F468794

General Info

Members Datasets Scaffolds Average Seq Length
608 276 608 119

Family's Representative Sequence

Representative Sequence 3300025934|Ga0207686_11051624|Ga0207686_110516242
Length 127
Sequence MSMALEGALLSALASPRRQEILRLTWREERTAGAIHQAMPDVTFGAVSLQLKALLEAGLIEARVEKSDRRNRYYKARPEALGEMGKMLERMWDDALWKLKVAAELEETRRGPRPSRKTSRRTKGKKK

Samples

Sample ID Description Type Environment
1 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
27 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
28 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
29 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
30 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
31 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
32 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
33 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
39 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
40 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
41 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
42 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
43 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
44 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
45 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
46 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
47 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
48 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
49 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
50 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
51 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
52 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
53 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
54 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
55 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
56 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
57 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
58 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
59 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
60 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
61 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
62 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
63 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
64 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
65 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
66 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
68 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
69 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
70 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
71 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
72 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
73 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
74 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
75 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
76 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
78 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
79 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
81 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
82 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
83 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
84 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
85 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
86 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
87 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
88 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
89 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
90 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
91 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
92 3300012492 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.yng.030610 Metagenome Rhizosphere
93 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
94 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
95 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
96 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
97 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
98 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
99 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
100 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
101 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
102 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
103 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
104 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
105 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
106 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
107 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
108 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
164 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
168 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
169 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
170 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
171 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
172 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
173 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
174 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
175 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
176 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
177 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
178 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
179 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
180 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
181 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
182 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
183 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
184 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
185 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
186 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
187 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
188 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
189 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
190 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
191 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
192 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
193 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
194 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
195 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
196 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
197 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
198 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
199 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
200 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
201 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
202 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
203 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
204 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
205 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
206 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
207 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
208 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
209 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
210 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
211 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
212 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
213 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
214 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
215 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
216 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
217 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
218 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
219 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
220 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
221 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
222 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
223 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
224 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
225 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
226 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
227 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
228 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
229 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
230 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
231 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
232 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
233 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
234 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
235 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
236 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
237 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
238 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
239 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
240 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
241 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
242 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
243 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
244 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
245 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
246 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
247 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
248 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
249 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
250 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
251 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
252 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
253 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
254 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
255 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
256 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
257 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
258 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
259 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
260 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
261 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
262 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
263 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
264 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
265 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
266 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
267 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
268 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
269 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
270 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
271 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
272 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
273 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
274 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
275 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
276 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.16
Nodule 0
Rhizoplane 4.11
Rhizosphere 95.23
Stem 0
Stem Tuber 0
Unclassified 0.49

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065712_10100903 3300005290 Bacteria 2049
2 Ga0065712_10153387 3300005290 Bacteria 1352
3 Ga0065715_10005279 3300005293 Bacteria 5406
4 Ga0065715_10432559 3300005293 Bacteria 845
5 Ga0070658_10941364 3300005327 Unclassified 751
6 Ga0070676_10007930 3300005328 Bacteria 5708
7 Ga0070683_100013920 3300005329 Bacteria 7027
8 Ga0070683_100028255 3300005329 Bacteria 5068
9 Ga0070683_100077653 3300005329 Bacteria 3105
10 Ga0070690_100028336 3300005330 Bacteria 3468
11 Ga0070690_100134820 3300005330 Unclassified 1671
12 Ga0070690_100437243 3300005330 Bacteria 967
13 Ga0070670_100033660 3300005331 Bacteria 4414
14 Ga0070670_100047539 3300005331 Bacteria 3693
15 Ga0070670_100688426 3300005331 Bacteria 919
16 Ga0070677_10006623 3300005333 Bacteria 3850
17 Ga0068869_100011562 3300005334 Bacteria 5794
18 Ga0068869_100424523 3300005334 Bacteria 1097
19 Ga0070666_10047517 3300005335 Bacteria 2881
20 Ga0070666_10142396 3300005335 Bacteria 1670
21 Ga0070666_10853510 3300005335 Bacteria 672
22 Ga0068868_100011370 3300005338 Bacteria 6481
23 Ga0068868_100535489 3300005338 Bacteria 1030
24 Ga0068868_100949065 3300005338 Unclassified 784
25 Ga0070660_101042719 3300005339 Unclassified 691
26 Ga0070689_100032116 3300005340 Bacteria 3992
27 Ga0070687_100028647 3300005343 Bacteria 2704
28 Ga0070661_100015020 3300005344 Bacteria 5464
29 Ga0070661_100383849 3300005344 Bacteria 1108
30 Ga0070661_100508413 3300005344 Bacteria 965
31 Ga0070661_100903923 3300005344 Bacteria 729
32 Ga0070692_10113356 3300005345 Bacteria 1503
33 Ga0070692_10948167 3300005345 Unclassified 598
34 Ga0070668_100115892 3300005347 Bacteria 2136
35 Ga0070668_100256563 3300005347 Bacteria 1453
36 Ga0070669_100048332 3300005353 Bacteria 3105
37 Ga0070669_100339727 3300005353 Bacteria 1216
38 Ga0070669_101865957 3300005353 Bacteria 525
39 Ga0070675_100000717 3300005354 Bacteria 23058
40 Ga0070675_100093550 3300005354 Bacteria 2521
41 Ga0070675_100205843 3300005354 Bacteria 1709
42 Ga0070675_100206743 3300005354 Bacteria 1705
43 Ga0070675_100949873 3300005354 Bacteria 789
44 Ga0070671_100064212 3300005355 Bacteria 3058
45 Ga0070671_100064247 3300005355 Bacteria 3057
46 Ga0070671_100344160 3300005355 Bacteria 1272
47 Ga0070671_101063390 3300005355 Bacteria 710
48 Ga0070671_101398626 3300005355 Unclassified 618
49 Ga0070674_100100329 3300005356 Bacteria 2108
50 Ga0070674_101172883 3300005356 Unclassified 681
51 Ga0070673_100005159 3300005364 Bacteria 8336
52 Ga0070673_100086244 3300005364 Bacteria 2558
53 Ga0070673_100132883 3300005364 Bacteria 2091
54 Ga0070673_100209173 3300005364 Unclassified 1684
55 Ga0070673_100233272 3300005364 Bacteria 1597
56 Ga0070673_100998898 3300005364 Unclassified 779
57 Ga0070673_101616756 3300005364 Bacteria 612
58 Ga0070688_100200625 3300005365 Bacteria 1395
59 Ga0070688_100966812 3300005365 Bacteria 675
60 Ga0070659_100083864 3300005366 Unclassified 2548
61 Ga0070659_100089438 3300005366 Bacteria 2466
62 Ga0070659_100231941 3300005366 Bacteria 1526
63 Ga0070667_100061901 3300005367 Bacteria 3169
64 Ga0070709_11583042 3300005434 Unclassified 533
65 Ga0070714_100020496 3300005435 Bacteria 5399
66 Ga0070713_100091619 3300005436 Bacteria 2616
67 Ga0070713_100382937 3300005436 Unclassified 1311
68 Ga0070701_10029960 3300005438 Bacteria 2688
69 Ga0070701_10040810 3300005438 Bacteria 2361
70 Ga0070711_100802620 3300005439 Bacteria 798
71 Ga0070705_101284893 3300005440 Bacteria 606
72 Ga0070700_100151730 3300005441 Bacteria 1585
73 Ga0070700_100152722 3300005441 Bacteria 1581
74 Ga0070700_100743122 3300005441 Bacteria 784
75 Ga0070700_101265346 3300005441 Bacteria 619
76 Ga0070708_100098075 3300005445 Bacteria 2680
77 Ga0070708_101325806 3300005445 Bacteria 672
78 Ga0070663_100930727 3300005455 Unclassified 752
79 Ga0070678_100138427 3300005456 Bacteria 1944
80 Ga0070678_100213534 3300005456 Unclassified 1600
81 Ga0070678_100418894 3300005456 Bacteria 1167
82 Ga0070662_100025107 3300005457 Bacteria 4112
83 Ga0070662_100026179 3300005457 Bacteria 4038
84 Ga0068867_100008076 3300005459 Bacteria 7437
85 Ga0068867_100559880 3300005459 Unclassified 991
86 Ga0068867_100614607 3300005459 Unclassified 949
87 Ga0070685_10003913 3300005466 Bacteria 7527
88 Ga0070707_101088759 3300005468 Bacteria 765
89 Ga0070699_100643054 3300005518 Unclassified 968
90 Ga0070679_100833668 3300005530 Unclassified 865
91 Ga0070684_100048231 3300005535 Bacteria 3695
92 Ga0070684_100066609 3300005535 Bacteria 3161
93 Ga0070684_100084687 3300005535 Bacteria 2810
94 Ga0070684_100091701 3300005535 Unclassified 2703
95 Ga0070684_100093990 3300005535 Unclassified 2670
96 Ga0070697_100783671 3300005536 Bacteria 843
97 Ga0070697_101389876 3300005536 Bacteria 627
98 Ga0068853_100094588 3300005539 Unclassified 2633
99 Ga0070672_100021412 3300005543 Bacteria 4730
100 Ga0070672_100035025 3300005543 Unclassified 3813
101 Ga0070672_100060228 3300005543 Bacteria 2989
102 Ga0070672_101529016 3300005543 Bacteria 598
103 Ga0070686_100017352 3300005544 Bacteria 4204
104 Ga0070686_100251582 3300005544 Unclassified 1291
105 Ga0070686_100428480 3300005544 Unclassified 1012
106 Ga0070686_100653260 3300005544 Unclassified 834
107 Ga0070696_100117208 3300005546 Bacteria 1924
108 Ga0070696_100530970 3300005546 Bacteria 940
109 Ga0070696_100820006 3300005546 Bacteria 767
110 Ga0070693_100042229 3300005547 Bacteria 2569
111 Ga0070693_100125721 3300005547 Bacteria 1596
112 Ga0070693_101456421 3300005547 Unclassified 534
113 Ga0070665_100914874 3300005548 Bacteria 890
114 Ga0070665_100977917 3300005548 Bacteria 859
115 Ga0070664_100001464 3300005564 Bacteria 18810
116 Ga0070664_100442056 3300005564 Bacteria 1193
117 Ga0070664_101329569 3300005564 Bacteria 679
118 Ga0070664_101669021 3300005564 Bacteria 604
119 Ga0068857_100027836 3300005577 Bacteria 4984
120 Ga0068857_100167916 3300005577 Bacteria 1993
121 Ga0068854_100731167 3300005578 Bacteria 857
122 Ga0068856_100012612 3300005614 Bacteria 8181
123 Ga0068856_100182673 3300005614 Bacteria 2111
124 Ga0068856_100858637 3300005614 Bacteria 927
125 Ga0070702_101450618 3300005615 Unclassified 563
126 Ga0068852_101195142 3300005616 Bacteria 781
127 Ga0068859_100052270 3300005617 Bacteria 4107
128 Ga0068859_100387711 3300005617 Bacteria 1493
129 Ga0068859_100726635 3300005617 Bacteria 1083
130 Ga0068859_100972072 3300005617 Bacteria 932
131 Ga0068864_100070523 3300005618 Bacteria 3041
132 Ga0068864_100227816 3300005618 Bacteria 1722
133 Ga0068864_100534049 3300005618 Unclassified 1132
134 Ga0068861_100020900 3300005719 Bacteria 4697
135 Ga0068870_10001750 3300005840 Bacteria 8901
136 Ga0068863_100007501 3300005841 Bacteria 10671
137 Ga0068863_100979838 3300005841 Unclassified 848
138 Ga0068863_101163007 3300005841 Unclassified 777
139 Ga0068863_101185900 3300005841 Bacteria 769
140 Ga0068863_102157800 3300005841 Unclassified 567
141 Ga0068863_102702468 3300005841 Unclassified 505
142 Ga0068858_100018658 3300005842 Bacteria 6494
143 Ga0068858_100137898 3300005842 Bacteria 2289
144 Ga0068858_100621230 3300005842 Unclassified 1049
145 Ga0068858_101724773 3300005842 Unclassified 618
146 Ga0068860_100066596 3300005843 Bacteria 3421
147 Ga0068860_100174441 3300005843 Bacteria 2078
148 Ga0068860_100605705 3300005843 Unclassified 1101
149 Ga0068860_101511362 3300005843 Bacteria 693
150 Ga0068862_100001318 3300005844 Bacteria 23064
151 Ga0068862_101323164 3300005844 Bacteria 722
152 Ga0081539_10000107 3300005985 Bacteria 195503
153 Ga0081539_10009987 3300005985 Bacteria 7821
154 Ga0070717_10383726 3300006028 Unclassified 1260
155 Ga0097621_100080773 3300006237 Bacteria 2705
156 Ga0097621_100272800 3300006237 Bacteria 1487
157 Ga0097621_100341500 3300006237 Unclassified 1330
158 Ga0097621_100527038 3300006237 Unclassified 1073
159 Ga0097621_101036924 3300006237 Unclassified 768
160 Ga0097621_101400569 3300006237 Bacteria 662
161 Ga0068871_100036875 3300006358 Bacteria 3895
162 Ga0068871_100076589 3300006358 Bacteria 2763
163 Ga0068871_100355994 3300006358 Unclassified 1296
164 Ga0075428_100078641 3300006844 Bacteria 3600
165 Ga0075428_101429223 3300006844 Unclassified 725
166 Ga0075430_100005932 3300006846 Bacteria 10320
167 Ga0075430_100007866 3300006846 Bacteria 9011
168 Ga0075430_100010875 3300006846 Bacteria 7708
169 Ga0075431_100007383 3300006847 Bacteria 10941
170 Ga0075431_100007549 3300006847 Bacteria 10827
171 Ga0075431_101988073 3300006847 Bacteria 537
172 Ga0075433_10004312 3300006852 Bacteria 11044
173 Ga0075433_11223674 3300006852 Bacteria 651
174 Ga0075433_11310606 3300006852 Unclassified 627
175 Ga0075434_100178070 3300006871 Bacteria 2146
176 Ga0075434_100404685 3300006871 Bacteria 1386
177 Ga0075434_100465626 3300006871 Bacteria 1285
178 Ga0075434_101567381 3300006871 Bacteria 667
179 Ga0075429_100004117 3300006880 Bacteria 12446
180 Ga0075429_100039891 3300006880 Bacteria 4086
181 Ga0075429_100115968 3300006880 Bacteria 2341
182 Ga0075429_100673112 3300006880 Unclassified 907
183 Ga0075429_100810923 3300006880 Bacteria 820
184 Ga0075429_100849905 3300006880 Unclassified 799
185 Ga0068865_100012200 3300006881 Bacteria 5404
186 Ga0075436_100099128 3300006914 Bacteria 2028
187 Ga0075436_100269247 3300006914 Bacteria 1216
188 Ga0075436_100347607 3300006914 Bacteria 1068
189 Ga0075436_100398240 3300006914 Unclassified 997
190 Ga0097620_100052272 3300006931 Bacteria 4107
191 Ga0097620_100387716 3300006931 Bacteria 1493
192 Ga0097620_100726585 3300006931 Bacteria 1083
193 Ga0097620_100972055 3300006931 Bacteria 932
194 Ga0075435_100064288 3300007076 Bacteria 2981
195 Ga0105240_10260044 3300009093 Bacteria 2003
196 Ga0105240_10352799 3300009093 Bacteria 1668
197 Ga0111539_10576590 3300009094 Bacteria 1310
198 Ga0111539_12011896 3300009094 Unclassified 670
199 Ga0105245_10003759 3300009098 Bacteria 13512
200 Ga0105245_10030565 3300009098 Bacteria 4763
201 Ga0105245_10051376 3300009098 Bacteria 3696
202 Ga0105245_10195875 3300009098 Bacteria 1938
203 Ga0105245_10904286 3300009098 Bacteria 924
204 Ga0105245_10933074 3300009098 Bacteria 910
205 Ga0105247_10349361 3300009101 Bacteria 1039
206 Ga0114129_10003784 3300009147 Bacteria 21336
207 Ga0114129_10004070 3300009147 Bacteria 20644
208 Ga0114129_10045388 3300009147 Bacteria 6178
209 Ga0114129_10169582 3300009147 Unclassified 2976
210 Ga0114129_10608086 3300009147 Bacteria 1415
211 Ga0105243_10172170 3300009148 Bacteria 1876
212 Ga0105243_10453705 3300009148 Bacteria 1204
213 Ga0105243_11010973 3300009148 Unclassified 835
214 Ga0105241_10022046 3300009174 Bacteria 4715
215 Ga0105241_10342345 3300009174 Unclassified 1296
216 Ga0105242_10277304 3300009176 Bacteria 1521
217 Ga0105242_10445251 3300009176 Bacteria 1220
218 Ga0105242_10472350 3300009176 Bacteria 1187
219 Ga0105242_10908045 3300009176 Unclassified 881
220 Ga0105242_11778285 3300009176 Unclassified 654
221 Ga0105242_12890881 3300009176 Bacteria 531
222 Ga0105248_10009093 3300009177 Bacteria 10927
223 Ga0105248_10009327 3300009177 Bacteria 10807
224 Ga0105248_10299332 3300009177 Bacteria 1811
225 Ga0105248_11159140 3300009177 Unclassified 874
226 Ga0105248_11169942 3300009177 Unclassified 869
227 Ga0105248_11917817 3300009177 Bacteria 672
228 Ga0105237_10007630 3300009545 Bacteria 11820
229 Ga0105237_10008101 3300009545 Bacteria 11418
230 Ga0105237_10117354 3300009545 Bacteria 2655
231 Ga0105238_10019149 3300009551 Bacteria 6974
232 Ga0105238_10028601 3300009551 Bacteria 5679
233 Ga0105238_10444324 3300009551 Bacteria 1293
234 Ga0105249_10037351 3300009553 Bacteria 4408
235 Ga0105249_10078472 3300009553 Bacteria 3064
236 Ga0105249_10131545 3300009553 Bacteria 2389
237 Ga0105239_10035610 3300010375 Bacteria 5466
238 Ga0105239_10072582 3300010375 Bacteria 3784
239 Ga0105246_10013213 3300011119 Bacteria 5170
240 Ga0105246_10015668 3300011119 Bacteria 4790
241 Ga0105246_10082103 3300011119 Bacteria 2299
242 Ga0105246_10388114 3300011119 Unclassified 1156
243 Ga0157335_1041960 3300012492 Unclassified 519
244 Ga0157342_1009623 3300012507 Bacteria 975
245 Ga0157370_10472529 3300013104 Bacteria 1152
246 Ga0157370_11106856 3300013104 Unclassified 716
247 Ga0157369_10046007 3300013105 Bacteria 4744
248 Ga0157369_10406837 3300013105 Bacteria 1411
249 Ga0157374_10020255 3300013296 Bacteria 5899
250 Ga0157374_10069144 3300013296 Bacteria 3324
251 Ga0157374_10176424 3300013296 Bacteria 2086
252 Ga0157374_10556489 3300013296 Bacteria 1155
253 Ga0157374_10935759 3300013296 Unclassified 885
254 Ga0157374_12477871 3300013296 Unclassified 546
255 Ga0157378_10052391 3300013297 Bacteria 3631
256 Ga0157378_11233712 3300013297 Unclassified 788
257 Ga0163162_10057935 3300013306 Bacteria 3902
258 Ga0163162_11078576 3300013306 Unclassified 910
259 Ga0163162_11346214 3300013306 Unclassified 812
260 Ga0163162_11822797 3300013306 Bacteria 696
261 Ga0157372_10109296 3300013307 Bacteria 3166
262 Ga0157372_10167184 3300013307 Bacteria 2544
263 Ga0157372_12026260 3300013307 Bacteria 661
264 Ga0157372_12640316 3300013307 Bacteria 576
265 Ga0157375_10010496 3300013308 Bacteria 8154
266 Ga0157375_10046872 3300013308 Bacteria 4217
267 Ga0157375_10091017 3300013308 Bacteria 3111
268 Ga0157375_10319657 3300013308 Bacteria 1717
269 Ga0163163_10032629 3300014325 Bacteria 5032
270 Ga0163163_10052703 3300014325 Bacteria 4014
271 Ga0163163_10189969 3300014325 Unclassified 2102
272 Ga0163163_10293699 3300014325 Bacteria 1677
273 Ga0163163_12113362 3300014325 Unclassified 623
274 Ga0157380_10028283 3300014326 Bacteria 4272
275 Ga0157380_13422617 3300014326 Bacteria 508
276 Ga0157377_10514528 3300014745 Bacteria 839
277 Ga0157379_10003010 3300014968 Bacteria 14229
278 Ga0157379_10092626 3300014968 Bacteria 2711
279 Ga0157379_10203719 3300014968 Bacteria 1790
280 Ga0157376_10269634 3300014969 Bacteria 1598
281 Ga0157376_10278583 3300014969 Bacteria 1574
282 Ga0157376_10290139 3300014969 Bacteria 1544
283 Ga0157376_10565591 3300014969 Bacteria 1127
284 Ga0157376_10964056 3300014969 Bacteria 874
285 Ga0163161_10074396 3300017792 Bacteria 2491
286 Ga0163161_10457212 3300017792 Unclassified 1033
287 Ga0213875_10002951 3300021388 Bacteria 9909
288 Ga0207697_10000443 3300025315 Bacteria 23388
289 Ga0207656_10680845 3300025321 Unclassified 526
290 Ga0207682_10000492 3300025893 Bacteria 18262
291 Ga0207642_10425636 3300025899 Unclassified 799
292 Ga0207688_10000727 3300025901 Bacteria 16326
293 Ga0207680_11053070 3300025903 Bacteria 582
294 Ga0207680_11291203 3300025903 Unclassified 519
295 Ga0207645_10003192 3300025907 Bacteria 12545
296 Ga0207643_10008797 3300025908 Bacteria 5416
297 Ga0207705_10611205 3300025909 Unclassified 848
298 Ga0207684_10580586 3300025910 Unclassified 958
299 Ga0207671_10047654 3300025914 Bacteria 3172
300 Ga0207671_10111517 3300025914 Bacteria 2081
301 Ga0207663_10924761 3300025916 Bacteria 698
302 Ga0207660_10498190 3300025917 Unclassified 988
303 Ga0207662_10023035 3300025918 Bacteria 3575
304 Ga0207657_11136118 3300025919 Unclassified 596
305 Ga0207649_10276575 3300025920 Bacteria 1219
306 Ga0207649_10560367 3300025920 Unclassified 875
307 Ga0207652_11555816 3300025921 Unclassified 565
308 Ga0207681_10027408 3300025923 Bacteria 3683
309 Ga0207681_10153151 3300025923 Bacteria 1730
310 Ga0207681_10382070 3300025923 Unclassified 1134
311 Ga0207681_10636690 3300025923 Bacteria 883
312 Ga0207694_10021351 3300025924 Bacteria 4906
313 Ga0207694_10123683 3300025924 Bacteria 2067
314 Ga0207694_10177248 3300025924 Bacteria 1727
315 Ga0207694_10943579 3300025924 Bacteria 730
316 Ga0207650_10043864 3300025925 Bacteria 3285
317 Ga0207650_10266673 3300025925 Bacteria 1391
318 Ga0207650_10752760 3300025925 Bacteria 824
319 Ga0207659_10058809 3300025926 Bacteria 2760
320 Ga0207659_10424042 3300025926 Unclassified 1116
321 Ga0207659_11654625 3300025926 Bacteria 546
322 Ga0207687_10018973 3300025927 Bacteria 4550
323 Ga0207687_10118089 3300025927 Bacteria 1979
324 Ga0207687_10241897 3300025927 Bacteria 1431
325 Ga0207687_11479753 3300025927 Unclassified 583
326 Ga0207700_10224061 3300025928 Bacteria 1595
327 Ga0207700_10503959 3300025928 Unclassified 1071
328 Ga0207664_10015746 3300025929 Bacteria 5500
329 Ga0207644_10028408 3300025931 Bacteria 3872
330 Ga0207644_10299739 3300025931 Bacteria 1295
331 Ga0207644_10342078 3300025931 Bacteria 1213
332 Ga0207644_10739641 3300025931 Bacteria 821
333 Ga0207644_10954039 3300025931 Unclassified 719
334 Ga0207690_10033662 3300025932 Bacteria 3297
335 Ga0207690_10197556 3300025932 Bacteria 1525
336 Ga0207690_10254731 3300025932 Unclassified 1357
337 Ga0207690_11478036 3300025932 Bacteria 568
338 Ga0207706_10009564 3300025933 Bacteria 8900
339 Ga0207706_10011832 3300025933 Bacteria 7945
340 Ga0207686_10076996 3300025934 Bacteria 2165
341 Ga0207686_10514703 3300025934 Bacteria 930
342 Ga0207686_11051624 3300025934 Unclassified 662
343 Ga0207686_11205194 3300025934 Unclassified 620
344 Ga0207709_10560553 3300025935 Bacteria 900
345 Ga0207709_10968970 3300025935 Bacteria 694
346 Ga0207670_11594334 3300025936 Unclassified 555
347 Ga0207704_10216308 3300025938 Unclassified 1414
348 Ga0207704_11222186 3300025938 Unclassified 641
349 Ga0207665_10438569 3300025939 Bacteria 1000
350 Ga0207691_10006460 3300025940 Bacteria 11327
351 Ga0207691_10007854 3300025940 Bacteria 10277
352 Ga0207691_11321354 3300025940 Unclassified 595
353 Ga0207691_11418518 3300025940 Bacteria 570
354 Ga0207711_10055719 3300025941 Bacteria 3394
355 Ga0207711_10098267 3300025941 Bacteria 2586
356 Ga0207711_10223248 3300025941 Bacteria 1724
357 Ga0207711_10298672 3300025941 Bacteria 1485
358 Ga0207689_10001107 3300025942 Bacteria 25998
359 Ga0207689_10106792 3300025942 Bacteria 2300
360 Ga0207661_10051241 3300025944 Unclassified 3293
361 Ga0207661_10076551 3300025944 Bacteria 2748
362 Ga0207661_10682358 3300025944 Bacteria 944
363 Ga0207679_10006202 3300025945 Bacteria 7547
364 Ga0207679_11081061 3300025945 Unclassified 736
365 Ga0207667_10054354 3300025949 Bacteria 4212
366 Ga0207667_10305514 3300025949 Bacteria 1625
367 Ga0207667_10395103 3300025949 Unclassified 1408
368 Ga0207651_10020469 3300025960 Bacteria 3993
369 Ga0207651_10482096 3300025960 Unclassified 1069
370 Ga0207651_10671639 3300025960 Bacteria 911
371 Ga0207651_10733838 3300025960 Unclassified 872
372 Ga0207651_11859283 3300025960 Bacteria 542
373 Ga0207712_10006641 3300025961 Bacteria 7303
374 Ga0207712_10171159 3300025961 Bacteria 1698
375 Ga0207712_10325773 3300025961 Bacteria 1269
376 Ga0207712_10524372 3300025961 Unclassified 1016
377 Ga0207712_11580281 3300025961 Bacteria 588
378 Ga0207712_12033836 3300025961 Unclassified 514
379 Ga0207668_10919325 3300025972 Bacteria 779
380 Ga0207658_10466023 3300025986 Bacteria 1121
381 Ga0207658_11093658 3300025986 Unclassified 728
382 Ga0207677_10153864 3300026023 Bacteria 1778
383 Ga0207677_10888139 3300026023 Unclassified 803
384 Ga0207703_10103737 3300026035 Bacteria 2414
385 Ga0207703_10338028 3300026035 Bacteria 1383
386 Ga0207703_10572833 3300026035 Bacteria 1066
387 Ga0207639_10507008 3300026041 Unclassified 1103
388 Ga0207678_11167207 3300026067 Unclassified 682
389 Ga0207708_10168239 3300026075 Bacteria 1734
390 Ga0207708_11275325 3300026075 Bacteria 643
391 Ga0207708_11995871 3300026075 Bacteria 508
392 Ga0207702_10068041 3300026078 Unclassified 3059
393 Ga0207702_10201499 3300026078 Bacteria 1845
394 Ga0207641_10016310 3300026088 Bacteria 6083
395 Ga0207641_10954468 3300026088 Bacteria 853
396 Ga0207641_11056146 3300026088 Unclassified 810
397 Ga0207641_11507280 3300026088 Unclassified 674
398 Ga0207641_11525154 3300026088 Bacteria 670
399 Ga0207641_11773029 3300026088 Unclassified 619
400 Ga0207641_12609879 3300026088 Unclassified 503
401 Ga0207648_10064133 3300026089 Bacteria 3202
402 Ga0207648_10095443 3300026089 Bacteria 2601
403 Ga0207676_10056606 3300026095 Bacteria 3084
404 Ga0207676_10269539 3300026095 Bacteria 1541
405 Ga0207676_10579707 3300026095 Unclassified 1075
406 Ga0207674_10002402 3300026116 Bacteria 23626
407 Ga0207674_10063731 3300026116 Bacteria 3719
408 Ga0207675_100034374 3300026118 Bacteria 4726
409 Ga0207675_100208446 3300026118 Unclassified 1879
410 Ga0207675_100467393 3300026118 Bacteria 1252
411 Ga0207675_101261671 3300026118 Bacteria 759
412 Ga0207683_10009105 3300026121 Bacteria 8462
413 Ga0207683_10340418 3300026121 Bacteria 1376
414 Ga0207683_10435992 3300026121 Bacteria 1207
415 Ga0207683_10494113 3300026121 Bacteria 1130
416 Ga0207698_10203294 3300026142 Bacteria 1776
417 Ga0207698_10425934 3300026142 Bacteria 1275
418 Ga0207698_10738751 3300026142 Unclassified 982
419 Ga0207698_11102149 3300026142 Unclassified 807
420 Ga0207428_10003783 3300027907 Bacteria 14518
421 Ga0268266_10101448 3300028379 Bacteria 2537
422 Ga0268266_10617871 3300028379 Bacteria 1042
423 Ga0268265_10019094 3300028380 Bacteria 4758
424 Ga0268265_10338021 3300028380 Bacteria 1370
425 Ga0268265_11307325 3300028380 Bacteria 725
426 Ga0268264_10189409 3300028381 Bacteria 1874
427 Ga0268264_10351629 3300028381 Bacteria 1403
428 Ga0268264_10952217 3300028381 Bacteria 864
429 Ga0265314_10212004 3300031711 Bacteria 1137
430 Ga0307405_11401870 3300031731 Unclassified 611
431 Ga0307416_102371216 3300032002 Unclassified 630
432 Ga0307415_100390918 3300032126 Bacteria 1184
433 Ga0373950_0155932 3300034818 Unclassified 525
434 Ga0373958_0023660 3300034819 Unclassified 1157
435 Ga0373959_0146183 3300034820 Unclassified 595
436 Ga0373938_0092025 3300034957 Unclassified 751
437 Ga0373934_0004220 3300035086 Bacteria 5304
438 Ga0373934_0073813 3300035086 Unclassified 1366
439 Ga0373940_0003235 3300035088 Bacteria 3298
440 Ga0373944_0434048 3300035089 Unclassified 510
441 Ga0373949_0074752 3300035090 Bacteria 893
442 Ga0373923_0089127 3300035111 Unclassified 1347
443 Ga0373932_0032293 3300035112 Bacteria 1463
444 Ga0373941_0164219 3300035115 Unclassified 823
445 Ga0373945_0337312 3300035116 Bacteria 651
446 Ga0373945_0539606 3300035116 Unclassified 522
447 Ga0373953_0028711 3300035117 Unclassified 2147
448 Ga0373954_0113213 3300035118 Bacteria 1313
449 Ga0373954_0220625 3300035118 Unclassified 933
450 Ga0373954_0277381 3300035118 Unclassified 826
451 Ga0373960_0103345 3300035121 Bacteria 926
452 Ga0373943_0080560 3300035170 Bacteria 1669
453 Ga0373946_0103421 3300035171 Unclassified 1280
454 Ga0373946_0166072 3300035171 Unclassified 1039
455 Ga0373955_0043756 3300035172 Bacteria 2410
456 Ga0373924_0093602 3300035410 Bacteria 1287
457 Ga0373931_0085910 3300035691 Bacteria 1745
458 Ga0373935_0570471 3300035692 Unclassified 826
459 Ga0373927_0128678 3300035695 Archaea 1654
460 Ga0373927_0293595 3300035695 Unclassified 1070
461 Ga0373927_0755681 3300035695 Bacteria 642
462 Ga0373933_0016820 3300035724 Bacteria 4098
463 Ga0373933_0242982 3300035724 Unclassified 1158
464 Ga0373933_0879503 3300035724 Unclassified 590
465 Ga0373947_0406951 3300035725 Bacteria 918
466 Ga0373947_0750270 3300035725 Bacteria 666
467 Ga0373937_0002833 3300036401 Bacteria 14500
468 Ga0373937_0050047 3300036401 Bacteria 3826
469 Ga0373937_0052873 3300036401 Unclassified 3726
470 Ga0373937_1297583 3300036401 Unclassified 676
471 Ga0373925_0017602 3300037068 Bacteria 5184
472 Ga0373925_0156497 3300037068 Bacteria 1793
473 Ga0436364_1013559 3300037853 Bacteria 49805
474 Ga0451802_1224248 3300041460 Unclassified 546
475 Ga0451807_1932057 3300041486 Bacteria 546
476 Ga0451807_2712053 3300041486 Unclassified 524
477 Ga0451853_3255850 3300041512 Bacteria 523
478 Ga0439450_069731 3300042008 Bacteria 861
479 Ga0451576_0449587 3300045051 Unclassified 1352
480 Ga0495592_0053013 3300046454 Bacteria 3009
481 Ga0495629_0175954 3300046459 Bacteria 1484
482 Ga0495629_0381033 3300046459 Bacteria 960
483 Ga0495651_0072396 3300046462 Bacteria 2618
484 Ga0495653_0307112 3300046463 Unclassified 1033
485 Ga0495580_0012630 3300046472 Bacteria 6474
486 Ga0495580_0063694 3300046472 Bacteria 2585
487 Ga0495580_0233259 3300046472 Bacteria 1263
488 Ga0495582_0019687 3300046473 Bacteria 3690
489 Ga0495639_0072652 3300046475 Bacteria 1591
490 Ga0495639_0100685 3300046475 Bacteria 1364
491 Ga0495662_0612988 3300046476 Unclassified 532
492 Ga0495594_0081419 3300046499 Bacteria 1808
493 Ga0495594_0614980 3300046499 Bacteria 616
494 Ga0495608_0279332 3300046511 Unclassified 1037
495 Ga0495666_0432519 3300046526 Unclassified 590
496 Ga0495652_0366693 3300046529 Bacteria 1028
497 Ga0495586_0022880 3300046535 Bacteria 3336
498 Ga0495586_0169935 3300046535 Bacteria 1232
499 Ga0495586_0179012 3300046535 Unclassified 1199
500 Ga0495586_0347828 3300046535 Bacteria 851
501 Ga0495587_0001781 3300046536 Bacteria 14395
502 Ga0495598_0056423 3300046537 Unclassified 1199
503 Ga0495645_0098410 3300046543 Bacteria 2082
504 Ga0495634_0176715 3300046642 Bacteria 1339
505 Ga0495635_0395092 3300046663 Bacteria 919
506 Ga0495647_0037515 3300046681 Bacteria 1829
507 Ga0495658_0012808 3300046683 Bacteria 4258
508 Ga0495658_0441712 3300046683 Bacteria 831
509 Ga0495669_0105525 3300046684 Bacteria 1312
510 Ga0495613_0064712 3300046689 Unclassified 2674
511 Ga0495613_0242398 3300046689 Unclassified 1260
512 Ga0495600_0048293 3300046809 Bacteria 2777
513 Ga0495581_0104371 3300047315 Bacteria 1647
514 Ga0495675_0234666 3300047444 Unclassified 1106
515 Ga0495684_0016340 3300047471 Bacteria 5714
516 Ga0496100_0098574 3300048903 Bacteria 2009
517 Ga0496101_0861616 3300048904 Unclassified 714
518 Ga0496102_0610347 3300048905 Unclassified 1014
519 Ga0496104_0019202 3300048907 Bacteria 6250
520 Ga0496104_0737410 3300048907 Bacteria 892
521 Ga0496104_0848973 3300048907 Unclassified 819
522 Ga0496104_1216256 3300048907 Bacteria 657
523 Ga0496105_0100132 3300048908 Bacteria 2393
524 Ga0496106_0125030 3300048909 Unclassified 2013
525 Ga0496107_1174976 3300048910 Unclassified 552
526 Ga0496109_0092907 3300048912 Unclassified 2791
527 Ga0496109_0276928 3300048912 Bacteria 1581
528 Ga0496109_1870359 3300048912 Bacteria 533
529 Ga0496110_0331090 3300048913 Bacteria 1387
530 Ga0496110_1233961 3300048913 Unclassified 657
531 Ga0496111_0960843 3300048914 Unclassified 613
532 Ga0496112_0119803 3300048915 Unclassified 2602
533 Ga0496112_0831531 3300048915 Bacteria 847
534 Ga0496112_0879191 3300048915 Unclassified 819
535 Ga0496112_1214483 3300048915 Bacteria 671
536 Ga0496113_0593829 3300048916 Unclassified 887
537 Ga0496114_0032058 3300048917 Unclassified 4323
538 Ga0501033_0111762 3300049570 Bacteria 1988
539 Ga0501036_0024755 3300049572 Bacteria 5061
540 Ga0501036_1355123 3300049572 Bacteria 577
541 Ga0501037_0077754 3300049573 Bacteria 2408
542 Ga0501038_0086320 3300049574 Bacteria 2637
543 Ga0501039_0077687 3300049575 Bacteria 2582
544 Ga0501039_0218043 3300049575 Bacteria 1500
545 Ga0501040_0017471 3300049576 Bacteria 4761
546 Ga0501041_0038116 3300049577 Unclassified 2914
547 Ga0501042_0131831 3300049578 Bacteria 1801
548 Ga0501046_0073723 3300049580 Unclassified 2649
549 Ga0501048_0127837 3300049582 Bacteria 1797
550 Ga0501068_0385253 3300049584 Bacteria 903
551 Ga0501071_0009788 3300049587 Bacteria 6398
552 Ga0501071_0295956 3300049587 Bacteria 1226
553 Ga0501071_0856440 3300049587 Bacteria 701
554 Ga0501072_0083258 3300049588 Unclassified 2536
555 Ga0501072_0103922 3300049588 Bacteria 2258
556 Ga0501075_0026388 3300049591 Bacteria 4276
557 Ga0501075_1189946 3300049591 Bacteria 578
558 Ga0501076_0000473 3300049592 Bacteria 25423
559 Ga0501076_0114613 3300049592 Bacteria 2181
560 Ga0501077_0150936 3300049593 Bacteria 1474
561 Ga0501079_0243404 3300049741 Bacteria 1405
562 Ga0501079_1555058 3300049741 Bacteria 520
563 Ga0501080_0173446 3300049742 Bacteria 1988
564 Ga0501080_1006001 3300049742 Bacteria 723
565 Ga0501080_1825828 3300049742 Bacteria 510
566 Ga0501081_0045419 3300049743 Bacteria 3016
567 Ga0501083_0200374 3300049744 Bacteria 1302
568 Ga0501045_0028924 3300049824 Bacteria 4000
569 Ga0501045_0945660 3300049824 Unclassified 632
570 nmdc:mga05p37_1154256_c1 3300050507 Bacteria 805
571 nmdc:mga05p37_1198508_c1 3300050507 Unclassified 785
572 nmdc:mga05p37_1622571_c1 3300050507 Unclassified 636
573 nmdc:mga05p37_177038_c1 3300050507 Bacteria 2598
574 nmdc:mga05p37_188453_c1 3300050507 Bacteria 2506
575 nmdc:mga05p37_25424_c1 3300050507 Bacteria 5278
576 nmdc:mga05p37_904646_c1 3300050507 Bacteria 951
577 nmdc:mga09592_685558_c1 3300050508 Unclassified 873
578 nmdc:mga09592_841214_c1 3300050508 Unclassified 774
579 nmdc:mga09592_85652_c1 3300050508 Bacteria 2688
580 nmdc:mga09592_962_c1 3300050508 Bacteria 22725
581 nmdc:mga0qj67_25428_c1 3300050509 Bacteria 4575
582 nmdc:mga0qj67_339222_c1 3300050509 Unclassified 1216
583 nmdc:mga0qj67_488_c1 3300050509 Bacteria 27100
584 nmdc:mga0qj67_659271_c1 3300050509 Bacteria 835
585 nmdc:mga06r32_202080_c1 3300050510 Unclassified 1975
586 nmdc:mga06r32_222071_c1 3300050510 Bacteria 1878
587 nmdc:mga06r32_436632_c1 3300050510 Unclassified 1290
588 nmdc:mga06r32_569319_c1 3300050510 Unclassified 1106
589 nmdc:mga08y16_1147862_c1 3300050511 Unclassified 750
590 nmdc:mga08y16_842413_c1 3300050511 Unclassified 907
591 nmdc:mga08y16_992478_c1 3300050511 Bacteria 820
592 nmdc:mga0n895_102938_c1 3300050512 Bacteria 2866
593 nmdc:mga0n895_2007808_c1 3300050512 Bacteria 536
594 nmdc:mga0n895_284417_c1 3300050512 Bacteria 1677
595 nmdc:mga0rr50_37959_c1 3300050513 Bacteria 3481
596 nmdc:mga08x19_103330_c1 3300050514 Bacteria 1893
597 nmdc:mga08x19_353657_c1 3300050514 Bacteria 1026
598 nmdc:mga0a205_1111194_c1 3300050515 Bacteria 638
599 nmdc:mga0a205_550_c1 3300050515 Bacteria 24226
600 Ga0495595_0219930 3300053084 Bacteria 948
601 Ga0495619_0189657 3300053085 Unclassified 1423
602 Ga0495619_0726624 3300053085 Bacteria 674
603 Ga0495619_0747541 3300053085 Bacteria 663
604 Ga0500556_0092711 3300053104 Bacteria 1155
605 Ga0501084_0088650 3300054114 Unclassified 2597
606 Ga0501084_0115964 3300054114 Bacteria 2251
607 Ga0501082_0006031 3300060353 Bacteria 10512
608 Ga0501082_0006280 3300060353 Bacteria 10312

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300006914 Ga0075436_100099128 Ga0075436_1000991283 106
2 3300005546 Ga0070696_100820006 Ga0070696_1008200062 107
3 3300025321 Ga0207656_10680845 Ga0207656_106808451 107
4 3300026118 Ga0207675_100467393 Ga0207675_1004673932 107
5 3300050507 nmdc:mga05p37_904646_c1 nmdc:mga05p37_904646_c1_13_354 107
6 3300050514 nmdc:mga08x19_103330_c1 nmdc:mga08x19_103330_c1_489_848 107
7 3300025908 Ga0207643_10008797 Ga0207643_100087972 108
8 3300035410 Ga0373924_0093602 Ga0373924_0093602_948_1277 108
9 3300005293 Ga0065715_10005279 Ga0065715_100052795 109
10 3300005328 Ga0070676_10007930 Ga0070676_100079302 109
11 3300005330 Ga0070690_100437243 Ga0070690_1004372432 109
12 3300005333 Ga0070677_10006623 Ga0070677_100066234 109
13 3300005334 Ga0068869_100011562 Ga0068869_1000115623 109
14 3300005335 Ga0070666_10047517 Ga0070666_100475172 109
15 3300005338 Ga0068868_100011370 Ga0068868_1000113704 109
16 3300005338 Ga0068868_100949065 Ga0068868_1009490652 109
17 3300005340 Ga0070689_100032116 Ga0070689_1000321163 109
18 3300005343 Ga0070687_100028647 Ga0070687_1000286472 109
19 3300005344 Ga0070661_100015020 Ga0070661_1000150202 109
20 3300005345 Ga0070692_10948167 Ga0070692_109481671 109
21 3300005347 Ga0070668_100115892 Ga0070668_1001158923 109
22 3300005353 Ga0070669_100048332 Ga0070669_1000483323 109
23 3300005354 Ga0070675_100093550 Ga0070675_1000935502 109
24 3300005354 Ga0070675_100206743 Ga0070675_1002067432 109
25 3300005355 Ga0070671_100064247 Ga0070671_1000642472 109
26 3300005364 Ga0070673_100005159 Ga0070673_1000051593 109
27 3300005364 Ga0070673_100086244 Ga0070673_1000862442 109
28 3300005365 Ga0070688_100200625 Ga0070688_1002006252 109
29 3300005366 Ga0070659_100231941 Ga0070659_1002319412 109
30 3300005367 Ga0070667_100061901 Ga0070667_1000619012 109
31 3300005434 Ga0070709_11583042 Ga0070709_115830421 109
32 3300005438 Ga0070701_10029960 Ga0070701_100299603 109
33 3300005438 Ga0070701_10040810 Ga0070701_100408102 109
34 3300005440 Ga0070705_101284893 Ga0070705_1012848931 109
35 3300005441 Ga0070700_100151730 Ga0070700_1001517302 109
36 3300005441 Ga0070700_100743122 Ga0070700_1007431221 109
37 3300005456 Ga0070678_100138427 Ga0070678_1001384273 109
38 3300005457 Ga0070662_100025107 Ga0070662_1000251073 109
39 3300005459 Ga0068867_100008076 Ga0068867_1000080766 109
40 3300005466 Ga0070685_10003913 Ga0070685_100039132 109
41 3300005535 Ga0070684_100091701 Ga0070684_1000917011 109
42 3300005543 Ga0070672_100021412 Ga0070672_1000214124 109
43 3300005544 Ga0070686_100017352 Ga0070686_1000173523 109
44 3300005544 Ga0070686_100428480 Ga0070686_1004284802 109
45 3300005547 Ga0070693_100125721 Ga0070693_1001257212 109
46 3300005548 Ga0070665_100977917 Ga0070665_1009779172 109
47 3300005564 Ga0070664_100001464 Ga0070664_1000014647 109
48 3300005617 Ga0068859_100052270 Ga0068859_1000522702 109
49 3300005719 Ga0068861_100020900 Ga0068861_1000209003 109
50 3300005840 Ga0068870_10001750 Ga0068870_100017507 109
51 3300005841 Ga0068863_100007501 Ga0068863_1000075017 109
52 3300005842 Ga0068858_100018658 Ga0068858_1000186585 109
53 3300005843 Ga0068860_100066596 Ga0068860_1000665963 109
54 3300005844 Ga0068862_100001318 Ga0068862_10000131811 109
55 3300006237 Ga0097621_100341500 Ga0097621_1003415002 109
56 3300006358 Ga0068871_100355994 Ga0068871_1003559942 109
57 3300006852 Ga0075433_10004312 Ga0075433_1000431210 109
58 3300006871 Ga0075434_100178070 Ga0075434_1001780702 109
59 3300006880 Ga0075429_100039891 Ga0075429_1000398912 109
60 3300006881 Ga0068865_100012200 Ga0068865_1000122007 109
61 3300006931 Ga0097620_100052272 Ga0097620_1000522723 109
62 3300007076 Ga0075435_100064288 Ga0075435_1000642883 109
63 3300009098 Ga0105245_10933074 Ga0105245_109330742 109
64 3300009147 Ga0114129_10045388 Ga0114129_100453885 109
65 3300009176 Ga0105242_10472350 Ga0105242_104723502 109
66 3300009177 Ga0105248_10009093 Ga0105248_100090932 109
67 3300009553 Ga0105249_10037351 Ga0105249_100373513 109
68 3300011119 Ga0105246_10015668 Ga0105246_100156683 109
69 3300012492 Ga0157335_1041960 Ga0157335_10419602 109
70 3300012507 Ga0157342_1009623 Ga0157342_10096232 109
71 3300013296 Ga0157374_10176424 Ga0157374_101764242 109
72 3300013306 Ga0163162_10057935 Ga0163162_100579353 109
73 3300014326 Ga0157380_10028283 Ga0157380_100282832 109
74 3300014968 Ga0157379_10003010 Ga0157379_100030102 109
75 3300017792 Ga0163161_10074396 Ga0163161_100743962 109
76 3300025315 Ga0207697_10000443 Ga0207697_100004437 109
77 3300025901 Ga0207688_10000727 Ga0207688_100007273 109
78 3300025903 Ga0207680_11291203 Ga0207680_112912031 109
79 3300025907 Ga0207645_10003192 Ga0207645_100031927 109
80 3300025918 Ga0207662_10023035 Ga0207662_100230353 109
81 3300025923 Ga0207681_10027408 Ga0207681_100274082 109
82 3300025926 Ga0207659_10424042 Ga0207659_104240422 109
83 3300025931 Ga0207644_10342078 Ga0207644_103420782 109
84 3300025932 Ga0207690_10197556 Ga0207690_101975562 109
85 3300025933 Ga0207706_10011832 Ga0207706_100118327 109
86 3300025936 Ga0207670_11594334 Ga0207670_115943341 109
87 3300025938 Ga0207704_10216308 Ga0207704_102163082 109
88 3300025940 Ga0207691_10006460 Ga0207691_100064602 109
89 3300025942 Ga0207689_10001107 Ga0207689_1000110714 109
90 3300025945 Ga0207679_10006202 Ga0207679_100062026 109
91 3300025960 Ga0207651_10020469 Ga0207651_100204692 109
92 3300025961 Ga0207712_10006641 Ga0207712_100066414 109
93 3300026023 Ga0207677_10153864 Ga0207677_101538642 109
94 3300026035 Ga0207703_10338028 Ga0207703_103380281 109
95 3300026075 Ga0207708_10168239 Ga0207708_101682392 109
96 3300026075 Ga0207708_11275325 Ga0207708_112753252 109
97 3300026088 Ga0207641_10016310 Ga0207641_100163106 109
98 3300026089 Ga0207648_10064133 Ga0207648_100641334 109
99 3300026118 Ga0207675_100034374 Ga0207675_1000343743 109
100 3300026121 Ga0207683_10009105 Ga0207683_100091053 109
101 3300026142 Ga0207698_10738751 Ga0207698_107387511 109
102 3300027907 Ga0207428_10003783 Ga0207428_1000378312 109
103 3300028379 Ga0268266_10101448 Ga0268266_101014482 109
104 3300028380 Ga0268265_10019094 Ga0268265_100190942 109
105 3300028380 Ga0268265_10338021 Ga0268265_103380211 109
106 3300028381 Ga0268264_10189409 Ga0268264_101894093 109
107 3300034818 Ga0373950_0155932 Ga0373950_0155932_81_464 109
108 3300034819 Ga0373958_0023660 Ga0373958_0023660_494_877 109
109 3300034820 Ga0373959_0146183 Ga0373959_0146183_186_569 109
110 3300034957 Ga0373938_0092025 Ga0373938_0092025_79_462 109
111 3300035088 Ga0373940_0003235 Ga0373940_0003235_1257_1640 109
112 3300035090 Ga0373949_0074752 Ga0373949_0074752_99_482 109
113 3300035112 Ga0373932_0032293 Ga0373932_0032293_17_400 109
114 3300035115 Ga0373941_0164219 Ga0373941_0164219_157_540 109
115 3300035121 Ga0373960_0103345 Ga0373960_0103345_488_871 109
116 3300035691 Ga0373931_0085910 Ga0373931_0085910_131_514 109
117 3300045051 Ga0451576_0449587 Ga0451576_0449587_958_1341 109
118 3300048910 Ga0496107_1174976 Ga0496107_1174976_120_503 109
119 3300048912 Ga0496109_0276928 Ga0496109_0276928_1090_1473 109
120 3300048913 Ga0496110_0331090 Ga0496110_0331090_480_863 109
121 3300048915 Ga0496112_1214483 Ga0496112_1214483_40_369 109
122 3300050512 nmdc:mga0n895_284417_c1 nmdc:mga0n895_284417_c1_780_1163 109
123 3300050513 nmdc:mga0rr50_37959_c1 nmdc:mga0rr50_37959_c1_681_1064 109
124 3300050515 nmdc:mga0a205_550_c1 nmdc:mga0a205_550_c1_10646_11029 109
125 3300006914 Ga0075436_100347607 Ga0075436_1003476072 110
126 3300009098 Ga0105245_10003759 Ga0105245_100037596 110
127 3300013297 Ga0157378_10052391 Ga0157378_100523915 110
128 3300025961 Ga0207712_12033836 Ga0207712_120338361 110
129 3300026088 Ga0207641_11525154 Ga0207641_115251542 110
130 3300026142 Ga0207698_10425934 Ga0207698_104259342 110
131 3300048907 Ga0496104_0019202 Ga0496104_0019202_1450_1785 110
132 3300005354 Ga0070675_100000717 Ga0070675_1000007174 111
133 3300005364 Ga0070673_100998898 Ga0070673_1009988981 111
134 3300005518 Ga0070699_100643054 Ga0070699_1006430542 111
135 3300005535 Ga0070684_100093990 Ga0070684_1000939901 111
136 3300005546 Ga0070696_100530970 Ga0070696_1005309701 111
137 3300005841 Ga0068863_102702468 Ga0068863_1027024682 111
138 3300006028 Ga0070717_10383726 Ga0070717_103837262 111
139 3300006871 Ga0075434_100465626 Ga0075434_1004656261 111
140 3300006914 Ga0075436_100269247 Ga0075436_1002692472 111
141 3300013296 Ga0157374_12477871 Ga0157374_124778712 111
142 3300025926 Ga0207659_10058809 Ga0207659_100588092 111
143 3300025932 Ga0207690_11478036 Ga0207690_114780362 111
144 3300025944 Ga0207661_10051241 Ga0207661_100512411 111
145 3300026088 Ga0207641_12609879 Ga0207641_126098792 111
146 3300041460 Ga0451802_1224248 Ga0451802_1224248_161_511 111
147 3300046537 Ga0495598_0056423 Ga0495598_0056423_171_518 111
148 3300048905 Ga0496102_0610347 Ga0496102_0610347_375_752 111
149 3300050512 nmdc:mga0n895_102938_c1 nmdc:mga0n895_102938_c1_718_1095 111
150 3300050512 nmdc:mga0n895_2007808_c1 nmdc:mga0n895_2007808_c1_67_432 111
151 3300050514 nmdc:mga08x19_353657_c1 nmdc:mga08x19_353657_c1_414_791 111
152 3300005338 Ga0068868_100535489 Ga0068868_1005354892 112
153 3300005356 Ga0070674_101172883 Ga0070674_1011728831 112
154 3300005439 Ga0070711_100802620 Ga0070711_1008026202 112
155 3300005445 Ga0070708_100098075 Ga0070708_1000980752 112
156 3300005536 Ga0070697_100783671 Ga0070697_1007836712 112
157 3300005546 Ga0070696_100117208 Ga0070696_1001172082 112
158 3300005843 Ga0068860_101511362 Ga0068860_1015113621 112
159 3300006852 Ga0075433_11310606 Ga0075433_113106061 112
160 3300006871 Ga0075434_101567381 Ga0075434_1015673812 112
161 3300009177 Ga0105248_11159140 Ga0105248_111591401 112
162 3300013104 Ga0157370_10472529 Ga0157370_104725295 112
163 3300013296 Ga0157374_10556489 Ga0157374_105564892 112
164 3300025916 Ga0207663_10924761 Ga0207663_109247611 112
165 3300025939 Ga0207665_10438569 Ga0207665_104385692 112
166 3300025961 Ga0207712_11580281 Ga0207712_115802811 112
167 3300026118 Ga0207675_101261671 Ga0207675_1012616712 112
168 3300028381 Ga0268264_10952217 Ga0268264_109522172 112
169 3300048907 Ga0496104_1216256 Ga0496104_1216256_138_485 112
170 3300049742 Ga0501080_1006001 Ga0501080_1006001_90_446 112
171 3300050507 nmdc:mga05p37_1154256_c1 nmdc:mga05p37_1154256_c1_333_680 112
172 3300060353 Ga0501082_0006031 Ga0501082_0006031_9361_9705 112
173 3300005327 Ga0070658_10941364 Ga0070658_109413642 113
174 3300005330 Ga0070690_100134820 Ga0070690_1001348203 113
175 3300005331 Ga0070670_100688426 Ga0070670_1006884262 113
176 3300005335 Ga0070666_10853510 Ga0070666_108535101 113
177 3300005344 Ga0070661_100903923 Ga0070661_1009039231 113
178 3300005354 Ga0070675_100205843 Ga0070675_1002058432 113
179 3300005354 Ga0070675_100949873 Ga0070675_1009498731 113
180 3300005355 Ga0070671_100344160 Ga0070671_1003441602 113
181 3300005355 Ga0070671_101063390 Ga0070671_1010633902 113
182 3300005364 Ga0070673_100209173 Ga0070673_1002091732 113
183 3300005364 Ga0070673_100233272 Ga0070673_1002332722 113
184 3300005364 Ga0070673_101616756 Ga0070673_1016167562 113
185 3300005366 Ga0070659_100083864 Ga0070659_1000838643 113
186 3300005441 Ga0070700_100152722 Ga0070700_1001527221 113
187 3300005456 Ga0070678_100213534 Ga0070678_1002135342 113
188 3300005543 Ga0070672_100035025 Ga0070672_1000350252 113
189 3300005543 Ga0070672_100060228 Ga0070672_1000602282 113
190 3300005616 Ga0068852_101195142 Ga0068852_1011951422 113
191 3300005841 Ga0068863_101163007 Ga0068863_1011630072 113
192 3300005985 Ga0081539_10009987 Ga0081539_100099871 113
193 3300006237 Ga0097621_101036924 Ga0097621_1010369242 113
194 3300006237 Ga0097621_101400569 Ga0097621_1014005692 113
195 3300006847 Ga0075431_101988073 Ga0075431_1019880732 113
196 3300013104 Ga0157370_11106856 Ga0157370_111068562 113
197 3300013105 Ga0157369_10406837 Ga0157369_104068372 113
198 3300013296 Ga0157374_10935759 Ga0157374_109357591 113
199 3300013308 Ga0157375_10046872 Ga0157375_100468724 113
200 3300013308 Ga0157375_10091017 Ga0157375_100910172 113
201 3300014969 Ga0157376_10269634 Ga0157376_102696341 113
202 3300014969 Ga0157376_10278583 Ga0157376_102785832 113
203 3300017792 Ga0163161_10457212 Ga0163161_104572122 113
204 3300025903 Ga0207680_11053070 Ga0207680_110530701 113
205 3300025909 Ga0207705_10611205 Ga0207705_106112052 113
206 3300025923 Ga0207681_10382070 Ga0207681_103820702 113
207 3300025925 Ga0207650_10752760 Ga0207650_107527602 113
208 3300025926 Ga0207659_11654625 Ga0207659_116546251 113
209 3300025931 Ga0207644_10299739 Ga0207644_102997392 113
210 3300025931 Ga0207644_10739641 Ga0207644_107396412 113
211 3300025932 Ga0207690_10254731 Ga0207690_102547313 113
212 3300025940 Ga0207691_10007854 Ga0207691_100078543 113
213 3300025940 Ga0207691_11321354 Ga0207691_113213541 113
214 3300025960 Ga0207651_10671639 Ga0207651_106716392 113
215 3300025960 Ga0207651_10733838 Ga0207651_107338382 113
216 3300025960 Ga0207651_11859283 Ga0207651_118592831 113
217 3300025986 Ga0207658_10466023 Ga0207658_104660232 113
218 3300026121 Ga0207683_10494113 Ga0207683_104941132 113
219 3300026142 Ga0207698_10203294 Ga0207698_102032942 113
220 3300035118 Ga0373954_0277381 Ga0373954_0277381_435_785 113
221 3300035170 Ga0373943_0080560 Ga0373943_0080560_397_744 113
222 3300041486 Ga0451807_1932057 Ga0451807_1932057_95_451 113
223 3300041512 Ga0451853_3255850 Ga0451853_3255850_122_475 113
224 3300046499 Ga0495594_0081419 Ga0495594_0081419_87_446 113
225 3300048909 Ga0496106_0125030 Ga0496106_0125030_234_626 113
226 3300050511 nmdc:mga08y16_992478_c1 nmdc:mga08y16_992478_c1_173_520 113
227 3300005290 Ga0065712_10153387 Ga0065712_101533872 114
228 3300005293 Ga0065715_10432559 Ga0065715_104325592 114
229 3300005329 Ga0070683_100013920 Ga0070683_1000139208 114
230 3300005329 Ga0070683_100077653 Ga0070683_1000776535 114
231 3300005330 Ga0070690_100028336 Ga0070690_1000283365 114
232 3300005334 Ga0068869_100424523 Ga0068869_1004245232 114
233 3300005335 Ga0070666_10142396 Ga0070666_101423963 114
234 3300005339 Ga0070660_101042719 Ga0070660_1010427191 114
235 3300005344 Ga0070661_100383849 Ga0070661_1003838491 114
236 3300005345 Ga0070692_10113356 Ga0070692_101133562 114
237 3300005347 Ga0070668_100256563 Ga0070668_1002565632 114
238 3300005353 Ga0070669_100339727 Ga0070669_1003397272 114
239 3300005355 Ga0070671_100064212 Ga0070671_1000642124 114
240 3300005364 Ga0070673_100132883 Ga0070673_1001328832 114
241 3300005366 Ga0070659_100089438 Ga0070659_1000894383 114
242 3300005435 Ga0070714_100020496 Ga0070714_1000204963 114
243 3300005436 Ga0070713_100091619 Ga0070713_1000916194 114
244 3300005436 Ga0070713_100382937 Ga0070713_1003829372 114
245 3300005441 Ga0070700_101265346 Ga0070700_1012653461 114
246 3300005456 Ga0070678_100418894 Ga0070678_1004188942 114
247 3300005457 Ga0070662_100026179 Ga0070662_1000261793 114
248 3300005459 Ga0068867_100559880 Ga0068867_1005598802 114
249 3300005459 Ga0068867_100614607 Ga0068867_1006146072 114
250 3300005468 Ga0070707_101088759 Ga0070707_1010887592 114
251 3300005530 Ga0070679_100833668 Ga0070679_1008336681 114
252 3300005535 Ga0070684_100048231 Ga0070684_1000482313 114
253 3300005535 Ga0070684_100066609 Ga0070684_1000666094 114
254 3300005535 Ga0070684_100084687 Ga0070684_1000846872 114
255 3300005543 Ga0070672_101529016 Ga0070672_1015290162 114
256 3300005544 Ga0070686_100251582 Ga0070686_1002515822 114
257 3300005547 Ga0070693_100042229 Ga0070693_1000422291 114
258 3300005547 Ga0070693_101456421 Ga0070693_1014564211 114
259 3300005548 Ga0070665_100914874 Ga0070665_1009148742 114
260 3300005564 Ga0070664_100442056 Ga0070664_1004420562 114
261 3300005577 Ga0068857_100027836 Ga0068857_1000278366 114
262 3300005577 Ga0068857_100167916 Ga0068857_1001679163 114
263 3300005614 Ga0068856_100182673 Ga0068856_1001826733 114
264 3300005614 Ga0068856_100858637 Ga0068856_1008586372 114
265 3300005615 Ga0070702_101450618 Ga0070702_1014506181 114
266 3300005617 Ga0068859_100387711 Ga0068859_1003877112 114
267 3300005617 Ga0068859_100726635 Ga0068859_1007266352 114
268 3300005617 Ga0068859_100972072 Ga0068859_1009720722 114
269 3300005618 Ga0068864_100227816 Ga0068864_1002278162 114
270 3300005618 Ga0068864_100534049 Ga0068864_1005340492 114
271 3300005841 Ga0068863_100979838 Ga0068863_1009798382 114
272 3300005841 Ga0068863_101185900 Ga0068863_1011859002 114
273 3300005841 Ga0068863_102157800 Ga0068863_1021578002 114
274 3300005842 Ga0068858_100621230 Ga0068858_1006212303 114
275 3300005842 Ga0068858_101724773 Ga0068858_1017247731 114
276 3300005843 Ga0068860_100174441 Ga0068860_1001744414 114
277 3300005843 Ga0068860_100605705 Ga0068860_1006057052 114
278 3300005985 Ga0081539_10000107 Ga0081539_100001075 114
279 3300006237 Ga0097621_100080773 Ga0097621_1000807732 114
280 3300006237 Ga0097621_100272800 Ga0097621_1002728002 114
281 3300006237 Ga0097621_100527038 Ga0097621_1005270382 114
282 3300006358 Ga0068871_100036875 Ga0068871_1000368753 114
283 3300006358 Ga0068871_100076589 Ga0068871_1000765893 114
284 3300006914 Ga0075436_100398240 Ga0075436_1003982401 114
285 3300006931 Ga0097620_100387716 Ga0097620_1003877162 114
286 3300006931 Ga0097620_100726585 Ga0097620_1007265852 114
287 3300006931 Ga0097620_100972055 Ga0097620_1009720552 114
288 3300009093 Ga0105240_10260044 Ga0105240_102600443 114
289 3300009093 Ga0105240_10352799 Ga0105240_103527992 114
290 3300009094 Ga0111539_10576590 Ga0111539_105765902 114
291 3300009094 Ga0111539_12011896 Ga0111539_120118961 114
292 3300009098 Ga0105245_10051376 Ga0105245_100513761 114
293 3300009098 Ga0105245_10904286 Ga0105245_109042862 114
294 3300009101 Ga0105247_10349361 Ga0105247_103493612 114
295 3300009148 Ga0105243_10172170 Ga0105243_101721703 114
296 3300009148 Ga0105243_10453705 Ga0105243_104537052 114
297 3300009148 Ga0105243_11010973 Ga0105243_110109732 114
298 3300009174 Ga0105241_10022046 Ga0105241_100220463 114
299 3300009174 Ga0105241_10342345 Ga0105241_103423452 114
300 3300009176 Ga0105242_10277304 Ga0105242_102773042 114
301 3300009176 Ga0105242_10445251 Ga0105242_104452512 114
302 3300009176 Ga0105242_10908045 Ga0105242_109080452 114
303 3300009176 Ga0105242_11778285 Ga0105242_117782852 114
304 3300009176 Ga0105242_12890881 Ga0105242_128908812 114
305 3300009177 Ga0105248_10299332 Ga0105248_102993322 114
306 3300009177 Ga0105248_11169942 Ga0105248_111699422 114
307 3300009545 Ga0105237_10007630 Ga0105237_100076302 114
308 3300009545 Ga0105237_10117354 Ga0105237_101173543 114
309 3300009551 Ga0105238_10028601 Ga0105238_100286012 114
310 3300009551 Ga0105238_10444324 Ga0105238_104443242 114
311 3300010375 Ga0105239_10072582 Ga0105239_100725825 114
312 3300011119 Ga0105246_10082103 Ga0105246_100821032 114
313 3300011119 Ga0105246_10388114 Ga0105246_103881142 114
314 3300013296 Ga0157374_10069144 Ga0157374_100691442 114
315 3300013297 Ga0157378_11233712 Ga0157378_112337121 114
316 3300013306 Ga0163162_11078576 Ga0163162_110785762 114
317 3300013306 Ga0163162_11346214 Ga0163162_113462142 114
318 3300013307 Ga0157372_10167184 Ga0157372_101671842 114
319 3300013307 Ga0157372_12026260 Ga0157372_120262601 114
320 3300013307 Ga0157372_12640316 Ga0157372_126403161 114
321 3300013308 Ga0157375_10319657 Ga0157375_103196572 114
322 3300014325 Ga0163163_10032629 Ga0163163_100326296 114
323 3300014325 Ga0163163_10052703 Ga0163163_100527034 114
324 3300014325 Ga0163163_10293699 Ga0163163_102936991 114
325 3300014325 Ga0163163_12113362 Ga0163163_121133622 114
326 3300014745 Ga0157377_10514528 Ga0157377_105145282 114
327 3300014968 Ga0157379_10092626 Ga0157379_100926265 114
328 3300014968 Ga0157379_10203719 Ga0157379_102037193 114
329 3300014969 Ga0157376_10290139 Ga0157376_102901392 114
330 3300014969 Ga0157376_10964056 Ga0157376_109640562 114
331 3300025899 Ga0207642_10425636 Ga0207642_104256362 114
332 3300025914 Ga0207671_10111517 Ga0207671_101115173 114
333 3300025919 Ga0207657_11136118 Ga0207657_111361182 114
334 3300025920 Ga0207649_10560367 Ga0207649_105603672 114
335 3300025921 Ga0207652_11555816 Ga0207652_115558161 114
336 3300025923 Ga0207681_10153151 Ga0207681_101531512 114
337 3300025924 Ga0207694_10123683 Ga0207694_101236832 114
338 3300025924 Ga0207694_10177248 Ga0207694_101772482 114
339 3300025924 Ga0207694_10943579 Ga0207694_109435792 114
340 3300025925 Ga0207650_10266673 Ga0207650_102666733 114
341 3300025927 Ga0207687_10241897 Ga0207687_102418972 114
342 3300025928 Ga0207700_10224061 Ga0207700_102240613 114
343 3300025928 Ga0207700_10503959 Ga0207700_105039592 114
344 3300025929 Ga0207664_10015746 Ga0207664_100157463 114
345 3300025931 Ga0207644_10028408 Ga0207644_100284082 114
346 3300025932 Ga0207690_10033662 Ga0207690_100336624 114
347 3300025933 Ga0207706_10009564 Ga0207706_100095648 114
348 3300025934 Ga0207686_10076996 Ga0207686_100769962 114
349 3300025934 Ga0207686_10514703 Ga0207686_105147032 114
350 3300025934 Ga0207686_11051624 Ga0207686_110516242 114
351 3300025934 Ga0207686_11205194 Ga0207686_112051941 114
352 3300025935 Ga0207709_10560553 Ga0207709_105605532 114
353 3300025940 Ga0207691_11418518 Ga0207691_114185181 114
354 3300025941 Ga0207711_10098267 Ga0207711_100982673 114
355 3300025941 Ga0207711_10223248 Ga0207711_102232482 114
356 3300025941 Ga0207711_10298672 Ga0207711_102986722 114
357 3300025942 Ga0207689_10106792 Ga0207689_101067922 114
358 3300025944 Ga0207661_10682358 Ga0207661_106823581 114
359 3300025949 Ga0207667_10054354 Ga0207667_100543545 114
360 3300025949 Ga0207667_10305514 Ga0207667_103055143 114
361 3300025949 Ga0207667_10395103 Ga0207667_103951032 114
362 3300025960 Ga0207651_10482096 Ga0207651_104820962 114
363 3300025961 Ga0207712_10524372 Ga0207712_105243722 114
364 3300025972 Ga0207668_10919325 Ga0207668_109193251 114
365 3300025986 Ga0207658_11093658 Ga0207658_110936582 114
366 3300026023 Ga0207677_10888139 Ga0207677_108881392 114
367 3300026035 Ga0207703_10572833 Ga0207703_105728332 114
368 3300026078 Ga0207702_10201499 Ga0207702_102014992 114
369 3300026088 Ga0207641_10954468 Ga0207641_109544682 114
370 3300026088 Ga0207641_11056146 Ga0207641_110561462 114
371 3300026088 Ga0207641_11507280 Ga0207641_115072801 114
372 3300026088 Ga0207641_11773029 Ga0207641_117730292 114
373 3300026089 Ga0207648_10095443 Ga0207648_100954432 114
374 3300026095 Ga0207676_10269539 Ga0207676_102695392 114
375 3300026095 Ga0207676_10579707 Ga0207676_105797072 114
376 3300026116 Ga0207674_10002402 Ga0207674_100024022 114
377 3300026116 Ga0207674_10063731 Ga0207674_100637312 114
378 3300026121 Ga0207683_10340418 Ga0207683_103404182 114
379 3300026121 Ga0207683_10435992 Ga0207683_104359922 114
380 3300028379 Ga0268266_10617871 Ga0268266_106178711 114
381 3300028381 Ga0268264_10351629 Ga0268264_103516292 114
382 3300035086 Ga0373934_0004220 Ga0373934_0004220_701_1051 114
383 3300035086 Ga0373934_0073813 Ga0373934_0073813_353_703 114
384 3300035089 Ga0373944_0434048 Ga0373944_0434048_132_485 114
385 3300035111 Ga0373923_0089127 Ga0373923_0089127_593_943 114
386 3300035116 Ga0373945_0337312 Ga0373945_0337312_66_431 114
387 3300035116 Ga0373945_0539606 Ga0373945_0539606_78_443 114
388 3300035117 Ga0373953_0028711 Ga0373953_0028711_1392_1742 114
389 3300035118 Ga0373954_0113213 Ga0373954_0113213_932_1282 114
390 3300035118 Ga0373954_0220625 Ga0373954_0220625_139_489 114
391 3300035171 Ga0373946_0103421 Ga0373946_0103421_908_1261 114
392 3300035171 Ga0373946_0166072 Ga0373946_0166072_557_922 114
393 3300035172 Ga0373955_0043756 Ga0373955_0043756_353_703 114
394 3300035692 Ga0373935_0570471 Ga0373935_0570471_17_382 114
395 3300035695 Ga0373927_0293595 Ga0373927_0293595_300_710 114
396 3300035695 Ga0373927_0755681 Ga0373927_0755681_208_573 114
397 3300035724 Ga0373933_0016820 Ga0373933_0016820_3139_3489 114
398 3300035724 Ga0373933_0242982 Ga0373933_0242982_101_451 114
399 3300035725 Ga0373947_0750270 Ga0373947_0750270_82_447 114
400 3300036401 Ga0373937_0002833 Ga0373937_0002833_2866_3216 114
401 3300036401 Ga0373937_0050047 Ga0373937_0050047_3390_3740 114
402 3300036401 Ga0373937_1297583 Ga0373937_1297583_34_399 114
403 3300046459 Ga0495629_0175954 Ga0495629_0175954_1055_1405 114
404 3300046459 Ga0495629_0381033 Ga0495629_0381033_177_542 114
405 3300046462 Ga0495651_0072396 Ga0495651_0072396_203_553 114
406 3300046463 Ga0495653_0307112 Ga0495653_0307112_42_392 114
407 3300046472 Ga0495580_0233259 Ga0495580_0233259_41_406 114
408 3300046473 Ga0495582_0019687 Ga0495582_0019687_489_842 114
409 3300046475 Ga0495639_0072652 Ga0495639_0072652_1012_1365 114
410 3300046475 Ga0495639_0100685 Ga0495639_0100685_436_801 114
411 3300046476 Ga0495662_0612988 Ga0495662_0612988_54_419 114
412 3300046499 Ga0495594_0614980 Ga0495594_0614980_10_375 114
413 3300046511 Ga0495608_0279332 Ga0495608_0279332_28_378 114
414 3300046526 Ga0495666_0432519 Ga0495666_0432519_214_567 114
415 3300046535 Ga0495586_0022880 Ga0495586_0022880_2353_2706 114
416 3300046535 Ga0495586_0169935 Ga0495586_0169935_694_1044 114
417 3300046535 Ga0495586_0179012 Ga0495586_0179012_311_661 114
418 3300046663 Ga0495635_0395092 Ga0495635_0395092_136_501 114
419 3300046681 Ga0495647_0037515 Ga0495647_0037515_93_458 114
420 3300046683 Ga0495658_0012808 Ga0495658_0012808_1491_1844 114
421 3300046684 Ga0495669_0105525 Ga0495669_0105525_372_755 114
422 3300046689 Ga0495613_0064712 Ga0495613_0064712_675_1025 114
423 3300046809 Ga0495600_0048293 Ga0495600_0048293_1041_1391 114
424 3300047315 Ga0495581_0104371 Ga0495581_0104371_1159_1512 114
425 3300047444 Ga0495675_0234666 Ga0495675_0234666_190_540 114
426 3300047471 Ga0495684_0016340 Ga0495684_0016340_1619_1969 114
427 3300048903 Ga0496100_0098574 Ga0496100_0098574_1019_1384 114
428 3300048904 Ga0496101_0861616 Ga0496101_0861616_176_538 114
429 3300048907 Ga0496104_0737410 Ga0496104_0737410_404_769 114
430 3300048908 Ga0496105_0100132 Ga0496105_0100132_1776_2141 114
431 3300048915 Ga0496112_0831531 Ga0496112_0831531_407_784 114
432 3300048917 Ga0496114_0032058 Ga0496114_0032058_3902_4267 114
433 3300050511 nmdc:mga08y16_1147862_c1 nmdc:mga08y16_1147862_c1_217_597 114
434 3300053084 Ga0495595_0219930 Ga0495595_0219930_191_556 114
435 3300053085 Ga0495619_0726624 Ga0495619_0726624_113_478 114
436 3300053085 Ga0495619_0747541 Ga0495619_0747541_289_639 114
437 3300005329 Ga0070683_100028255 Ga0070683_1000282556 115
438 3300005331 Ga0070670_100033660 Ga0070670_1000336604 115
439 3300005344 Ga0070661_100508413 Ga0070661_1005084131 115
440 3300005353 Ga0070669_101865957 Ga0070669_1018659571 115
441 3300005356 Ga0070674_100100329 Ga0070674_1001003294 115
442 3300005455 Ga0070663_100930727 Ga0070663_1009307271 115
443 3300005536 Ga0070697_101389876 Ga0070697_1013898762 115
444 3300005539 Ga0068853_100094588 Ga0068853_1000945882 115
445 3300005564 Ga0070664_101329569 Ga0070664_1013295692 115
446 3300005564 Ga0070664_101669021 Ga0070664_1016690212 115
447 3300005578 Ga0068854_100731167 Ga0068854_1007311672 115
448 3300005614 Ga0068856_100012612 Ga0068856_1000126124 115
449 3300005618 Ga0068864_100070523 Ga0068864_1000705234 115
450 3300005842 Ga0068858_100137898 Ga0068858_1001378983 115
451 3300006844 Ga0075428_100078641 Ga0075428_1000786412 115
452 3300006846 Ga0075430_100005932 Ga0075430_1000059321 115
453 3300006880 Ga0075429_100004117 Ga0075429_1000041178 115
454 3300009098 Ga0105245_10030565 Ga0105245_100305652 115
455 3300009098 Ga0105245_10195875 Ga0105245_101958753 115
456 3300009177 Ga0105248_10009327 Ga0105248_1000932710 115
457 3300009177 Ga0105248_11917817 Ga0105248_119178172 115
458 3300009545 Ga0105237_10008101 Ga0105237_100081015 115
459 3300009551 Ga0105238_10019149 Ga0105238_100191494 115
460 3300009553 Ga0105249_10131545 Ga0105249_101315453 115
461 3300010375 Ga0105239_10035610 Ga0105239_100356104 115
462 3300011119 Ga0105246_10013213 Ga0105246_100132136 115
463 3300013105 Ga0157369_10046007 Ga0157369_100460073 115
464 3300013296 Ga0157374_10020255 Ga0157374_100202557 115
465 3300013306 Ga0163162_11822797 Ga0163162_118227972 115
466 3300013307 Ga0157372_10109296 Ga0157372_101092965 115
467 3300013308 Ga0157375_10010496 Ga0157375_100104967 115
468 3300014325 Ga0163163_10189969 Ga0163163_101899694 115
469 3300014326 Ga0157380_13422617 Ga0157380_134226172 115
470 3300014969 Ga0157376_10565591 Ga0157376_105655912 115
471 3300021388 Ga0213875_10002951 Ga0213875_100029517 115
472 3300025893 Ga0207682_10000492 Ga0207682_1000049214 115
473 3300025910 Ga0207684_10580586 Ga0207684_105805862 115
474 3300025914 Ga0207671_10047654 Ga0207671_100476545 115
475 3300025920 Ga0207649_10276575 Ga0207649_102765752 115
476 3300025923 Ga0207681_10636690 Ga0207681_106366902 115
477 3300025924 Ga0207694_10021351 Ga0207694_100213513 115
478 3300025925 Ga0207650_10043864 Ga0207650_100438644 115
479 3300025927 Ga0207687_10018973 Ga0207687_100189736 115
480 3300025927 Ga0207687_10118089 Ga0207687_101180892 115
481 3300025927 Ga0207687_11479753 Ga0207687_114797532 115
482 3300025931 Ga0207644_10954039 Ga0207644_109540392 115
483 3300025941 Ga0207711_10055719 Ga0207711_100557193 115
484 3300025944 Ga0207661_10076551 Ga0207661_100765513 115
485 3300025945 Ga0207679_11081061 Ga0207679_110810611 115
486 3300025961 Ga0207712_10171159 Ga0207712_101711592 115
487 3300026035 Ga0207703_10103737 Ga0207703_101037373 115
488 3300026041 Ga0207639_10507008 Ga0207639_105070082 115
489 3300026067 Ga0207678_11167207 Ga0207678_111672072 115
490 3300026078 Ga0207702_10068041 Ga0207702_100680412 115
491 3300026095 Ga0207676_10056606 Ga0207676_100566064 115
492 3300026142 Ga0207698_11102149 Ga0207698_111021491 115
493 3300032002 Ga0307416_102371216 Ga0307416_1023712162 115
494 3300035725 Ga0373947_0406951 Ga0373947_0406951_10_369 115
495 3300037068 Ga0373925_0017602 Ga0373925_0017602_2014_2373 115
496 3300037068 Ga0373925_0156497 Ga0373925_0156497_1023_1379 115
497 3300037853 Ga0436364_1013559 Ga0436364_1013559_3609_3962 115
498 3300042008 Ga0439450_069731 Ga0439450_069731_189_572 115
499 3300046472 Ga0495580_0012630 Ga0495580_0012630_549_908 115
500 3300046472 Ga0495580_0063694 Ga0495580_0063694_1571_1927 115
501 3300048912 Ga0496109_0092907 Ga0496109_0092907_1048_1398 115
502 3300048915 Ga0496112_0119803 Ga0496112_0119803_195_545 115
503 3300048915 Ga0496112_0879191 Ga0496112_0879191_367_735 115
504 3300048916 Ga0496113_0593829 Ga0496113_0593829_375_725 115
505 3300049570 Ga0501033_0111762 Ga0501033_0111762_831_1187 115
506 3300049572 Ga0501036_0024755 Ga0501036_0024755_4471_4827 115
507 3300049573 Ga0501037_0077754 Ga0501037_0077754_413_769 115
508 3300049574 Ga0501038_0086320 Ga0501038_0086320_930_1286 115
509 3300049575 Ga0501039_0077687 Ga0501039_0077687_1984_2340 115
510 3300049576 Ga0501040_0017471 Ga0501040_0017471_778_1134 115
511 3300049582 Ga0501048_0127837 Ga0501048_0127837_955_1311 115
512 3300049587 Ga0501071_0295956 Ga0501071_0295956_110_466 115
513 3300049588 Ga0501072_0103922 Ga0501072_0103922_1072_1428 115
514 3300049591 Ga0501075_0026388 Ga0501075_0026388_1477_1833 115
515 3300049592 Ga0501076_0000473 Ga0501076_0000473_7973_8329 115
516 3300049593 Ga0501077_0150936 Ga0501077_0150936_914_1270 115
517 3300049741 Ga0501079_0243404 Ga0501079_0243404_36_392 115
518 3300049742 Ga0501080_0173446 Ga0501080_0173446_1441_1797 115
519 3300049742 Ga0501080_1825828 Ga0501080_1825828_19_396 115
520 3300049743 Ga0501081_0045419 Ga0501081_0045419_1591_1947 115
521 3300049744 Ga0501083_0200374 Ga0501083_0200374_162_518 115
522 3300049824 Ga0501045_0028924 Ga0501045_0028924_1937_2293 115
523 3300050507 nmdc:mga05p37_188453_c1 nmdc:mga05p37_188453_c1_1129_1512 115
524 3300050508 nmdc:mga09592_962_c1 nmdc:mga09592_962_c1_22089_22472 115
525 3300050509 nmdc:mga0qj67_488_c1 nmdc:mga0qj67_488_c1_7202_7585 115
526 3300050511 nmdc:mga08y16_842413_c1 nmdc:mga08y16_842413_c1_413_781 115
527 3300053104 Ga0500556_0092711 Ga0500556_0092711_127_489 115
528 3300054114 Ga0501084_0115964 Ga0501084_0115964_1781_2137 115
529 3300060353 Ga0501082_0006280 Ga0501082_0006280_8913_9269 115
530 3300005290 Ga0065712_10100903 Ga0065712_101009035 116
531 3300005331 Ga0070670_100047539 Ga0070670_1000475393 116
532 3300005355 Ga0070671_101398626 Ga0070671_1013986261 116
533 3300005365 Ga0070688_100966812 Ga0070688_1009668122 116
534 3300005445 Ga0070708_101325806 Ga0070708_1013258061 116
535 3300005544 Ga0070686_100653260 Ga0070686_1006532602 116
536 3300005844 Ga0068862_101323164 Ga0068862_1013231641 116
537 3300006844 Ga0075428_101429223 Ga0075428_1014292231 116
538 3300006846 Ga0075430_100007866 Ga0075430_1000078662 116
539 3300006846 Ga0075430_100010875 Ga0075430_10001087510 116
540 3300006847 Ga0075431_100007383 Ga0075431_1000073834 116
541 3300006847 Ga0075431_100007549 Ga0075431_1000075493 116
542 3300006852 Ga0075433_11223674 Ga0075433_112236741 116
543 3300006871 Ga0075434_100404685 Ga0075434_1004046852 116
544 3300006880 Ga0075429_100115968 Ga0075429_1001159681 116
545 3300006880 Ga0075429_100673112 Ga0075429_1006731122 116
546 3300006880 Ga0075429_100810923 Ga0075429_1008109232 116
547 3300006880 Ga0075429_100849905 Ga0075429_1008499052 116
548 3300009147 Ga0114129_10003784 Ga0114129_1000378416 116
549 3300009147 Ga0114129_10004070 Ga0114129_100040702 116
550 3300009147 Ga0114129_10169582 Ga0114129_101695824 116
551 3300009147 Ga0114129_10608086 Ga0114129_106080862 116
552 3300009553 Ga0105249_10078472 Ga0105249_100784723 116
553 3300025917 Ga0207660_10498190 Ga0207660_104981902 116
554 3300025935 Ga0207709_10968970 Ga0207709_109689701 116
555 3300025938 Ga0207704_11222186 Ga0207704_112221862 116
556 3300025961 Ga0207712_10325773 Ga0207712_103257732 116
557 3300026075 Ga0207708_11995871 Ga0207708_119958711 116
558 3300026118 Ga0207675_100208446 Ga0207675_1002084462 116
559 3300028380 Ga0268265_11307325 Ga0268265_113073252 116
560 3300031711 Ga0265314_10212004 Ga0265314_102120042 116
561 3300031731 Ga0307405_11401870 Ga0307405_114018701 116
562 3300032126 Ga0307415_100390918 Ga0307415_1003909182 116
563 3300035695 Ga0373927_0128678 Ga0373927_0128678_226_594 116
564 3300035724 Ga0373933_0879503 Ga0373933_0879503_123_491 116
565 3300036401 Ga0373937_0052873 Ga0373937_0052873_68_436 116
566 3300041486 Ga0451807_2712053 Ga0451807_2712053_10_363 116
567 3300046454 Ga0495592_0053013 Ga0495592_0053013_1712_2080 116
568 3300046529 Ga0495652_0366693 Ga0495652_0366693_129_497 116
569 3300046535 Ga0495586_0347828 Ga0495586_0347828_388_768 116
570 3300046536 Ga0495587_0001781 Ga0495587_0001781_6802_7170 116
571 3300046543 Ga0495645_0098410 Ga0495645_0098410_450_818 116
572 3300046642 Ga0495634_0176715 Ga0495634_0176715_172_552 116
573 3300046683 Ga0495658_0441712 Ga0495658_0441712_36_386 116
574 3300046689 Ga0495613_0242398 Ga0495613_0242398_341_691 116
575 3300048907 Ga0496104_0848973 Ga0496104_0848973_64_432 116
576 3300048912 Ga0496109_1870359 Ga0496109_1870359_24_374 116
577 3300048913 Ga0496110_1233961 Ga0496110_1233961_91_459 116
578 3300048914 Ga0496111_0960843 Ga0496111_0960843_43_396 116
579 3300049572 Ga0501036_1355123 Ga0501036_1355123_145_513 116
580 3300049575 Ga0501039_0218043 Ga0501039_0218043_788_1156 116
581 3300049577 Ga0501041_0038116 Ga0501041_0038116_901_1269 116
582 3300049578 Ga0501042_0131831 Ga0501042_0131831_1097_1465 116
583 3300049580 Ga0501046_0073723 Ga0501046_0073723_1185_1553 116
584 3300049584 Ga0501068_0385253 Ga0501068_0385253_47_415 116
585 3300049587 Ga0501071_0009788 Ga0501071_0009788_2075_2443 116
586 3300049587 Ga0501071_0856440 Ga0501071_0856440_230_586 116
587 3300049588 Ga0501072_0083258 Ga0501072_0083258_639_1007 116
588 3300049591 Ga0501075_1189946 Ga0501075_1189946_102_470 116
589 3300049592 Ga0501076_0114613 Ga0501076_0114613_720_1088 116
590 3300049741 Ga0501079_1555058 Ga0501079_1555058_32_388 116
591 3300049824 Ga0501045_0945660 Ga0501045_0945660_210_593 116
592 3300050507 nmdc:mga05p37_1198508_c1 nmdc:mga05p37_1198508_c1_259_618 116
593 3300050507 nmdc:mga05p37_1622571_c1 nmdc:mga05p37_1622571_c1_193_555 116
594 3300050507 nmdc:mga05p37_177038_c1 nmdc:mga05p37_177038_c1_2086_2469 116
595 3300050507 nmdc:mga05p37_25424_c1 nmdc:mga05p37_25424_c1_2856_3221 116
596 3300050508 nmdc:mga09592_685558_c1 nmdc:mga09592_685558_c1_291_656 116
597 3300050508 nmdc:mga09592_841214_c1 nmdc:mga09592_841214_c1_270_629 116
598 3300050508 nmdc:mga09592_85652_c1 nmdc:mga09592_85652_c1_1758_2123 116
599 3300050509 nmdc:mga0qj67_25428_c1 nmdc:mga0qj67_25428_c1_2905_3270 116
600 3300050509 nmdc:mga0qj67_339222_c1 nmdc:mga0qj67_339222_c1_652_1017 116
601 3300050509 nmdc:mga0qj67_659271_c1 nmdc:mga0qj67_659271_c1_365_730 116
602 3300050510 nmdc:mga06r32_202080_c1 nmdc:mga06r32_202080_c1_350_715 116
603 3300050510 nmdc:mga06r32_222071_c1 nmdc:mga06r32_222071_c1_802_1167 116
604 3300050510 nmdc:mga06r32_436632_c1 nmdc:mga06r32_436632_c1_97_462 116
605 3300050510 nmdc:mga06r32_569319_c1 nmdc:mga06r32_569319_c1_425_784 116
606 3300050515 nmdc:mga0a205_1111194_c1 nmdc:mga0a205_1111194_c1_118_501 116
607 3300053085 Ga0495619_0189657 Ga0495619_0189657_343_693 116
608 3300054114 Ga0501084_0088650 Ga0501084_0088650_673_1041 116

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12840

HTH_20

Helix-turn-helix domain

13

63

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
4lb5-assembly1.cif.gz_A-2 crystal structure of pkz zalpha in complex with ds(cg)6 (hexagonal form) 0.9177 17 71
5zuo-assembly1.cif.gz_A crystal structure of bz junction in diverse sequence 0.9177 28 71
2mh2-assembly1.cif.gz_A structural insights into the dna recognition and protein interaction domains reveal fundamental homologous dna pairing properties of hop2 0.903 18 71
2k4b-assembly1.cif.gz_A copr repressor structure 0.8933 18 71
7ne9-assembly1.cif.gz_DDD a single sensor controls large variations in zinc quotas in a marine cyanobacterium 0.8902 12 70
ID Description Score Start End Superfamily
1saxB01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9303 17 71 1.10.10.10
1sd6A01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9281 12 71 1.10.10.10
af_Q58793_245_317_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.924 7 70 1.10.10.10
5zuoA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9177 28 71 1.10.10.10
4lb5A00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9177 17 71 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A7C3DR54-F1-model_v4 ArsR family transcriptional regulator 0.9815 5 75 GO:0003700
AF-A0A812QMK9-F1-model_v4 deleted 0.9763 5 104
AF-A0A532DH07-F1-model_v4 Helix-turn-helix transcriptional regulator 0.959 5 78 GO:0003700
AF-M6KC98-F1-model_v4 DNA-binding helix-turn-helix protein 0.956 5 71 GO:0003677
GO:0003700
AF-A0A2Z3HKI1-F1-model_v4 ArsR family transcriptional regulator 0.9544 4 71 GO:0003700

Feature Viewer

pLDDT pTM Quality
87.33 0.79 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map