga0163161_10000002168 228
290 3300017792 Ga0163161_10008601 Ga0163161_100086012 228
291 3300017792 Ga0163161_10197413 Ga0163161_101974131 228
292 3300017792 Ga0163161_10261632 Ga0163161_102616321 228
293 3300021384 Ga0213876_10000132 Ga0213876_100001321 228
294 3300025207 Ga0209760_100063 Ga0209760_10006348 228
295 3300025224 Ga0209784_100001 Ga0209784_100001307 228
296 3300025225 Ga0209566_100001 Ga0209566_100001307 228
297 3300025226 Ga0209674_100002 Ga0209674_100002307 228
298 3300025230 Ga0209563_100008 Ga0209563_100008310 228
299 3300025231 Ga0207427_100002 Ga0207427_100002970 228
300 3300025233 Ga0209437_100046 Ga0209437_100046112 228
301 3300025233 Ga0209437_100063 Ga0209437_100063141 228
302 3300025253 Ga0209677_100004 Ga0209677_100004310 228
303 3300025258 Ga0209129_1000008 Ga0209129_1000008407 228
304 3300025711 Ga0207696_1000009 Ga0207696_1000009205 228
305 3300025711 Ga0207696_1000027 Ga0207696_1000027196 228
306 3300025711 Ga0207696_1000093 Ga0207696_100009345 228
307 3300025711 Ga0207696_1000140 Ga0207696_1000140121 228
308 3300025711 Ga0207696_1000142 Ga0207696_100014299 228
309 3300025711 Ga0207696_1000761 Ga0207696_100076112 228
310 3300025711 Ga0207696_1001106 Ga0207696_100110612 228
311 3300025711 Ga0207696_1001210 Ga0207696_10012102 228
312 3300025711 Ga0207696_1004737 Ga0207696_10047374 228
313 3300025711 Ga0207696_1016557 Ga0207696_10165573 228
314 3300025711 Ga0207696_1051871 Ga0207696_10518711 228
315 3300025711 Ga0207696_1070420 Ga0207696_10704201 228
316 3300025728 Ga0207655_1000017 Ga0207655_1000017317 228
317 3300025728 Ga0207655_1000024 Ga0207655_1000024149 228
318 3300025728 Ga0207655_1000026 Ga0207655_1000026309 228
319 3300025728 Ga0207655_1000054 Ga0207655_1000054188 228
320 3300025728 Ga0207655_1000056 Ga0207655_1000056143 228
321 3300025728 Ga0207655_1000101 Ga0207655_100010145 228
322 3300025728 Ga0207655_1000146 Ga0207655_100014687 228
323 3300025728 Ga0207655_1001632 Ga0207655_10016326 228
324 3300025728 Ga0207655_1002118 Ga0207655_10021185 228
325 3300025728 Ga0207655_1005112 Ga0207655_10051123 228
326 3300025728 Ga0207655_1010976 Ga0207655_10109764 228
327 3300025728 Ga0207655_1013098 Ga0207655_10130983 228
328 3300025728 Ga0207655_1014466 Ga0207655_10144663 228
329 3300025728 Ga0207655_1019220 Ga0207655_10192201 228
330 3300025728 Ga0207655_1034979 Ga0207655_10349791 228
331 3300025728 Ga0207655_1058106 Ga0207655_10581062 228
332 3300025728 Ga0207655_1063424 Ga0207655_10634241 228
333 3300025728 Ga0207655_1105043 Ga0207655_11050431 228
334 3300025735 Ga0207713_1000007 Ga0207713_1000007168 228
335 3300025735 Ga0207713_1000034 Ga0207713_100003428 228
336 3300025735 Ga0207713_1000046 Ga0207713_1000046122 228
337 3300025735 Ga0207713_1000110 Ga0207713_100011013 228
338 3300025735 Ga0207713_1000419 Ga0207713_100041931 228
339 3300025735 Ga0207713_1000500 Ga0207713_10005004 228
340 3300025735 Ga0207713_1016451 Ga0207713_10164512 228
341 3300025735 Ga0207713_1038876 Ga0207713_10388762 228
342 3300025735 Ga0207713_1039154 Ga0207713_10391541 228
343 3300025735 Ga0207713_1048219 Ga0207713_10482192 228
344 3300025735 Ga0207713_1075562 Ga0207713_10755622 228
345 3300025900 Ga0207710_10000015 Ga0207710_10000015320 228
346 3300025911 Ga0207654_10000009 Ga0207654_10000009114 228
347 3300025913 Ga0207695_10094050 Ga0207695_100940502 228
348 3300025914 Ga0207671_10286041 Ga0207671_102860412 228
349 3300025932 Ga0207690_10219203 Ga0207690_102192032 228
350 3300025935 Ga0207709_10007353 Ga0207709_100073534 228
351 3300025935 Ga0207709_10089191 Ga0207709_100891911 228
352 3300025935 Ga0207709_10301638 Ga0207709_103016381 228
353 3300025972 Ga0207668_10002127 Ga0207668_100021278 228
354 3300025972 Ga0207668_10213356 Ga0207668_102133562 228
355 3300026116 Ga0207674_10000009 Ga0207674_100000094 228
356 3300027111 Ga0209281_1000054 Ga0209281_100005497 228
357 3300027111 Ga0209281_1000058 Ga0209281_100005867 228
358 3300027111 Ga0209281_1000060 Ga0209281_1000060138 228
359 3300027111 Ga0209281_1000120 Ga0209281_1000120105 228
360 3300027111 Ga0209281_1000648 Ga0209281_10006481 228
361 3300027111 Ga0209281_1000822 Ga0209281_100082227 228
362 3300027111 Ga0209281_1000854 Ga0209281_100085412 228
363 3300027111 Ga0209281_1001185 Ga0209281_100118517 228
364 3300027111 Ga0209281_1007172 Ga0209281_10071722 228
365 3300027111 Ga0209281_1014574 Ga0209281_10145742 228
366 3300027111 Ga0209281_1021606 Ga0209281_10216061 228
367 3300027312 Ga0209371_1000030 Ga0209371_1000030120 228
368 3300027312 Ga0209371_1000053 Ga0209371_1000053152 228
369 3300027312 Ga0209371_1000054 Ga0209371_1000054100 228
370 3300027312 Ga0209371_1000111 Ga0209371_100011175 228
371 3300027312 Ga0209371_1000438 Ga0209371_100043841 228
372 3300027312 Ga0209371_1000495 Ga0209371_100049524 228
373 3300027312 Ga0209371_1000544 Ga0209371_10005445 228
374 3300027312 Ga0209371_1000655 Ga0209371_10006551 228
375 3300027312 Ga0209371_1001916 Ga0209371_100191611 228
376 3300027312 Ga0209371_1002048 Ga0209371_10020488 228
377 3300027312 Ga0209371_1002190 Ga0209371_10021901 228
378 3300027312 Ga0209371_1002345 Ga0209371_10023457 228
379 3300027312 Ga0209371_1003753 Ga0209371_10037533 228
380 3300027312 Ga0209371_1005744 Ga0209371_10057443 228
381 3300027312 Ga0209371_1007953 Ga0209371_10079533 228
382 3300027312 Ga0209371_1027988 Ga0209371_10279881 228
383 3300028379 Ga0268266_10000290 Ga0268266_100002901 228
384 3300028379 Ga0268266_10024985 Ga0268266_100249855 228
385 3300028379 Ga0268266_10118516 Ga0268266_101185162 228
386 3300030500 Ga0268256_1000012 Ga0268256_1000012593 228
387 3300030500 Ga0268256_1000021 Ga0268256_1000021167 228
388 3300030500 Ga0268256_1000025 Ga0268256_1000025173 228
389 3300030500 Ga0268256_1000053 Ga0268256_100005382 228
390 3300030500 Ga0268256_1000095 Ga0268256_100009528 228
391 3300030500 Ga0268256_1000426 Ga0268256_100042610 228
392 3300030500 Ga0268256_1000462 Ga0268256_100046232 228
393 3300030500 Ga0268256_1000560 Ga0268256_100056024 228
394 3300030500 Ga0268256_1001180 Ga0268256_10011804 228
395 3300030500 Ga0268256_1001858 Ga0268256_10018582 228
396 3300030500 Ga0268256_1001950 Ga0268256_10019501 228
397 3300030500 Ga0268256_1002082 Ga0268256_10020827 228
398 3300030500 Ga0268256_1004037 Ga0268256_10040373 228
399 3300030500 Ga0268256_1004508 Ga0268256_10045085 228
400 3300030500 Ga0268256_1005793 Ga0268256_10057933 228
401 3300030500 Ga0268256_1006066 Ga0268256_10060662 228
402 3300030500 Ga0268256_1007914 Ga0268256_10079142 228
403 3300030500 Ga0268256_1028405 Ga0268256_10284051 228
404 3300030500 Ga0268256_1031819 Ga0268256_10318192 228
405 3300030500 Ga0268256_1033766 Ga0268256_10337662 228
406 3300030500 Ga0268256_1053571 Ga0268256_10535711 228
407 3300041405 Ga0439438_000677 Ga0439438_000677_2030_2728 228
408 3300041405 Ga0439438_001019 Ga0439438_001019_995_1681 228
409 3300041405 Ga0439438_015809 Ga0439438_015809_855_1559 228
410 3300041407 Ga0439447_000341 Ga0439447_000341_15005_15703 228
411 3300041407 Ga0439447_000968 Ga0439447_000968_909_1613 228
412 3300041407 Ga0439447_002365 Ga0439447_002365_4152_4850 228
413 3300041411 Ga0439466_0000002 Ga0439466_0000002_374314_375018 228
414 3300041512 Ga0451853_2824457 Ga0451853_2824457_25_711 228
415 3300042006 Ga0439432_002050 Ga0439432_002050_5182_5907 228
416 3300042006 Ga0439432_002366 Ga0439432_002366_3303_4007 228
417 3300042006 Ga0439432_029985 Ga0439432_029985_330_1016 228
418 3300042010 Ga0439452_000005 Ga0439452_000005_200644_201330 228
419 3300042010 Ga0439452_000007 Ga0439452_000007_259746_260432 228
420 3300042010 Ga0439452_000056 Ga0439452_000056_95138_95824 228
421 3300042010 Ga0439452_001035 Ga0439452_001035_11269_11955 228
422 3300042010 Ga0439452_003977 Ga0439452_003977_631_1317 228
423 3300042016 Ga0439463_001114 Ga0439463_001114_724_1428 228
424 3300042136 Ga0450900_001762 Ga0450900_001762_713_1399 228
425 3300042146 Ga0450907_000284 Ga0450907_000284_2707_3411 228
426 3300042439 Ga0439464_0000295 Ga0439464_0000295_1505_2209 228
427 3300042439 Ga0439464_0005852 Ga0439464_0005852_1690_2376 228
428 3300042532 Ga0450893_0008208 Ga0450893_0008208_588_1274 228
429 3300044669 Ga0466981_0000014 Ga0466981_0000014_81699_82385 228
430 3300046452 Ga0495617_008933 Ga0495617_008933_1905_2609 228
431 3300046453 Ga0495627_000042 Ga0495627_000042_32023_32709 228
432 3300046458 Ga0495591_000024 Ga0495591_000024_187491_188195 228
433 3300046458 Ga0495591_000231 Ga0495591_000231_21315_22010 228
434 3300046458 Ga0495591_009447 Ga0495591_009447_328_1029 228
435 3300046458 Ga0495591_018920 Ga0495591_018920_1092_1823 228
436 3300046460 Ga0495638_0008135 Ga0495638_0008135_1450_2181 228
437 3300046471 Ga0495650_0000004 Ga0495650_0000004_343610_344296 228
438 3300046471 Ga0495650_0000028 Ga0495650_0000028_183452_184138 228
439 3300046471 Ga0495650_0000113 Ga0495650_0000113_80340_81041 228
440 3300046474 Ga0495605_0065601 Ga0495605_0065601_248_949 228
441 3300046501 Ga0495607_0004107 Ga0495607_0004107_8844_9545 228
442 3300046507 Ga0495606_0001088 Ga0495606_0001088_31742_32443 228
443 3300046513 Ga0495616_0027953 Ga0495616_0027953_1131_1832 228
444 3300046515 Ga0495620_0001603 Ga0495620_0001603_265_996 228
445 3300046515 Ga0495620_0108206 Ga0495620_0108206_149_835 228
446 3300046519 Ga0495632_0017209 Ga0495632_0017209_1234_1920 228
447 3300046522 Ga0495643_0074273 Ga0495643_0074273_806_1537 228
448 3300046524 Ga0495648_0008024 Ga0495648_0008024_5997_6698 228
449 3300046524 Ga0495648_0023431 Ga0495648_0023431_2279_2983 228
450 3300046530 Ga0495654_0000031 Ga0495654_0000031_51779_52483 228
451 3300046530 Ga0495654_0000342 Ga0495654_0000342_26719_27405 228
452 3300046530 Ga0495654_0000390 Ga0495654_0000390_9695_10396 228
453 3300046530 Ga0495654_0047366 Ga0495654_0047366_589_1275 228
454 3300046542 Ga0495597_0000548 Ga0495597_0000548_16167_16868 228
455 3300046660 Ga0495625_0004340 Ga0495625_0004340_46_774 228
456 3300046692 Ga0495671_0001418 Ga0495671_0001418_8999_9700 228
457 3300046694 Ga0495649_0046353 Ga0495649_0046353_969_1670 228
458 3300046694 Ga0495649_0097667 Ga0495649_0097667_482_1213 228
459 3300046694 Ga0495649_0172902 Ga0495649_0172902_350_1081 228
460 3300046794 Ga0495589_0000005 Ga0495589_0000005_365260_365946 228
461 3300046794 Ga0495589_0198543 Ga0495589_0198543_111_812 228
462 3300046810 Ga0495660_0000013 Ga0495660_0000013_275805_276491 228
463 3300046810 Ga0495660_0000034 Ga0495660_0000034_87392_88093 228
464 3300047320 Ga0495672_0000029 Ga0495672_0000029_90721_91422 228
465 3300047320 Ga0495672_0000051 Ga0495672_0000051_167041_167742 228
466 3300047320 Ga0495672_0000054 Ga0495672_0000054_32471_33175 228
467 3300047323 Ga0495683_0034625 Ga0495683_0034625_568_1269 228
468 3300047446 Ga0495679_000014 Ga0495679_000014_117115_117843 228
469 3300047446 Ga0495679_002205 Ga0495679_002205_8952_9683 228
470 3300047446 Ga0495679_009550 Ga0495679_009550_2981_3685 228
471 3300047446 Ga0495679_078053 Ga0495679_078053_141_827 228
472 3300047469 Ga0495673_0000047 Ga0495673_0000047_49319_50005 228
473 3300047469 Ga0495673_0000820 Ga0495673_0000820_11637_12338 228
474 3300047470 Ga0495681_0042288 Ga0495681_0042288_1005_1691 228
475 3300048903 Ga0496100_0016906 Ga0496100_0016906_1564_2268 228
476 3300048904 Ga0496101_0008506 Ga0496101_0008506_1587_2291 228
477 3300048905 Ga0496102_0004986 Ga0496102_0004986_10137_10874 228
478 3300048906 Ga0496103_0061548 Ga0496103_0061548_1376_2062 228
479 3300048907 Ga0496104_0000302 Ga0496104_0000302_42854_43540 228
480 3300048907 Ga0496104_0001413 Ga0496104_0001413_12005_12691 228
481 3300048907 Ga0496104_0460305 Ga0496104_0460305_304_990 228
482 3300048907 Ga0496104_0661447 Ga0496104_0661447_144_830 228
483 3300048908 Ga0496105_0085801 Ga0496105_0085801_357_1061 228
484 3300048908 Ga0496105_0130329 Ga0496105_0130329_1214_1900 228
485 3300048908 Ga0496105_0485457 Ga0496105_0485457_174_860 228
486 3300048919 Ga0496116_0000015 Ga0496116_0000015_227361_228047 228
487 3300048919 Ga0496116_0000016 Ga0496116_0000016_214754_215440 228
488 3300048919 Ga0496116_0000715 Ga0496116_0000715_13_717 228
489 3300048919 Ga0496116_0008145 Ga0496116_0008145_381_1067 228
490 3300048919 Ga0496116_0008871 Ga0496116_0008871_2719_3456 228
491 3300048919 Ga0496116_0010355 Ga0496116_0010355_6538_7242 228
492 3300048919 Ga0496116_0015021 Ga0496116_0015021_2579_3265 228
493 3300048919 Ga0496116_0038103 Ga0496116_0038103_2607_3293 228
494 3300048919 Ga0496116_0096129 Ga0496116_0096129_676_1380 228
495 3300048919 Ga0496116_0218799 Ga0496116_0218799_187_873 228
496 3300048920 Ga0496117_0000103 Ga0496117_0000103_82373_83110 228
497 3300048920 Ga0496117_0000238 Ga0496117_0000238_58865_59569 228
498 3300048920 Ga0496117_0002432 Ga0496117_0002432_17423_18127 228
499 3300048920 Ga0496117_0003210 Ga0496117_0003210_10043_10729 228
500 3300048920 Ga0496117_0007956 Ga0496117_0007956_382_1068 228
501 3300048920 Ga0496117_0010933 Ga0496117_0010933_603_1289 228
502 3300048920 Ga0496117_0013561 Ga0496117_0013561_5196_5882 228
503 3300048920 Ga0496117_0068976 Ga0496117_0068976_1683_2369 228
504 3300048920 Ga0496117_0115109 Ga0496117_0115109_107_793 228
505 3300048920 Ga0496117_0153841 Ga0496117_0153841_269_973 228
506 3300048920 Ga0496117_0169188 Ga0496117_0169188_299_985 228
507 3300048920 Ga0496117_0252612 Ga0496117_0252612_231_917 228
508 3300048920 Ga0496117_0252614 Ga0496117_0252614_231_917 228
509 3300048921 Ga0496118_0000046 Ga0496118_0000046_164840_165577 228
510 3300048921 Ga0496118_0000959 Ga0496118_0000959_22944_23648 228
511 3300048921 Ga0496118_0001062 Ga0496118_0001062_9752_10456 228
512 3300048921 Ga0496118_0002877 Ga0496118_0002877_382_1068 228
513 3300048921 Ga0496118_0007962 Ga0496118_0007962_8146_8832 228
514 3300048921 Ga0496118_0010449 Ga0496118_0010449_729_1415 228
515 3300048921 Ga0496118_0011468 Ga0496118_0011468_2246_2932 228
516 3300048921 Ga0496118_0013917 Ga0496118_0013917_6498_7184 228
517 3300048921 Ga0496118_0112685 Ga0496118_0112685_603_1289 228
518 3300048921 Ga0496118_0189757 Ga0496118_0189757_309_995 228
519 3300048921 Ga0496118_0193512 Ga0496118_0193512_373_1077 228
520 3300048921 Ga0496118_0250681 Ga0496118_0250681_246_932 228
521 3300048921 Ga0496118_0258495 Ga0496118_0258495_68_754 228
522 3300048921 Ga0496118_0258497 Ga0496118_0258497_68_754 228
523 3300048922 Ga0496119_0000026 Ga0496119_0000026_109864_110550 228
524 3300048922 Ga0496119_0001418 Ga0496119_0001418_7954_8640 228
525 3300048922 Ga0496119_0005727 Ga0496119_0005727_2182_2886 228
526 3300048922 Ga0496119_0008301 Ga0496119_0008301_381_1067 228
527 3300048922 Ga0496119_0016334 Ga0496119_0016334_4797_5483 228
528 3300048922 Ga0496119_0036526 Ga0496119_0036526_1601_2287 228
529 3300048922 Ga0496119_0060191 Ga0496119_0060191_1150_1854 228
530 3300048922 Ga0496119_0127513 Ga0496119_0127513_340_1026 228
531 3300048922 Ga0496119_0138441 Ga0496119_0138441_308_994 228
532 3300048922 Ga0496119_0238310 Ga0496119_0238310_54_740 228
533 3300048923 Ga0496120_0000344 Ga0496120_0000344_75031_75735 228
534 3300048923 Ga0496120_0001012 Ga0496120_0001012_23722_24426 228
535 3300048923 Ga0496120_0001279 Ga0496120_0001279_365_1051 228
536 3300048923 Ga0496120_0001280 Ga0496120_0001280_364_1050 228
537 3300048923 Ga0496120_0004434 Ga0496120_0004434_8889_9593 228
538 3300048923 Ga0496120_0006998 Ga0496120_0006998_363_1049 228
539 3300048923 Ga0496120_0011752 Ga0496120_0011752_1420_2106 228
540 3300048923 Ga0496120_0036845 Ga0496120_0036845_206_892 228
541 3300048923 Ga0496120_0041252 Ga0496120_0041252_206_892 228
542 3300048923 Ga0496120_0104908 Ga0496120_0104908_187_873 228
543 3300048923 Ga0496120_0203086 Ga0496120_0203086_111_797 228
544 3300048924 Ga0496121_0001130 Ga0496121_0001130_13640_14344 228
545 3300048924 Ga0496121_0004701 Ga0496121_0004701_411_1097 228
546 3300048924 Ga0496121_0007313 Ga0496121_0007313_1268_1954 228
547 3300048924 Ga0496121_0018542 Ga0496121_0018542_6016_6702 228
548 3300048924 Ga0496121_0180193 Ga0496121_0180193_381_1067 228
549 3300048924 Ga0496121_0284847 Ga0496121_0284847_272_958 228
550 3300048924 Ga0496121_0384334 Ga0496121_0384334_206_892 228
551 3300048924 Ga0496121_0406089 Ga0496121_0406089_33_719 228
552 3300048925 Ga0496122_0000075 Ga0496122_0000075_22431_23117 228
553 3300048925 Ga0496122_0000125 Ga0496122_0000125_75529_76215 228
554 3300048925 Ga0496122_0001095 Ga0496122_0001095_12851_13537 228
555 3300048925 Ga0496122_0002193 Ga0496122_0002193_16960_17667 228
556 3300048925 Ga0496122_0008894 Ga0496122_0008894_9619_10323 228
557 3300048925 Ga0496122_0046002 Ga0496122_0046002_2085_2771 228
558 3300048925 Ga0496122_0052149 Ga0496122_0052149_551_1237 228
559 3300048925 Ga0496122_0067808 Ga0496122_0067808_1063_1749 228
560 3300048925 Ga0496122_0127465 Ga0496122_0127465_516_1253 228
561 3300048925 Ga0496122_0151386 Ga0496122_0151386_420_1106 228
562 3300048925 Ga0496122_0197808 Ga0496122_0197808_308_994 228
563 3300048925 Ga0496122_0209014 Ga0496122_0209014_388_1092 228
564 3300048925 Ga0496122_0251235 Ga0496122_0251235_131_817 228
565 3300048926 Ga0496123_0000019 Ga0496123_0000019_115450_116136 228
566 3300048926 Ga0496123_0000092 Ga0496123_0000092_103454_104140 228
567 3300048926 Ga0496123_0000377 Ga0496123_0000377_32660_33346 228
568 3300048926 Ga0496123_0000774 Ga0496123_0000774_39589_40296 228
569 3300048926 Ga0496123_0001657 Ga0496123_0001657_19087_19791 228
570 3300048926 Ga0496123_0003347 Ga0496123_0003347_466_1152 228
571 3300048926 Ga0496123_0008703 Ga0496123_0008703_8415_9101 228
572 3300048926 Ga0496123_0022397 Ga0496123_0022397_373_1110 228
573 3300048926 Ga0496123_0110705 Ga0496123_0110705_67_753 228
574 3300048926 Ga0496123_0187191 Ga0496123_0187191_124_810 228
575 3300048926 Ga0496123_0187686 Ga0496123_0187686_66_752 228
576 3300048926 Ga0496123_0199835 Ga0496123_0199835_132_818 228
577 3300048926 Ga0496123_0231010 Ga0496123_0231010_104_790 228
578 3300048927 Ga0496124_0000058 Ga0496124_0000058_35399_36085 228
579 3300048927 Ga0496124_0000142 Ga0496124_0000142_9827_10513 228
580 3300048927 Ga0496124_0000238 Ga0496124_0000238_65448_66134 228
581 3300048927 Ga0496124_0000528 Ga0496124_0000528_55862_56548 228
582 3300048927 Ga0496124_0000965 Ga0496124_0000965_32532_33236 228
583 3300048927 Ga0496124_0006756 Ga0496124_0006756_206_892 228
584 3300048927 Ga0496124_0016519 Ga0496124_0016519_4813_5517 228
585 3300048927 Ga0496124_0027757 Ga0496124_0027757_1980_2666 228
586 3300048927 Ga0496124_0043456 Ga0496124_0043456_602_1306 228
587 3300048927 Ga0496124_0067154 Ga0496124_0067154_373_1110 228
588 3300048927 Ga0496124_0076976 Ga0496124_0076976_663_1367 228
589 3300048927 Ga0496124_0160833 Ga0496124_0160833_161_847 228
590 3300048927 Ga0496124_0184809 Ga0496124_0184809_810_1496 228
591 3300048927 Ga0496124_0285434 Ga0496124_0285434_492_1178 228
592 3300048927 Ga0496124_0416986 Ga0496124_0416986_202_906 228
593 3300048928 Ga0496125_0000032 Ga0496125_0000032_249515_250201 228
594 3300048928 Ga0496125_0000384 Ga0496125_0000384_7507_8193 228
595 3300048928 Ga0496125_0011357 Ga0496125_0011357_309_995 228
596 3300048928 Ga0496125_0015148 Ga0496125_0015148_2515_3219 228
597 3300048928 Ga0496125_0037736 Ga0496125_0037736_2672_3358 228
598 3300048928 Ga0496125_0193044 Ga0496125_0193044_233_919 228
599 3300048928 Ga0496125_0282358 Ga0496125_0282358_136_822 228
600 3300048929 Ga0496126_0000109 Ga0496126_0000109_58053_58739 228
601 3300048929 Ga0496126_0036712 Ga0496126_0036712_1065_1769 228
602 3300048929 Ga0496126_0050965 Ga0496126_0050965_68_754 228
603 3300048929 Ga0496126_0061296 Ga0496126_0061296_1673_2377 228
604 3300048929 Ga0496126_0083323 Ga0496126_0083323_788_1474 228
605 3300048929 Ga0496126_0303053 Ga0496126_0303053_438_1124 228
606 3300048929 Ga0496126_0372754 Ga0496126_0372754_304_990 228
607 3300049460 Ga0495682_0000003 Ga0495682_0000003_204549_205250 228
608 3300050491 nmdc:mga00v17_229400_c1 nmdc:mga00v17_229400_c1_373_1110 228
609 3300053126 Ga0500621_000006 Ga0500621_000006_194321_195022 228
610 iso_pu_bacteria 2537561728 2538427029 228
611 iso_pu_bacteria 2608642108 2608670520 228

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00588

SpoU_methylase

SpoU rRNA Methylase family

1

148

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
3kty-assembly2.cif.gz_C crystal structure of probable methyltransferase from bordetella pertussis tohama i 0.9219 2 159
5gmc-assembly1.cif.gz_A methylation at position 32 of trna catalyzed by trmj alters oxidative stress response in pseudomonas aeruiginosa 0.9044 3 159
4cne-assembly1.cif.gz_A crystal structure of e.coli trmj in complex with s-adenosyl-l- homocysteine 0.9001 3 157
4cne-assembly1.cif.gz_B crystal structure of e.coli trmj in complex with s-adenosyl-l- homocysteine 0.8998 3 157
3onp-assembly1.cif.gz_A-2 crystal structure of trna/rrna methyltransferase spou from rhodobacter sphaeroides 0.8922 1 157
ID Description Score Start End Superfamily
3ktyA01 Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain 0.8887 2 159 3.40.1280.10
4cngB00 Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain 0.8821 1 157 3.40.1280.10
3onpA00 Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain 0.8789 1 157 3.40.1280.10
4cndB01 Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain 0.8726 3 157 3.40.1280.10
af_P37005_1_177_3.40.1280.10 Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain 0.8722 1 176 3.40.1280.10
ID Description Score Start End GO Terms
AF-A0A381GSW4-F1-model_v4 deleted 0.961 1 112
AF-A0A6L3XU80-F1-model_v4 tRNA (cytidine/uridine-2'-O-)-methyltransferase TrmJ (EC 2.1.1.200) (tRNA (cytidine(32)/uridine(32)-2'-O)-methyltransferase) (tRNA Cm32/Um32 methyltransferase) 0.9522 1 154 GO:0002128
GO:0003723
GO:0005829
GO:0160206
AF-A0A6L3XU80-F1-model_v4 tRNA (cytidine/uridine-2'-O-)-methyltransferase TrmJ (EC 2.1.1.200) (tRNA (cytidine(32)/uridine(32)-2'-O)-methyltransferase) (tRNA Cm32/Um32 methyltransferase) 0.9462 1 154 GO:0002128
GO:0003723
GO:0005829
GO:0160206
AF-A0A256WF56-F1-model_v4 tRNA/rRNA methyltransferase 0.9368 2 131 GO:0002128
GO:0003723
GO:0005829
GO:0008173
AF-A0A381GSW4-F1-model_v4 deleted 0.9365 1 112

Feature Viewer

pLDDT pTM Quality
80.91 0.66 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map