F468794
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 608 | 276 | 608 | 119 |
Family's Representative Sequence
| Representative Sequence | 3300025934|Ga0207686_11051624|Ga0207686_110516242 |
| Length | 127 |
| Sequence | MSMALEGALLSALASPRRQEILRLTWREERTAGAIHQAMPDVTFGAVSLQLKALLEAGLIEARVEKSDRRNRYYKARPEALGEMGKMLERMWDDALWKLKVAAELEETRRGPRPSRKTSRRTKGKKK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 2 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 3 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 7 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 10 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 12 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 14 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 17 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 24 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 38 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 42 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 45 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 52 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 53 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 54 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 56 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 57 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 58 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 59 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 60 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 61 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 62 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 63 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 64 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 65 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 68 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 69 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 70 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 71 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 72 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 73 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 74 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 75 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 76 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 78 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300012492 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.yng.030610 | Metagenome | Rhizosphere |
| 93 | 3300012507 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 | Metagenome | Rhizosphere |
| 94 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 108 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 164 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 168 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 169 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 170 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 171 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 172 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 173 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 174 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 175 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 176 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 177 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 178 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 179 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 180 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 181 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 182 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 183 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 184 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 185 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 186 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 187 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 188 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 189 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 190 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 191 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 192 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 193 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 194 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 195 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 196 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 197 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 198 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 199 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 200 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 201 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 202 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 203 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 230 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 231 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 232 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 233 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 234 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 235 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 236 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 237 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 238 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 239 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 240 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 241 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 242 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 243 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 244 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 245 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 246 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 247 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 248 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 249 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 250 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 251 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 252 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 253 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 254 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 255 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 256 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 257 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 258 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 259 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 260 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 261 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 262 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 263 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 264 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 265 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 266 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 267 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 268 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 269 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 270 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 271 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 272 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 275 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 276 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.16 |
| Nodule | 0 |
| Rhizoplane | 4.11 |
| Rhizosphere | 95.23 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.49 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0065712_10100903 | 3300005290 | Bacteria | 2049 |
| 2 | Ga0065712_10153387 | 3300005290 | Bacteria | 1352 |
| 3 | Ga0065715_10005279 | 3300005293 | Bacteria | 5406 |
| 4 | Ga0065715_10432559 | 3300005293 | Bacteria | 845 |
| 5 | Ga0070658_10941364 | 3300005327 | Unclassified | 751 |
| 6 | Ga0070676_10007930 | 3300005328 | Bacteria | 5708 |
| 7 | Ga0070683_100013920 | 3300005329 | Bacteria | 7027 |
| 8 | Ga0070683_100028255 | 3300005329 | Bacteria | 5068 |
| 9 | Ga0070683_100077653 | 3300005329 | Bacteria | 3105 |
| 10 | Ga0070690_100028336 | 3300005330 | Bacteria | 3468 |
| 11 | Ga0070690_100134820 | 3300005330 | Unclassified | 1671 |
| 12 | Ga0070690_100437243 | 3300005330 | Bacteria | 967 |
| 13 | Ga0070670_100033660 | 3300005331 | Bacteria | 4414 |
| 14 | Ga0070670_100047539 | 3300005331 | Bacteria | 3693 |
| 15 | Ga0070670_100688426 | 3300005331 | Bacteria | 919 |
| 16 | Ga0070677_10006623 | 3300005333 | Bacteria | 3850 |
| 17 | Ga0068869_100011562 | 3300005334 | Bacteria | 5794 |
| 18 | Ga0068869_100424523 | 3300005334 | Bacteria | 1097 |
| 19 | Ga0070666_10047517 | 3300005335 | Bacteria | 2881 |
| 20 | Ga0070666_10142396 | 3300005335 | Bacteria | 1670 |
| 21 | Ga0070666_10853510 | 3300005335 | Bacteria | 672 |
| 22 | Ga0068868_100011370 | 3300005338 | Bacteria | 6481 |
| 23 | Ga0068868_100535489 | 3300005338 | Bacteria | 1030 |
| 24 | Ga0068868_100949065 | 3300005338 | Unclassified | 784 |
| 25 | Ga0070660_101042719 | 3300005339 | Unclassified | 691 |
| 26 | Ga0070689_100032116 | 3300005340 | Bacteria | 3992 |
| 27 | Ga0070687_100028647 | 3300005343 | Bacteria | 2704 |
| 28 | Ga0070661_100015020 | 3300005344 | Bacteria | 5464 |
| 29 | Ga0070661_100383849 | 3300005344 | Bacteria | 1108 |
| 30 | Ga0070661_100508413 | 3300005344 | Bacteria | 965 |
| 31 | Ga0070661_100903923 | 3300005344 | Bacteria | 729 |
| 32 | Ga0070692_10113356 | 3300005345 | Bacteria | 1503 |
| 33 | Ga0070692_10948167 | 3300005345 | Unclassified | 598 |
| 34 | Ga0070668_100115892 | 3300005347 | Bacteria | 2136 |
| 35 | Ga0070668_100256563 | 3300005347 | Bacteria | 1453 |
| 36 | Ga0070669_100048332 | 3300005353 | Bacteria | 3105 |
| 37 | Ga0070669_100339727 | 3300005353 | Bacteria | 1216 |
| 38 | Ga0070669_101865957 | 3300005353 | Bacteria | 525 |
| 39 | Ga0070675_100000717 | 3300005354 | Bacteria | 23058 |
| 40 | Ga0070675_100093550 | 3300005354 | Bacteria | 2521 |
| 41 | Ga0070675_100205843 | 3300005354 | Bacteria | 1709 |
| 42 | Ga0070675_100206743 | 3300005354 | Bacteria | 1705 |
| 43 | Ga0070675_100949873 | 3300005354 | Bacteria | 789 |
| 44 | Ga0070671_100064212 | 3300005355 | Bacteria | 3058 |
| 45 | Ga0070671_100064247 | 3300005355 | Bacteria | 3057 |
| 46 | Ga0070671_100344160 | 3300005355 | Bacteria | 1272 |
| 47 | Ga0070671_101063390 | 3300005355 | Bacteria | 710 |
| 48 | Ga0070671_101398626 | 3300005355 | Unclassified | 618 |
| 49 | Ga0070674_100100329 | 3300005356 | Bacteria | 2108 |
| 50 | Ga0070674_101172883 | 3300005356 | Unclassified | 681 |
| 51 | Ga0070673_100005159 | 3300005364 | Bacteria | 8336 |
| 52 | Ga0070673_100086244 | 3300005364 | Bacteria | 2558 |
| 53 | Ga0070673_100132883 | 3300005364 | Bacteria | 2091 |
| 54 | Ga0070673_100209173 | 3300005364 | Unclassified | 1684 |
| 55 | Ga0070673_100233272 | 3300005364 | Bacteria | 1597 |
| 56 | Ga0070673_100998898 | 3300005364 | Unclassified | 779 |
| 57 | Ga0070673_101616756 | 3300005364 | Bacteria | 612 |
| 58 | Ga0070688_100200625 | 3300005365 | Bacteria | 1395 |
| 59 | Ga0070688_100966812 | 3300005365 | Bacteria | 675 |
| 60 | Ga0070659_100083864 | 3300005366 | Unclassified | 2548 |
| 61 | Ga0070659_100089438 | 3300005366 | Bacteria | 2466 |
| 62 | Ga0070659_100231941 | 3300005366 | Bacteria | 1526 |
| 63 | Ga0070667_100061901 | 3300005367 | Bacteria | 3169 |
| 64 | Ga0070709_11583042 | 3300005434 | Unclassified | 533 |
| 65 | Ga0070714_100020496 | 3300005435 | Bacteria | 5399 |
| 66 | Ga0070713_100091619 | 3300005436 | Bacteria | 2616 |
| 67 | Ga0070713_100382937 | 3300005436 | Unclassified | 1311 |
| 68 | Ga0070701_10029960 | 3300005438 | Bacteria | 2688 |
| 69 | Ga0070701_10040810 | 3300005438 | Bacteria | 2361 |
| 70 | Ga0070711_100802620 | 3300005439 | Bacteria | 798 |
| 71 | Ga0070705_101284893 | 3300005440 | Bacteria | 606 |
| 72 | Ga0070700_100151730 | 3300005441 | Bacteria | 1585 |
| 73 | Ga0070700_100152722 | 3300005441 | Bacteria | 1581 |
| 74 | Ga0070700_100743122 | 3300005441 | Bacteria | 784 |
| 75 | Ga0070700_101265346 | 3300005441 | Bacteria | 619 |
| 76 | Ga0070708_100098075 | 3300005445 | Bacteria | 2680 |
| 77 | Ga0070708_101325806 | 3300005445 | Bacteria | 672 |
| 78 | Ga0070663_100930727 | 3300005455 | Unclassified | 752 |
| 79 | Ga0070678_100138427 | 3300005456 | Bacteria | 1944 |
| 80 | Ga0070678_100213534 | 3300005456 | Unclassified | 1600 |
| 81 | Ga0070678_100418894 | 3300005456 | Bacteria | 1167 |
| 82 | Ga0070662_100025107 | 3300005457 | Bacteria | 4112 |
| 83 | Ga0070662_100026179 | 3300005457 | Bacteria | 4038 |
| 84 | Ga0068867_100008076 | 3300005459 | Bacteria | 7437 |
| 85 | Ga0068867_100559880 | 3300005459 | Unclassified | 991 |
| 86 | Ga0068867_100614607 | 3300005459 | Unclassified | 949 |
| 87 | Ga0070685_10003913 | 3300005466 | Bacteria | 7527 |
| 88 | Ga0070707_101088759 | 3300005468 | Bacteria | 765 |
| 89 | Ga0070699_100643054 | 3300005518 | Unclassified | 968 |
| 90 | Ga0070679_100833668 | 3300005530 | Unclassified | 865 |
| 91 | Ga0070684_100048231 | 3300005535 | Bacteria | 3695 |
| 92 | Ga0070684_100066609 | 3300005535 | Bacteria | 3161 |
| 93 | Ga0070684_100084687 | 3300005535 | Bacteria | 2810 |
| 94 | Ga0070684_100091701 | 3300005535 | Unclassified | 2703 |
| 95 | Ga0070684_100093990 | 3300005535 | Unclassified | 2670 |
| 96 | Ga0070697_100783671 | 3300005536 | Bacteria | 843 |
| 97 | Ga0070697_101389876 | 3300005536 | Bacteria | 627 |
| 98 | Ga0068853_100094588 | 3300005539 | Unclassified | 2633 |
| 99 | Ga0070672_100021412 | 3300005543 | Bacteria | 4730 |
| 100 | Ga0070672_100035025 | 3300005543 | Unclassified | 3813 |
| 101 | Ga0070672_100060228 | 3300005543 | Bacteria | 2989 |
| 102 | Ga0070672_101529016 | 3300005543 | Bacteria | 598 |
| 103 | Ga0070686_100017352 | 3300005544 | Bacteria | 4204 |
| 104 | Ga0070686_100251582 | 3300005544 | Unclassified | 1291 |
| 105 | Ga0070686_100428480 | 3300005544 | Unclassified | 1012 |
| 106 | Ga0070686_100653260 | 3300005544 | Unclassified | 834 |
| 107 | Ga0070696_100117208 | 3300005546 | Bacteria | 1924 |
| 108 | Ga0070696_100530970 | 3300005546 | Bacteria | 940 |
| 109 | Ga0070696_100820006 | 3300005546 | Bacteria | 767 |
| 110 | Ga0070693_100042229 | 3300005547 | Bacteria | 2569 |
| 111 | Ga0070693_100125721 | 3300005547 | Bacteria | 1596 |
| 112 | Ga0070693_101456421 | 3300005547 | Unclassified | 534 |
| 113 | Ga0070665_100914874 | 3300005548 | Bacteria | 890 |
| 114 | Ga0070665_100977917 | 3300005548 | Bacteria | 859 |
| 115 | Ga0070664_100001464 | 3300005564 | Bacteria | 18810 |
| 116 | Ga0070664_100442056 | 3300005564 | Bacteria | 1193 |
| 117 | Ga0070664_101329569 | 3300005564 | Bacteria | 679 |
| 118 | Ga0070664_101669021 | 3300005564 | Bacteria | 604 |
| 119 | Ga0068857_100027836 | 3300005577 | Bacteria | 4984 |
| 120 | Ga0068857_100167916 | 3300005577 | Bacteria | 1993 |
| 121 | Ga0068854_100731167 | 3300005578 | Bacteria | 857 |
| 122 | Ga0068856_100012612 | 3300005614 | Bacteria | 8181 |
| 123 | Ga0068856_100182673 | 3300005614 | Bacteria | 2111 |
| 124 | Ga0068856_100858637 | 3300005614 | Bacteria | 927 |
| 125 | Ga0070702_101450618 | 3300005615 | Unclassified | 563 |
| 126 | Ga0068852_101195142 | 3300005616 | Bacteria | 781 |
| 127 | Ga0068859_100052270 | 3300005617 | Bacteria | 4107 |
| 128 | Ga0068859_100387711 | 3300005617 | Bacteria | 1493 |
| 129 | Ga0068859_100726635 | 3300005617 | Bacteria | 1083 |
| 130 | Ga0068859_100972072 | 3300005617 | Bacteria | 932 |
| 131 | Ga0068864_100070523 | 3300005618 | Bacteria | 3041 |
| 132 | Ga0068864_100227816 | 3300005618 | Bacteria | 1722 |
| 133 | Ga0068864_100534049 | 3300005618 | Unclassified | 1132 |
| 134 | Ga0068861_100020900 | 3300005719 | Bacteria | 4697 |
| 135 | Ga0068870_10001750 | 3300005840 | Bacteria | 8901 |
| 136 | Ga0068863_100007501 | 3300005841 | Bacteria | 10671 |
| 137 | Ga0068863_100979838 | 3300005841 | Unclassified | 848 |
| 138 | Ga0068863_101163007 | 3300005841 | Unclassified | 777 |
| 139 | Ga0068863_101185900 | 3300005841 | Bacteria | 769 |
| 140 | Ga0068863_102157800 | 3300005841 | Unclassified | 567 |
| 141 | Ga0068863_102702468 | 3300005841 | Unclassified | 505 |
| 142 | Ga0068858_100018658 | 3300005842 | Bacteria | 6494 |
| 143 | Ga0068858_100137898 | 3300005842 | Bacteria | 2289 |
| 144 | Ga0068858_100621230 | 3300005842 | Unclassified | 1049 |
| 145 | Ga0068858_101724773 | 3300005842 | Unclassified | 618 |
| 146 | Ga0068860_100066596 | 3300005843 | Bacteria | 3421 |
| 147 | Ga0068860_100174441 | 3300005843 | Bacteria | 2078 |
| 148 | Ga0068860_100605705 | 3300005843 | Unclassified | 1101 |
| 149 | Ga0068860_101511362 | 3300005843 | Bacteria | 693 |
| 150 | Ga0068862_100001318 | 3300005844 | Bacteria | 23064 |
| 151 | Ga0068862_101323164 | 3300005844 | Bacteria | 722 |
| 152 | Ga0081539_10000107 | 3300005985 | Bacteria | 195503 |
| 153 | Ga0081539_10009987 | 3300005985 | Bacteria | 7821 |
| 154 | Ga0070717_10383726 | 3300006028 | Unclassified | 1260 |
| 155 | Ga0097621_100080773 | 3300006237 | Bacteria | 2705 |
| 156 | Ga0097621_100272800 | 3300006237 | Bacteria | 1487 |
| 157 | Ga0097621_100341500 | 3300006237 | Unclassified | 1330 |
| 158 | Ga0097621_100527038 | 3300006237 | Unclassified | 1073 |
| 159 | Ga0097621_101036924 | 3300006237 | Unclassified | 768 |
| 160 | Ga0097621_101400569 | 3300006237 | Bacteria | 662 |
| 161 | Ga0068871_100036875 | 3300006358 | Bacteria | 3895 |
| 162 | Ga0068871_100076589 | 3300006358 | Bacteria | 2763 |
| 163 | Ga0068871_100355994 | 3300006358 | Unclassified | 1296 |
| 164 | Ga0075428_100078641 | 3300006844 | Bacteria | 3600 |
| 165 | Ga0075428_101429223 | 3300006844 | Unclassified | 725 |
| 166 | Ga0075430_100005932 | 3300006846 | Bacteria | 10320 |
| 167 | Ga0075430_100007866 | 3300006846 | Bacteria | 9011 |
| 168 | Ga0075430_100010875 | 3300006846 | Bacteria | 7708 |
| 169 | Ga0075431_100007383 | 3300006847 | Bacteria | 10941 |
| 170 | Ga0075431_100007549 | 3300006847 | Bacteria | 10827 |
| 171 | Ga0075431_101988073 | 3300006847 | Bacteria | 537 |
| 172 | Ga0075433_10004312 | 3300006852 | Bacteria | 11044 |
| 173 | Ga0075433_11223674 | 3300006852 | Bacteria | 651 |
| 174 | Ga0075433_11310606 | 3300006852 | Unclassified | 627 |
| 175 | Ga0075434_100178070 | 3300006871 | Bacteria | 2146 |
| 176 | Ga0075434_100404685 | 3300006871 | Bacteria | 1386 |
| 177 | Ga0075434_100465626 | 3300006871 | Bacteria | 1285 |
| 178 | Ga0075434_101567381 | 3300006871 | Bacteria | 667 |
| 179 | Ga0075429_100004117 | 3300006880 | Bacteria | 12446 |
| 180 | Ga0075429_100039891 | 3300006880 | Bacteria | 4086 |
| 181 | Ga0075429_100115968 | 3300006880 | Bacteria | 2341 |
| 182 | Ga0075429_100673112 | 3300006880 | Unclassified | 907 |
| 183 | Ga0075429_100810923 | 3300006880 | Bacteria | 820 |
| 184 | Ga0075429_100849905 | 3300006880 | Unclassified | 799 |
| 185 | Ga0068865_100012200 | 3300006881 | Bacteria | 5404 |
| 186 | Ga0075436_100099128 | 3300006914 | Bacteria | 2028 |
| 187 | Ga0075436_100269247 | 3300006914 | Bacteria | 1216 |
| 188 | Ga0075436_100347607 | 3300006914 | Bacteria | 1068 |
| 189 | Ga0075436_100398240 | 3300006914 | Unclassified | 997 |
| 190 | Ga0097620_100052272 | 3300006931 | Bacteria | 4107 |
| 191 | Ga0097620_100387716 | 3300006931 | Bacteria | 1493 |
| 192 | Ga0097620_100726585 | 3300006931 | Bacteria | 1083 |
| 193 | Ga0097620_100972055 | 3300006931 | Bacteria | 932 |
| 194 | Ga0075435_100064288 | 3300007076 | Bacteria | 2981 |
| 195 | Ga0105240_10260044 | 3300009093 | Bacteria | 2003 |
| 196 | Ga0105240_10352799 | 3300009093 | Bacteria | 1668 |
| 197 | Ga0111539_10576590 | 3300009094 | Bacteria | 1310 |
| 198 | Ga0111539_12011896 | 3300009094 | Unclassified | 670 |
| 199 | Ga0105245_10003759 | 3300009098 | Bacteria | 13512 |
| 200 | Ga0105245_10030565 | 3300009098 | Bacteria | 4763 |
| 201 | Ga0105245_10051376 | 3300009098 | Bacteria | 3696 |
| 202 | Ga0105245_10195875 | 3300009098 | Bacteria | 1938 |
| 203 | Ga0105245_10904286 | 3300009098 | Bacteria | 924 |
| 204 | Ga0105245_10933074 | 3300009098 | Bacteria | 910 |
| 205 | Ga0105247_10349361 | 3300009101 | Bacteria | 1039 |
| 206 | Ga0114129_10003784 | 3300009147 | Bacteria | 21336 |
| 207 | Ga0114129_10004070 | 3300009147 | Bacteria | 20644 |
| 208 | Ga0114129_10045388 | 3300009147 | Bacteria | 6178 |
| 209 | Ga0114129_10169582 | 3300009147 | Unclassified | 2976 |
| 210 | Ga0114129_10608086 | 3300009147 | Bacteria | 1415 |
| 211 | Ga0105243_10172170 | 3300009148 | Bacteria | 1876 |
| 212 | Ga0105243_10453705 | 3300009148 | Bacteria | 1204 |
| 213 | Ga0105243_11010973 | 3300009148 | Unclassified | 835 |
| 214 | Ga0105241_10022046 | 3300009174 | Bacteria | 4715 |
| 215 | Ga0105241_10342345 | 3300009174 | Unclassified | 1296 |
| 216 | Ga0105242_10277304 | 3300009176 | Bacteria | 1521 |
| 217 | Ga0105242_10445251 | 3300009176 | Bacteria | 1220 |
| 218 | Ga0105242_10472350 | 3300009176 | Bacteria | 1187 |
| 219 | Ga0105242_10908045 | 3300009176 | Unclassified | 881 |
| 220 | Ga0105242_11778285 | 3300009176 | Unclassified | 654 |
| 221 | Ga0105242_12890881 | 3300009176 | Bacteria | 531 |
| 222 | Ga0105248_10009093 | 3300009177 | Bacteria | 10927 |
| 223 | Ga0105248_10009327 | 3300009177 | Bacteria | 10807 |
| 224 | Ga0105248_10299332 | 3300009177 | Bacteria | 1811 |
| 225 | Ga0105248_11159140 | 3300009177 | Unclassified | 874 |
| 226 | Ga0105248_11169942 | 3300009177 | Unclassified | 869 |
| 227 | Ga0105248_11917817 | 3300009177 | Bacteria | 672 |
| 228 | Ga0105237_10007630 | 3300009545 | Bacteria | 11820 |
| 229 | Ga0105237_10008101 | 3300009545 | Bacteria | 11418 |
| 230 | Ga0105237_10117354 | 3300009545 | Bacteria | 2655 |
| 231 | Ga0105238_10019149 | 3300009551 | Bacteria | 6974 |
| 232 | Ga0105238_10028601 | 3300009551 | Bacteria | 5679 |
| 233 | Ga0105238_10444324 | 3300009551 | Bacteria | 1293 |
| 234 | Ga0105249_10037351 | 3300009553 | Bacteria | 4408 |
| 235 | Ga0105249_10078472 | 3300009553 | Bacteria | 3064 |
| 236 | Ga0105249_10131545 | 3300009553 | Bacteria | 2389 |
| 237 | Ga0105239_10035610 | 3300010375 | Bacteria | 5466 |
| 238 | Ga0105239_10072582 | 3300010375 | Bacteria | 3784 |
| 239 | Ga0105246_10013213 | 3300011119 | Bacteria | 5170 |
| 240 | Ga0105246_10015668 | 3300011119 | Bacteria | 4790 |
| 241 | Ga0105246_10082103 | 3300011119 | Bacteria | 2299 |
| 242 | Ga0105246_10388114 | 3300011119 | Unclassified | 1156 |
| 243 | Ga0157335_1041960 | 3300012492 | Unclassified | 519 |
| 244 | Ga0157342_1009623 | 3300012507 | Bacteria | 975 |
| 245 | Ga0157370_10472529 | 3300013104 | Bacteria | 1152 |
| 246 | Ga0157370_11106856 | 3300013104 | Unclassified | 716 |
| 247 | Ga0157369_10046007 | 3300013105 | Bacteria | 4744 |
| 248 | Ga0157369_10406837 | 3300013105 | Bacteria | 1411 |
| 249 | Ga0157374_10020255 | 3300013296 | Bacteria | 5899 |
| 250 | Ga0157374_10069144 | 3300013296 | Bacteria | 3324 |
| 251 | Ga0157374_10176424 | 3300013296 | Bacteria | 2086 |
| 252 | Ga0157374_10556489 | 3300013296 | Bacteria | 1155 |
| 253 | Ga0157374_10935759 | 3300013296 | Unclassified | 885 |
| 254 | Ga0157374_12477871 | 3300013296 | Unclassified | 546 |
| 255 | Ga0157378_10052391 | 3300013297 | Bacteria | 3631 |
| 256 | Ga0157378_11233712 | 3300013297 | Unclassified | 788 |
| 257 | Ga0163162_10057935 | 3300013306 | Bacteria | 3902 |
| 258 | Ga0163162_11078576 | 3300013306 | Unclassified | 910 |
| 259 | Ga0163162_11346214 | 3300013306 | Unclassified | 812 |
| 260 | Ga0163162_11822797 | 3300013306 | Bacteria | 696 |
| 261 | Ga0157372_10109296 | 3300013307 | Bacteria | 3166 |
| 262 | Ga0157372_10167184 | 3300013307 | Bacteria | 2544 |
| 263 | Ga0157372_12026260 | 3300013307 | Bacteria | 661 |
| 264 | Ga0157372_12640316 | 3300013307 | Bacteria | 576 |
| 265 | Ga0157375_10010496 | 3300013308 | Bacteria | 8154 |
| 266 | Ga0157375_10046872 | 3300013308 | Bacteria | 4217 |
| 267 | Ga0157375_10091017 | 3300013308 | Bacteria | 3111 |
| 268 | Ga0157375_10319657 | 3300013308 | Bacteria | 1717 |
| 269 | Ga0163163_10032629 | 3300014325 | Bacteria | 5032 |
| 270 | Ga0163163_10052703 | 3300014325 | Bacteria | 4014 |
| 271 | Ga0163163_10189969 | 3300014325 | Unclassified | 2102 |
| 272 | Ga0163163_10293699 | 3300014325 | Bacteria | 1677 |
| 273 | Ga0163163_12113362 | 3300014325 | Unclassified | 623 |
| 274 | Ga0157380_10028283 | 3300014326 | Bacteria | 4272 |
| 275 | Ga0157380_13422617 | 3300014326 | Bacteria | 508 |
| 276 | Ga0157377_10514528 | 3300014745 | Bacteria | 839 |
| 277 | Ga0157379_10003010 | 3300014968 | Bacteria | 14229 |
| 278 | Ga0157379_10092626 | 3300014968 | Bacteria | 2711 |
| 279 | Ga0157379_10203719 | 3300014968 | Bacteria | 1790 |
| 280 | Ga0157376_10269634 | 3300014969 | Bacteria | 1598 |
| 281 | Ga0157376_10278583 | 3300014969 | Bacteria | 1574 |
| 282 | Ga0157376_10290139 | 3300014969 | Bacteria | 1544 |
| 283 | Ga0157376_10565591 | 3300014969 | Bacteria | 1127 |
| 284 | Ga0157376_10964056 | 3300014969 | Bacteria | 874 |
| 285 | Ga0163161_10074396 | 3300017792 | Bacteria | 2491 |
| 286 | Ga0163161_10457212 | 3300017792 | Unclassified | 1033 |
| 287 | Ga0213875_10002951 | 3300021388 | Bacteria | 9909 |
| 288 | Ga0207697_10000443 | 3300025315 | Bacteria | 23388 |
| 289 | Ga0207656_10680845 | 3300025321 | Unclassified | 526 |
| 290 | Ga0207682_10000492 | 3300025893 | Bacteria | 18262 |
| 291 | Ga0207642_10425636 | 3300025899 | Unclassified | 799 |
| 292 | Ga0207688_10000727 | 3300025901 | Bacteria | 16326 |
| 293 | Ga0207680_11053070 | 3300025903 | Bacteria | 582 |
| 294 | Ga0207680_11291203 | 3300025903 | Unclassified | 519 |
| 295 | Ga0207645_10003192 | 3300025907 | Bacteria | 12545 |
| 296 | Ga0207643_10008797 | 3300025908 | Bacteria | 5416 |
| 297 | Ga0207705_10611205 | 3300025909 | Unclassified | 848 |
| 298 | Ga0207684_10580586 | 3300025910 | Unclassified | 958 |
| 299 | Ga0207671_10047654 | 3300025914 | Bacteria | 3172 |
| 300 | Ga0207671_10111517 | 3300025914 | Bacteria | 2081 |
| 301 | Ga0207663_10924761 | 3300025916 | Bacteria | 698 |
| 302 | Ga0207660_10498190 | 3300025917 | Unclassified | 988 |
| 303 | Ga0207662_10023035 | 3300025918 | Bacteria | 3575 |
| 304 | Ga0207657_11136118 | 3300025919 | Unclassified | 596 |
| 305 | Ga0207649_10276575 | 3300025920 | Bacteria | 1219 |
| 306 | Ga0207649_10560367 | 3300025920 | Unclassified | 875 |
| 307 | Ga0207652_11555816 | 3300025921 | Unclassified | 565 |
| 308 | Ga0207681_10027408 | 3300025923 | Bacteria | 3683 |
| 309 | Ga0207681_10153151 | 3300025923 | Bacteria | 1730 |
| 310 | Ga0207681_10382070 | 3300025923 | Unclassified | 1134 |
| 311 | Ga0207681_10636690 | 3300025923 | Bacteria | 883 |
| 312 | Ga0207694_10021351 | 3300025924 | Bacteria | 4906 |
| 313 | Ga0207694_10123683 | 3300025924 | Bacteria | 2067 |
| 314 | Ga0207694_10177248 | 3300025924 | Bacteria | 1727 |
| 315 | Ga0207694_10943579 | 3300025924 | Bacteria | 730 |
| 316 | Ga0207650_10043864 | 3300025925 | Bacteria | 3285 |
| 317 | Ga0207650_10266673 | 3300025925 | Bacteria | 1391 |
| 318 | Ga0207650_10752760 | 3300025925 | Bacteria | 824 |
| 319 | Ga0207659_10058809 | 3300025926 | Bacteria | 2760 |
| 320 | Ga0207659_10424042 | 3300025926 | Unclassified | 1116 |
| 321 | Ga0207659_11654625 | 3300025926 | Bacteria | 546 |
| 322 | Ga0207687_10018973 | 3300025927 | Bacteria | 4550 |
| 323 | Ga0207687_10118089 | 3300025927 | Bacteria | 1979 |
| 324 | Ga0207687_10241897 | 3300025927 | Bacteria | 1431 |
| 325 | Ga0207687_11479753 | 3300025927 | Unclassified | 583 |
| 326 | Ga0207700_10224061 | 3300025928 | Bacteria | 1595 |
| 327 | Ga0207700_10503959 | 3300025928 | Unclassified | 1071 |
| 328 | Ga0207664_10015746 | 3300025929 | Bacteria | 5500 |
| 329 | Ga0207644_10028408 | 3300025931 | Bacteria | 3872 |
| 330 | Ga0207644_10299739 | 3300025931 | Bacteria | 1295 |
| 331 | Ga0207644_10342078 | 3300025931 | Bacteria | 1213 |
| 332 | Ga0207644_10739641 | 3300025931 | Bacteria | 821 |
| 333 | Ga0207644_10954039 | 3300025931 | Unclassified | 719 |
| 334 | Ga0207690_10033662 | 3300025932 | Bacteria | 3297 |
| 335 | Ga0207690_10197556 | 3300025932 | Bacteria | 1525 |
| 336 | Ga0207690_10254731 | 3300025932 | Unclassified | 1357 |
| 337 | Ga0207690_11478036 | 3300025932 | Bacteria | 568 |
| 338 | Ga0207706_10009564 | 3300025933 | Bacteria | 8900 |
| 339 | Ga0207706_10011832 | 3300025933 | Bacteria | 7945 |
| 340 | Ga0207686_10076996 | 3300025934 | Bacteria | 2165 |
| 341 | Ga0207686_10514703 | 3300025934 | Bacteria | 930 |
| 342 | Ga0207686_11051624 | 3300025934 | Unclassified | 662 |
| 343 | Ga0207686_11205194 | 3300025934 | Unclassified | 620 |
| 344 | Ga0207709_10560553 | 3300025935 | Bacteria | 900 |
| 345 | Ga0207709_10968970 | 3300025935 | Bacteria | 694 |
| 346 | Ga0207670_11594334 | 3300025936 | Unclassified | 555 |
| 347 | Ga0207704_10216308 | 3300025938 | Unclassified | 1414 |
| 348 | Ga0207704_11222186 | 3300025938 | Unclassified | 641 |
| 349 | Ga0207665_10438569 | 3300025939 | Bacteria | 1000 |
| 350 | Ga0207691_10006460 | 3300025940 | Bacteria | 11327 |
| 351 | Ga0207691_10007854 | 3300025940 | Bacteria | 10277 |
| 352 | Ga0207691_11321354 | 3300025940 | Unclassified | 595 |
| 353 | Ga0207691_11418518 | 3300025940 | Bacteria | 570 |
| 354 | Ga0207711_10055719 | 3300025941 | Bacteria | 3394 |
| 355 | Ga0207711_10098267 | 3300025941 | Bacteria | 2586 |
| 356 | Ga0207711_10223248 | 3300025941 | Bacteria | 1724 |
| 357 | Ga0207711_10298672 | 3300025941 | Bacteria | 1485 |
| 358 | Ga0207689_10001107 | 3300025942 | Bacteria | 25998 |
| 359 | Ga0207689_10106792 | 3300025942 | Bacteria | 2300 |
| 360 | Ga0207661_10051241 | 3300025944 | Unclassified | 3293 |
| 361 | Ga0207661_10076551 | 3300025944 | Bacteria | 2748 |
| 362 | Ga0207661_10682358 | 3300025944 | Bacteria | 944 |
| 363 | Ga0207679_10006202 | 3300025945 | Bacteria | 7547 |
| 364 | Ga0207679_11081061 | 3300025945 | Unclassified | 736 |
| 365 | Ga0207667_10054354 | 3300025949 | Bacteria | 4212 |
| 366 | Ga0207667_10305514 | 3300025949 | Bacteria | 1625 |
| 367 | Ga0207667_10395103 | 3300025949 | Unclassified | 1408 |
| 368 | Ga0207651_10020469 | 3300025960 | Bacteria | 3993 |
| 369 | Ga0207651_10482096 | 3300025960 | Unclassified | 1069 |
| 370 | Ga0207651_10671639 | 3300025960 | Bacteria | 911 |
| 371 | Ga0207651_10733838 | 3300025960 | Unclassified | 872 |
| 372 | Ga0207651_11859283 | 3300025960 | Bacteria | 542 |
| 373 | Ga0207712_10006641 | 3300025961 | Bacteria | 7303 |
| 374 | Ga0207712_10171159 | 3300025961 | Bacteria | 1698 |
| 375 | Ga0207712_10325773 | 3300025961 | Bacteria | 1269 |
| 376 | Ga0207712_10524372 | 3300025961 | Unclassified | 1016 |
| 377 | Ga0207712_11580281 | 3300025961 | Bacteria | 588 |
| 378 | Ga0207712_12033836 | 3300025961 | Unclassified | 514 |
| 379 | Ga0207668_10919325 | 3300025972 | Bacteria | 779 |
| 380 | Ga0207658_10466023 | 3300025986 | Bacteria | 1121 |
| 381 | Ga0207658_11093658 | 3300025986 | Unclassified | 728 |
| 382 | Ga0207677_10153864 | 3300026023 | Bacteria | 1778 |
| 383 | Ga0207677_10888139 | 3300026023 | Unclassified | 803 |
| 384 | Ga0207703_10103737 | 3300026035 | Bacteria | 2414 |
| 385 | Ga0207703_10338028 | 3300026035 | Bacteria | 1383 |
| 386 | Ga0207703_10572833 | 3300026035 | Bacteria | 1066 |
| 387 | Ga0207639_10507008 | 3300026041 | Unclassified | 1103 |
| 388 | Ga0207678_11167207 | 3300026067 | Unclassified | 682 |
| 389 | Ga0207708_10168239 | 3300026075 | Bacteria | 1734 |
| 390 | Ga0207708_11275325 | 3300026075 | Bacteria | 643 |
| 391 | Ga0207708_11995871 | 3300026075 | Bacteria | 508 |
| 392 | Ga0207702_10068041 | 3300026078 | Unclassified | 3059 |
| 393 | Ga0207702_10201499 | 3300026078 | Bacteria | 1845 |
| 394 | Ga0207641_10016310 | 3300026088 | Bacteria | 6083 |
| 395 | Ga0207641_10954468 | 3300026088 | Bacteria | 853 |
| 396 | Ga0207641_11056146 | 3300026088 | Unclassified | 810 |
| 397 | Ga0207641_11507280 | 3300026088 | Unclassified | 674 |
| 398 | Ga0207641_11525154 | 3300026088 | Bacteria | 670 |
| 399 | Ga0207641_11773029 | 3300026088 | Unclassified | 619 |
| 400 | Ga0207641_12609879 | 3300026088 | Unclassified | 503 |
| 401 | Ga0207648_10064133 | 3300026089 | Bacteria | 3202 |
| 402 | Ga0207648_10095443 | 3300026089 | Bacteria | 2601 |
| 403 | Ga0207676_10056606 | 3300026095 | Bacteria | 3084 |
| 404 | Ga0207676_10269539 | 3300026095 | Bacteria | 1541 |
| 405 | Ga0207676_10579707 | 3300026095 | Unclassified | 1075 |
| 406 | Ga0207674_10002402 | 3300026116 | Bacteria | 23626 |
| 407 | Ga0207674_10063731 | 3300026116 | Bacteria | 3719 |
| 408 | Ga0207675_100034374 | 3300026118 | Bacteria | 4726 |
| 409 | Ga0207675_100208446 | 3300026118 | Unclassified | 1879 |
| 410 | Ga0207675_100467393 | 3300026118 | Bacteria | 1252 |
| 411 | Ga0207675_101261671 | 3300026118 | Bacteria | 759 |
| 412 | Ga0207683_10009105 | 3300026121 | Bacteria | 8462 |
| 413 | Ga0207683_10340418 | 3300026121 | Bacteria | 1376 |
| 414 | Ga0207683_10435992 | 3300026121 | Bacteria | 1207 |
| 415 | Ga0207683_10494113 | 3300026121 | Bacteria | 1130 |
| 416 | Ga0207698_10203294 | 3300026142 | Bacteria | 1776 |
| 417 | Ga0207698_10425934 | 3300026142 | Bacteria | 1275 |
| 418 | Ga0207698_10738751 | 3300026142 | Unclassified | 982 |
| 419 | Ga0207698_11102149 | 3300026142 | Unclassified | 807 |
| 420 | Ga0207428_10003783 | 3300027907 | Bacteria | 14518 |
| 421 | Ga0268266_10101448 | 3300028379 | Bacteria | 2537 |
| 422 | Ga0268266_10617871 | 3300028379 | Bacteria | 1042 |
| 423 | Ga0268265_10019094 | 3300028380 | Bacteria | 4758 |
| 424 | Ga0268265_10338021 | 3300028380 | Bacteria | 1370 |
| 425 | Ga0268265_11307325 | 3300028380 | Bacteria | 725 |
| 426 | Ga0268264_10189409 | 3300028381 | Bacteria | 1874 |
| 427 | Ga0268264_10351629 | 3300028381 | Bacteria | 1403 |
| 428 | Ga0268264_10952217 | 3300028381 | Bacteria | 864 |
| 429 | Ga0265314_10212004 | 3300031711 | Bacteria | 1137 |
| 430 | Ga0307405_11401870 | 3300031731 | Unclassified | 611 |
| 431 | Ga0307416_102371216 | 3300032002 | Unclassified | 630 |
| 432 | Ga0307415_100390918 | 3300032126 | Bacteria | 1184 |
| 433 | Ga0373950_0155932 | 3300034818 | Unclassified | 525 |
| 434 | Ga0373958_0023660 | 3300034819 | Unclassified | 1157 |
| 435 | Ga0373959_0146183 | 3300034820 | Unclassified | 595 |
| 436 | Ga0373938_0092025 | 3300034957 | Unclassified | 751 |
| 437 | Ga0373934_0004220 | 3300035086 | Bacteria | 5304 |
| 438 | Ga0373934_0073813 | 3300035086 | Unclassified | 1366 |
| 439 | Ga0373940_0003235 | 3300035088 | Bacteria | 3298 |
| 440 | Ga0373944_0434048 | 3300035089 | Unclassified | 510 |
| 441 | Ga0373949_0074752 | 3300035090 | Bacteria | 893 |
| 442 | Ga0373923_0089127 | 3300035111 | Unclassified | 1347 |
| 443 | Ga0373932_0032293 | 3300035112 | Bacteria | 1463 |
| 444 | Ga0373941_0164219 | 3300035115 | Unclassified | 823 |
| 445 | Ga0373945_0337312 | 3300035116 | Bacteria | 651 |
| 446 | Ga0373945_0539606 | 3300035116 | Unclassified | 522 |
| 447 | Ga0373953_0028711 | 3300035117 | Unclassified | 2147 |
| 448 | Ga0373954_0113213 | 3300035118 | Bacteria | 1313 |
| 449 | Ga0373954_0220625 | 3300035118 | Unclassified | 933 |
| 450 | Ga0373954_0277381 | 3300035118 | Unclassified | 826 |
| 451 | Ga0373960_0103345 | 3300035121 | Bacteria | 926 |
| 452 | Ga0373943_0080560 | 3300035170 | Bacteria | 1669 |
| 453 | Ga0373946_0103421 | 3300035171 | Unclassified | 1280 |
| 454 | Ga0373946_0166072 | 3300035171 | Unclassified | 1039 |
| 455 | Ga0373955_0043756 | 3300035172 | Bacteria | 2410 |
| 456 | Ga0373924_0093602 | 3300035410 | Bacteria | 1287 |
| 457 | Ga0373931_0085910 | 3300035691 | Bacteria | 1745 |
| 458 | Ga0373935_0570471 | 3300035692 | Unclassified | 826 |
| 459 | Ga0373927_0128678 | 3300035695 | Archaea | 1654 |
| 460 | Ga0373927_0293595 | 3300035695 | Unclassified | 1070 |
| 461 | Ga0373927_0755681 | 3300035695 | Bacteria | 642 |
| 462 | Ga0373933_0016820 | 3300035724 | Bacteria | 4098 |
| 463 | Ga0373933_0242982 | 3300035724 | Unclassified | 1158 |
| 464 | Ga0373933_0879503 | 3300035724 | Unclassified | 590 |
| 465 | Ga0373947_0406951 | 3300035725 | Bacteria | 918 |
| 466 | Ga0373947_0750270 | 3300035725 | Bacteria | 666 |
| 467 | Ga0373937_0002833 | 3300036401 | Bacteria | 14500 |
| 468 | Ga0373937_0050047 | 3300036401 | Bacteria | 3826 |
| 469 | Ga0373937_0052873 | 3300036401 | Unclassified | 3726 |
| 470 | Ga0373937_1297583 | 3300036401 | Unclassified | 676 |
| 471 | Ga0373925_0017602 | 3300037068 | Bacteria | 5184 |
| 472 | Ga0373925_0156497 | 3300037068 | Bacteria | 1793 |
| 473 | Ga0436364_1013559 | 3300037853 | Bacteria | 49805 |
| 474 | Ga0451802_1224248 | 3300041460 | Unclassified | 546 |
| 475 | Ga0451807_1932057 | 3300041486 | Bacteria | 546 |
| 476 | Ga0451807_2712053 | 3300041486 | Unclassified | 524 |
| 477 | Ga0451853_3255850 | 3300041512 | Bacteria | 523 |
| 478 | Ga0439450_069731 | 3300042008 | Bacteria | 861 |
| 479 | Ga0451576_0449587 | 3300045051 | Unclassified | 1352 |
| 480 | Ga0495592_0053013 | 3300046454 | Bacteria | 3009 |
| 481 | Ga0495629_0175954 | 3300046459 | Bacteria | 1484 |
| 482 | Ga0495629_0381033 | 3300046459 | Bacteria | 960 |
| 483 | Ga0495651_0072396 | 3300046462 | Bacteria | 2618 |
| 484 | Ga0495653_0307112 | 3300046463 | Unclassified | 1033 |
| 485 | Ga0495580_0012630 | 3300046472 | Bacteria | 6474 |
| 486 | Ga0495580_0063694 | 3300046472 | Bacteria | 2585 |
| 487 | Ga0495580_0233259 | 3300046472 | Bacteria | 1263 |
| 488 | Ga0495582_0019687 | 3300046473 | Bacteria | 3690 |
| 489 | Ga0495639_0072652 | 3300046475 | Bacteria | 1591 |
| 490 | Ga0495639_0100685 | 3300046475 | Bacteria | 1364 |
| 491 | Ga0495662_0612988 | 3300046476 | Unclassified | 532 |
| 492 | Ga0495594_0081419 | 3300046499 | Bacteria | 1808 |
| 493 | Ga0495594_0614980 | 3300046499 | Bacteria | 616 |
| 494 | Ga0495608_0279332 | 3300046511 | Unclassified | 1037 |
| 495 | Ga0495666_0432519 | 3300046526 | Unclassified | 590 |
| 496 | Ga0495652_0366693 | 3300046529 | Bacteria | 1028 |
| 497 | Ga0495586_0022880 | 3300046535 | Bacteria | 3336 |
| 498 | Ga0495586_0169935 | 3300046535 | Bacteria | 1232 |
| 499 | Ga0495586_0179012 | 3300046535 | Unclassified | 1199 |
| 500 | Ga0495586_0347828 | 3300046535 | Bacteria | 851 |
| 501 | Ga0495587_0001781 | 3300046536 | Bacteria | 14395 |
| 502 | Ga0495598_0056423 | 3300046537 | Unclassified | 1199 |
| 503 | Ga0495645_0098410 | 3300046543 | Bacteria | 2082 |
| 504 | Ga0495634_0176715 | 3300046642 | Bacteria | 1339 |
| 505 | Ga0495635_0395092 | 3300046663 | Bacteria | 919 |
| 506 | Ga0495647_0037515 | 3300046681 | Bacteria | 1829 |
| 507 | Ga0495658_0012808 | 3300046683 | Bacteria | 4258 |
| 508 | Ga0495658_0441712 | 3300046683 | Bacteria | 831 |
| 509 | Ga0495669_0105525 | 3300046684 | Bacteria | 1312 |
| 510 | Ga0495613_0064712 | 3300046689 | Unclassified | 2674 |
| 511 | Ga0495613_0242398 | 3300046689 | Unclassified | 1260 |
| 512 | Ga0495600_0048293 | 3300046809 | Bacteria | 2777 |
| 513 | Ga0495581_0104371 | 3300047315 | Bacteria | 1647 |
| 514 | Ga0495675_0234666 | 3300047444 | Unclassified | 1106 |
| 515 | Ga0495684_0016340 | 3300047471 | Bacteria | 5714 |
| 516 | Ga0496100_0098574 | 3300048903 | Bacteria | 2009 |
| 517 | Ga0496101_0861616 | 3300048904 | Unclassified | 714 |
| 518 | Ga0496102_0610347 | 3300048905 | Unclassified | 1014 |
| 519 | Ga0496104_0019202 | 3300048907 | Bacteria | 6250 |
| 520 | Ga0496104_0737410 | 3300048907 | Bacteria | 892 |
| 521 | Ga0496104_0848973 | 3300048907 | Unclassified | 819 |
| 522 | Ga0496104_1216256 | 3300048907 | Bacteria | 657 |
| 523 | Ga0496105_0100132 | 3300048908 | Bacteria | 2393 |
| 524 | Ga0496106_0125030 | 3300048909 | Unclassified | 2013 |
| 525 | Ga0496107_1174976 | 3300048910 | Unclassified | 552 |
| 526 | Ga0496109_0092907 | 3300048912 | Unclassified | 2791 |
| 527 | Ga0496109_0276928 | 3300048912 | Bacteria | 1581 |
| 528 | Ga0496109_1870359 | 3300048912 | Bacteria | 533 |
| 529 | Ga0496110_0331090 | 3300048913 | Bacteria | 1387 |
| 530 | Ga0496110_1233961 | 3300048913 | Unclassified | 657 |
| 531 | Ga0496111_0960843 | 3300048914 | Unclassified | 613 |
| 532 | Ga0496112_0119803 | 3300048915 | Unclassified | 2602 |
| 533 | Ga0496112_0831531 | 3300048915 | Bacteria | 847 |
| 534 | Ga0496112_0879191 | 3300048915 | Unclassified | 819 |
| 535 | Ga0496112_1214483 | 3300048915 | Bacteria | 671 |
| 536 | Ga0496113_0593829 | 3300048916 | Unclassified | 887 |
| 537 | Ga0496114_0032058 | 3300048917 | Unclassified | 4323 |
| 538 | Ga0501033_0111762 | 3300049570 | Bacteria | 1988 |
| 539 | Ga0501036_0024755 | 3300049572 | Bacteria | 5061 |
| 540 | Ga0501036_1355123 | 3300049572 | Bacteria | 577 |
| 541 | Ga0501037_0077754 | 3300049573 | Bacteria | 2408 |
| 542 | Ga0501038_0086320 | 3300049574 | Bacteria | 2637 |
| 543 | Ga0501039_0077687 | 3300049575 | Bacteria | 2582 |
| 544 | Ga0501039_0218043 | 3300049575 | Bacteria | 1500 |
| 545 | Ga0501040_0017471 | 3300049576 | Bacteria | 4761 |
| 546 | Ga0501041_0038116 | 3300049577 | Unclassified | 2914 |
| 547 | Ga0501042_0131831 | 3300049578 | Bacteria | 1801 |
| 548 | Ga0501046_0073723 | 3300049580 | Unclassified | 2649 |
| 549 | Ga0501048_0127837 | 3300049582 | Bacteria | 1797 |
| 550 | Ga0501068_0385253 | 3300049584 | Bacteria | 903 |
| 551 | Ga0501071_0009788 | 3300049587 | Bacteria | 6398 |
| 552 | Ga0501071_0295956 | 3300049587 | Bacteria | 1226 |
| 553 | Ga0501071_0856440 | 3300049587 | Bacteria | 701 |
| 554 | Ga0501072_0083258 | 3300049588 | Unclassified | 2536 |
| 555 | Ga0501072_0103922 | 3300049588 | Bacteria | 2258 |
| 556 | Ga0501075_0026388 | 3300049591 | Bacteria | 4276 |
| 557 | Ga0501075_1189946 | 3300049591 | Bacteria | 578 |
| 558 | Ga0501076_0000473 | 3300049592 | Bacteria | 25423 |
| 559 | Ga0501076_0114613 | 3300049592 | Bacteria | 2181 |
| 560 | Ga0501077_0150936 | 3300049593 | Bacteria | 1474 |
| 561 | Ga0501079_0243404 | 3300049741 | Bacteria | 1405 |
| 562 | Ga0501079_1555058 | 3300049741 | Bacteria | 520 |
| 563 | Ga0501080_0173446 | 3300049742 | Bacteria | 1988 |
| 564 | Ga0501080_1006001 | 3300049742 | Bacteria | 723 |
| 565 | Ga0501080_1825828 | 3300049742 | Bacteria | 510 |
| 566 | Ga0501081_0045419 | 3300049743 | Bacteria | 3016 |
| 567 | Ga0501083_0200374 | 3300049744 | Bacteria | 1302 |
| 568 | Ga0501045_0028924 | 3300049824 | Bacteria | 4000 |
| 569 | Ga0501045_0945660 | 3300049824 | Unclassified | 632 |
| 570 | nmdc:mga05p37_1154256_c1 | 3300050507 | Bacteria | 805 |
| 571 | nmdc:mga05p37_1198508_c1 | 3300050507 | Unclassified | 785 |
| 572 | nmdc:mga05p37_1622571_c1 | 3300050507 | Unclassified | 636 |
| 573 | nmdc:mga05p37_177038_c1 | 3300050507 | Bacteria | 2598 |
| 574 | nmdc:mga05p37_188453_c1 | 3300050507 | Bacteria | 2506 |
| 575 | nmdc:mga05p37_25424_c1 | 3300050507 | Bacteria | 5278 |
| 576 | nmdc:mga05p37_904646_c1 | 3300050507 | Bacteria | 951 |
| 577 | nmdc:mga09592_685558_c1 | 3300050508 | Unclassified | 873 |
| 578 | nmdc:mga09592_841214_c1 | 3300050508 | Unclassified | 774 |
| 579 | nmdc:mga09592_85652_c1 | 3300050508 | Bacteria | 2688 |
| 580 | nmdc:mga09592_962_c1 | 3300050508 | Bacteria | 22725 |
| 581 | nmdc:mga0qj67_25428_c1 | 3300050509 | Bacteria | 4575 |
| 582 | nmdc:mga0qj67_339222_c1 | 3300050509 | Unclassified | 1216 |
| 583 | nmdc:mga0qj67_488_c1 | 3300050509 | Bacteria | 27100 |
| 584 | nmdc:mga0qj67_659271_c1 | 3300050509 | Bacteria | 835 |
| 585 | nmdc:mga06r32_202080_c1 | 3300050510 | Unclassified | 1975 |
| 586 | nmdc:mga06r32_222071_c1 | 3300050510 | Bacteria | 1878 |
| 587 | nmdc:mga06r32_436632_c1 | 3300050510 | Unclassified | 1290 |
| 588 | nmdc:mga06r32_569319_c1 | 3300050510 | Unclassified | 1106 |
| 589 | nmdc:mga08y16_1147862_c1 | 3300050511 | Unclassified | 750 |
| 590 | nmdc:mga08y16_842413_c1 | 3300050511 | Unclassified | 907 |
| 591 | nmdc:mga08y16_992478_c1 | 3300050511 | Bacteria | 820 |
| 592 | nmdc:mga0n895_102938_c1 | 3300050512 | Bacteria | 2866 |
| 593 | nmdc:mga0n895_2007808_c1 | 3300050512 | Bacteria | 536 |
| 594 | nmdc:mga0n895_284417_c1 | 3300050512 | Bacteria | 1677 |
| 595 | nmdc:mga0rr50_37959_c1 | 3300050513 | Bacteria | 3481 |
| 596 | nmdc:mga08x19_103330_c1 | 3300050514 | Bacteria | 1893 |
| 597 | nmdc:mga08x19_353657_c1 | 3300050514 | Bacteria | 1026 |
| 598 | nmdc:mga0a205_1111194_c1 | 3300050515 | Bacteria | 638 |
| 599 | nmdc:mga0a205_550_c1 | 3300050515 | Bacteria | 24226 |
| 600 | Ga0495595_0219930 | 3300053084 | Bacteria | 948 |
| 601 | Ga0495619_0189657 | 3300053085 | Unclassified | 1423 |
| 602 | Ga0495619_0726624 | 3300053085 | Bacteria | 674 |
| 603 | Ga0495619_0747541 | 3300053085 | Bacteria | 663 |
| 604 | Ga0500556_0092711 | 3300053104 | Bacteria | 1155 |
| 605 | Ga0501084_0088650 | 3300054114 | Unclassified | 2597 |
| 606 | Ga0501084_0115964 | 3300054114 | Bacteria | 2251 |
| 607 | Ga0501082_0006031 | 3300060353 | Bacteria | 10512 |
| 608 | Ga0501082_0006280 | 3300060353 | Bacteria | 10312 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300006914 | Ga0075436_100099128 | Ga0075436_1000991283 | 106 |
| 2 | 3300005546 | Ga0070696_100820006 | Ga0070696_1008200062 | 107 |
| 3 | 3300025321 | Ga0207656_10680845 | Ga0207656_106808451 | 107 |
| 4 | 3300026118 | Ga0207675_100467393 | Ga0207675_1004673932 | 107 |
| 5 | 3300050507 | nmdc:mga05p37_904646_c1 | nmdc:mga05p37_904646_c1_13_354 | 107 |
| 6 | 3300050514 | nmdc:mga08x19_103330_c1 | nmdc:mga08x19_103330_c1_489_848 | 107 |
| 7 | 3300025908 | Ga0207643_10008797 | Ga0207643_100087972 | 108 |
| 8 | 3300035410 | Ga0373924_0093602 | Ga0373924_0093602_948_1277 | 108 |
| 9 | 3300005293 | Ga0065715_10005279 | Ga0065715_100052795 | 109 |
| 10 | 3300005328 | Ga0070676_10007930 | Ga0070676_100079302 | 109 |
| 11 | 3300005330 | Ga0070690_100437243 | Ga0070690_1004372432 | 109 |
| 12 | 3300005333 | Ga0070677_10006623 | Ga0070677_100066234 | 109 |
| 13 | 3300005334 | Ga0068869_100011562 | Ga0068869_1000115623 | 109 |
| 14 | 3300005335 | Ga0070666_10047517 | Ga0070666_100475172 | 109 |
| 15 | 3300005338 | Ga0068868_100011370 | Ga0068868_1000113704 | 109 |
| 16 | 3300005338 | Ga0068868_100949065 | Ga0068868_1009490652 | 109 |
| 17 | 3300005340 | Ga0070689_100032116 | Ga0070689_1000321163 | 109 |
| 18 | 3300005343 | Ga0070687_100028647 | Ga0070687_1000286472 | 109 |
| 19 | 3300005344 | Ga0070661_100015020 | Ga0070661_1000150202 | 109 |
| 20 | 3300005345 | Ga0070692_10948167 | Ga0070692_109481671 | 109 |
| 21 | 3300005347 | Ga0070668_100115892 | Ga0070668_1001158923 | 109 |
| 22 | 3300005353 | Ga0070669_100048332 | Ga0070669_1000483323 | 109 |
| 23 | 3300005354 | Ga0070675_100093550 | Ga0070675_1000935502 | 109 |
| 24 | 3300005354 | Ga0070675_100206743 | Ga0070675_1002067432 | 109 |
| 25 | 3300005355 | Ga0070671_100064247 | Ga0070671_1000642472 | 109 |
| 26 | 3300005364 | Ga0070673_100005159 | Ga0070673_1000051593 | 109 |
| 27 | 3300005364 | Ga0070673_100086244 | Ga0070673_1000862442 | 109 |
| 28 | 3300005365 | Ga0070688_100200625 | Ga0070688_1002006252 | 109 |
| 29 | 3300005366 | Ga0070659_100231941 | Ga0070659_1002319412 | 109 |
| 30 | 3300005367 | Ga0070667_100061901 | Ga0070667_1000619012 | 109 |
| 31 | 3300005434 | Ga0070709_11583042 | Ga0070709_115830421 | 109 |
| 32 | 3300005438 | Ga0070701_10029960 | Ga0070701_100299603 | 109 |
| 33 | 3300005438 | Ga0070701_10040810 | Ga0070701_100408102 | 109 |
| 34 | 3300005440 | Ga0070705_101284893 | Ga0070705_1012848931 | 109 |
| 35 | 3300005441 | Ga0070700_100151730 | Ga0070700_1001517302 | 109 |
| 36 | 3300005441 | Ga0070700_100743122 | Ga0070700_1007431221 | 109 |
| 37 | 3300005456 | Ga0070678_100138427 | Ga0070678_1001384273 | 109 |
| 38 | 3300005457 | Ga0070662_100025107 | Ga0070662_1000251073 | 109 |
| 39 | 3300005459 | Ga0068867_100008076 | Ga0068867_1000080766 | 109 |
| 40 | 3300005466 | Ga0070685_10003913 | Ga0070685_100039132 | 109 |
| 41 | 3300005535 | Ga0070684_100091701 | Ga0070684_1000917011 | 109 |
| 42 | 3300005543 | Ga0070672_100021412 | Ga0070672_1000214124 | 109 |
| 43 | 3300005544 | Ga0070686_100017352 | Ga0070686_1000173523 | 109 |
| 44 | 3300005544 | Ga0070686_100428480 | Ga0070686_1004284802 | 109 |
| 45 | 3300005547 | Ga0070693_100125721 | Ga0070693_1001257212 | 109 |
| 46 | 3300005548 | Ga0070665_100977917 | Ga0070665_1009779172 | 109 |
| 47 | 3300005564 | Ga0070664_100001464 | Ga0070664_1000014647 | 109 |
| 48 | 3300005617 | Ga0068859_100052270 | Ga0068859_1000522702 | 109 |
| 49 | 3300005719 | Ga0068861_100020900 | Ga0068861_1000209003 | 109 |
| 50 | 3300005840 | Ga0068870_10001750 | Ga0068870_100017507 | 109 |
| 51 | 3300005841 | Ga0068863_100007501 | Ga0068863_1000075017 | 109 |
| 52 | 3300005842 | Ga0068858_100018658 | Ga0068858_1000186585 | 109 |
| 53 | 3300005843 | Ga0068860_100066596 | Ga0068860_1000665963 | 109 |
| 54 | 3300005844 | Ga0068862_100001318 | Ga0068862_10000131811 | 109 |
| 55 | 3300006237 | Ga0097621_100341500 | Ga0097621_1003415002 | 109 |
| 56 | 3300006358 | Ga0068871_100355994 | Ga0068871_1003559942 | 109 |
| 57 | 3300006852 | Ga0075433_10004312 | Ga0075433_1000431210 | 109 |
| 58 | 3300006871 | Ga0075434_100178070 | Ga0075434_1001780702 | 109 |
| 59 | 3300006880 | Ga0075429_100039891 | Ga0075429_1000398912 | 109 |
| 60 | 3300006881 | Ga0068865_100012200 | Ga0068865_1000122007 | 109 |
| 61 | 3300006931 | Ga0097620_100052272 | Ga0097620_1000522723 | 109 |
| 62 | 3300007076 | Ga0075435_100064288 | Ga0075435_1000642883 | 109 |
| 63 | 3300009098 | Ga0105245_10933074 | Ga0105245_109330742 | 109 |
| 64 | 3300009147 | Ga0114129_10045388 | Ga0114129_100453885 | 109 |
| 65 | 3300009176 | Ga0105242_10472350 | Ga0105242_104723502 | 109 |
| 66 | 3300009177 | Ga0105248_10009093 | Ga0105248_100090932 | 109 |
| 67 | 3300009553 | Ga0105249_10037351 | Ga0105249_100373513 | 109 |
| 68 | 3300011119 | Ga0105246_10015668 | Ga0105246_100156683 | 109 |
| 69 | 3300012492 | Ga0157335_1041960 | Ga0157335_10419602 | 109 |
| 70 | 3300012507 | Ga0157342_1009623 | Ga0157342_10096232 | 109 |
| 71 | 3300013296 | Ga0157374_10176424 | Ga0157374_101764242 | 109 |
| 72 | 3300013306 | Ga0163162_10057935 | Ga0163162_100579353 | 109 |
| 73 | 3300014326 | Ga0157380_10028283 | Ga0157380_100282832 | 109 |
| 74 | 3300014968 | Ga0157379_10003010 | Ga0157379_100030102 | 109 |
| 75 | 3300017792 | Ga0163161_10074396 | Ga0163161_100743962 | 109 |
| 76 | 3300025315 | Ga0207697_10000443 | Ga0207697_100004437 | 109 |
| 77 | 3300025901 | Ga0207688_10000727 | Ga0207688_100007273 | 109 |
| 78 | 3300025903 | Ga0207680_11291203 | Ga0207680_112912031 | 109 |
| 79 | 3300025907 | Ga0207645_10003192 | Ga0207645_100031927 | 109 |
| 80 | 3300025918 | Ga0207662_10023035 | Ga0207662_100230353 | 109 |
| 81 | 3300025923 | Ga0207681_10027408 | Ga0207681_100274082 | 109 |
| 82 | 3300025926 | Ga0207659_10424042 | Ga0207659_104240422 | 109 |
| 83 | 3300025931 | Ga0207644_10342078 | Ga0207644_103420782 | 109 |
| 84 | 3300025932 | Ga0207690_10197556 | Ga0207690_101975562 | 109 |
| 85 | 3300025933 | Ga0207706_10011832 | Ga0207706_100118327 | 109 |
| 86 | 3300025936 | Ga0207670_11594334 | Ga0207670_115943341 | 109 |
| 87 | 3300025938 | Ga0207704_10216308 | Ga0207704_102163082 | 109 |
| 88 | 3300025940 | Ga0207691_10006460 | Ga0207691_100064602 | 109 |
| 89 | 3300025942 | Ga0207689_10001107 | Ga0207689_1000110714 | 109 |
| 90 | 3300025945 | Ga0207679_10006202 | Ga0207679_100062026 | 109 |
| 91 | 3300025960 | Ga0207651_10020469 | Ga0207651_100204692 | 109 |
| 92 | 3300025961 | Ga0207712_10006641 | Ga0207712_100066414 | 109 |
| 93 | 3300026023 | Ga0207677_10153864 | Ga0207677_101538642 | 109 |
| 94 | 3300026035 | Ga0207703_10338028 | Ga0207703_103380281 | 109 |
| 95 | 3300026075 | Ga0207708_10168239 | Ga0207708_101682392 | 109 |
| 96 | 3300026075 | Ga0207708_11275325 | Ga0207708_112753252 | 109 |
| 97 | 3300026088 | Ga0207641_10016310 | Ga0207641_100163106 | 109 |
| 98 | 3300026089 | Ga0207648_10064133 | Ga0207648_100641334 | 109 |
| 99 | 3300026118 | Ga0207675_100034374 | Ga0207675_1000343743 | 109 |
| 100 | 3300026121 | Ga0207683_10009105 | Ga0207683_100091053 | 109 |
| 101 | 3300026142 | Ga0207698_10738751 | Ga0207698_107387511 | 109 |
| 102 | 3300027907 | Ga0207428_10003783 | Ga0207428_1000378312 | 109 |
| 103 | 3300028379 | Ga0268266_10101448 | Ga0268266_101014482 | 109 |
| 104 | 3300028380 | Ga0268265_10019094 | Ga0268265_100190942 | 109 |
| 105 | 3300028380 | Ga0268265_10338021 | Ga0268265_103380211 | 109 |
| 106 | 3300028381 | Ga0268264_10189409 | Ga0268264_101894093 | 109 |
| 107 | 3300034818 | Ga0373950_0155932 | Ga0373950_0155932_81_464 | 109 |
| 108 | 3300034819 | Ga0373958_0023660 | Ga0373958_0023660_494_877 | 109 |
| 109 | 3300034820 | Ga0373959_0146183 | Ga0373959_0146183_186_569 | 109 |
| 110 | 3300034957 | Ga0373938_0092025 | Ga0373938_0092025_79_462 | 109 |
| 111 | 3300035088 | Ga0373940_0003235 | Ga0373940_0003235_1257_1640 | 109 |
| 112 | 3300035090 | Ga0373949_0074752 | Ga0373949_0074752_99_482 | 109 |
| 113 | 3300035112 | Ga0373932_0032293 | Ga0373932_0032293_17_400 | 109 |
| 114 | 3300035115 | Ga0373941_0164219 | Ga0373941_0164219_157_540 | 109 |
| 115 | 3300035121 | Ga0373960_0103345 | Ga0373960_0103345_488_871 | 109 |
| 116 | 3300035691 | Ga0373931_0085910 | Ga0373931_0085910_131_514 | 109 |
| 117 | 3300045051 | Ga0451576_0449587 | Ga0451576_0449587_958_1341 | 109 |
| 118 | 3300048910 | Ga0496107_1174976 | Ga0496107_1174976_120_503 | 109 |
| 119 | 3300048912 | Ga0496109_0276928 | Ga0496109_0276928_1090_1473 | 109 |
| 120 | 3300048913 | Ga0496110_0331090 | Ga0496110_0331090_480_863 | 109 |
| 121 | 3300048915 | Ga0496112_1214483 | Ga0496112_1214483_40_369 | 109 |
| 122 | 3300050512 | nmdc:mga0n895_284417_c1 | nmdc:mga0n895_284417_c1_780_1163 | 109 |
| 123 | 3300050513 | nmdc:mga0rr50_37959_c1 | nmdc:mga0rr50_37959_c1_681_1064 | 109 |
| 124 | 3300050515 | nmdc:mga0a205_550_c1 | nmdc:mga0a205_550_c1_10646_11029 | 109 |
| 125 | 3300006914 | Ga0075436_100347607 | Ga0075436_1003476072 | 110 |
| 126 | 3300009098 | Ga0105245_10003759 | Ga0105245_100037596 | 110 |
| 127 | 3300013297 | Ga0157378_10052391 | Ga0157378_100523915 | 110 |
| 128 | 3300025961 | Ga0207712_12033836 | Ga0207712_120338361 | 110 |
| 129 | 3300026088 | Ga0207641_11525154 | Ga0207641_115251542 | 110 |
| 130 | 3300026142 | Ga0207698_10425934 | Ga0207698_104259342 | 110 |
| 131 | 3300048907 | Ga0496104_0019202 | Ga0496104_0019202_1450_1785 | 110 |
| 132 | 3300005354 | Ga0070675_100000717 | Ga0070675_1000007174 | 111 |
| 133 | 3300005364 | Ga0070673_100998898 | Ga0070673_1009988981 | 111 |
| 134 | 3300005518 | Ga0070699_100643054 | Ga0070699_1006430542 | 111 |
| 135 | 3300005535 | Ga0070684_100093990 | Ga0070684_1000939901 | 111 |
| 136 | 3300005546 | Ga0070696_100530970 | Ga0070696_1005309701 | 111 |
| 137 | 3300005841 | Ga0068863_102702468 | Ga0068863_1027024682 | 111 |
| 138 | 3300006028 | Ga0070717_10383726 | Ga0070717_103837262 | 111 |
| 139 | 3300006871 | Ga0075434_100465626 | Ga0075434_1004656261 | 111 |
| 140 | 3300006914 | Ga0075436_100269247 | Ga0075436_1002692472 | 111 |
| 141 | 3300013296 | Ga0157374_12477871 | Ga0157374_124778712 | 111 |
| 142 | 3300025926 | Ga0207659_10058809 | Ga0207659_100588092 | 111 |
| 143 | 3300025932 | Ga0207690_11478036 | Ga0207690_114780362 | 111 |
| 144 | 3300025944 | Ga0207661_10051241 | Ga0207661_100512411 | 111 |
| 145 | 3300026088 | Ga0207641_12609879 | Ga0207641_126098792 | 111 |
| 146 | 3300041460 | Ga0451802_1224248 | Ga0451802_1224248_161_511 | 111 |
| 147 | 3300046537 | Ga0495598_0056423 | Ga0495598_0056423_171_518 | 111 |
| 148 | 3300048905 | Ga0496102_0610347 | Ga0496102_0610347_375_752 | 111 |
| 149 | 3300050512 | nmdc:mga0n895_102938_c1 | nmdc:mga0n895_102938_c1_718_1095 | 111 |
| 150 | 3300050512 | nmdc:mga0n895_2007808_c1 | nmdc:mga0n895_2007808_c1_67_432 | 111 |
| 151 | 3300050514 | nmdc:mga08x19_353657_c1 | nmdc:mga08x19_353657_c1_414_791 | 111 |
| 152 | 3300005338 | Ga0068868_100535489 | Ga0068868_1005354892 | 112 |
| 153 | 3300005356 | Ga0070674_101172883 | Ga0070674_1011728831 | 112 |
| 154 | 3300005439 | Ga0070711_100802620 | Ga0070711_1008026202 | 112 |
| 155 | 3300005445 | Ga0070708_100098075 | Ga0070708_1000980752 | 112 |
| 156 | 3300005536 | Ga0070697_100783671 | Ga0070697_1007836712 | 112 |
| 157 | 3300005546 | Ga0070696_100117208 | Ga0070696_1001172082 | 112 |
| 158 | 3300005843 | Ga0068860_101511362 | Ga0068860_1015113621 | 112 |
| 159 | 3300006852 | Ga0075433_11310606 | Ga0075433_113106061 | 112 |
| 160 | 3300006871 | Ga0075434_101567381 | Ga0075434_1015673812 | 112 |
| 161 | 3300009177 | Ga0105248_11159140 | Ga0105248_111591401 | 112 |
| 162 | 3300013104 | Ga0157370_10472529 | Ga0157370_104725295 | 112 |
| 163 | 3300013296 | Ga0157374_10556489 | Ga0157374_105564892 | 112 |
| 164 | 3300025916 | Ga0207663_10924761 | Ga0207663_109247611 | 112 |
| 165 | 3300025939 | Ga0207665_10438569 | Ga0207665_104385692 | 112 |
| 166 | 3300025961 | Ga0207712_11580281 | Ga0207712_115802811 | 112 |
| 167 | 3300026118 | Ga0207675_101261671 | Ga0207675_1012616712 | 112 |
| 168 | 3300028381 | Ga0268264_10952217 | Ga0268264_109522172 | 112 |
| 169 | 3300048907 | Ga0496104_1216256 | Ga0496104_1216256_138_485 | 112 |
| 170 | 3300049742 | Ga0501080_1006001 | Ga0501080_1006001_90_446 | 112 |
| 171 | 3300050507 | nmdc:mga05p37_1154256_c1 | nmdc:mga05p37_1154256_c1_333_680 | 112 |
| 172 | 3300060353 | Ga0501082_0006031 | Ga0501082_0006031_9361_9705 | 112 |
| 173 | 3300005327 | Ga0070658_10941364 | Ga0070658_109413642 | 113 |
| 174 | 3300005330 | Ga0070690_100134820 | Ga0070690_1001348203 | 113 |
| 175 | 3300005331 | Ga0070670_100688426 | Ga0070670_1006884262 | 113 |
| 176 | 3300005335 | Ga0070666_10853510 | Ga0070666_108535101 | 113 |
| 177 | 3300005344 | Ga0070661_100903923 | Ga0070661_1009039231 | 113 |
| 178 | 3300005354 | Ga0070675_100205843 | Ga0070675_1002058432 | 113 |
| 179 | 3300005354 | Ga0070675_100949873 | Ga0070675_1009498731 | 113 |
| 180 | 3300005355 | Ga0070671_100344160 | Ga0070671_1003441602 | 113 |
| 181 | 3300005355 | Ga0070671_101063390 | Ga0070671_1010633902 | 113 |
| 182 | 3300005364 | Ga0070673_100209173 | Ga0070673_1002091732 | 113 |
| 183 | 3300005364 | Ga0070673_100233272 | Ga0070673_1002332722 | 113 |
| 184 | 3300005364 | Ga0070673_101616756 | Ga0070673_1016167562 | 113 |
| 185 | 3300005366 | Ga0070659_100083864 | Ga0070659_1000838643 | 113 |
| 186 | 3300005441 | Ga0070700_100152722 | Ga0070700_1001527221 | 113 |
| 187 | 3300005456 | Ga0070678_100213534 | Ga0070678_1002135342 | 113 |
| 188 | 3300005543 | Ga0070672_100035025 | Ga0070672_1000350252 | 113 |
| 189 | 3300005543 | Ga0070672_100060228 | Ga0070672_1000602282 | 113 |
| 190 | 3300005616 | Ga0068852_101195142 | Ga0068852_1011951422 | 113 |
| 191 | 3300005841 | Ga0068863_101163007 | Ga0068863_1011630072 | 113 |
| 192 | 3300005985 | Ga0081539_10009987 | Ga0081539_100099871 | 113 |
| 193 | 3300006237 | Ga0097621_101036924 | Ga0097621_1010369242 | 113 |
| 194 | 3300006237 | Ga0097621_101400569 | Ga0097621_1014005692 | 113 |
| 195 | 3300006847 | Ga0075431_101988073 | Ga0075431_1019880732 | 113 |
| 196 | 3300013104 | Ga0157370_11106856 | Ga0157370_111068562 | 113 |
| 197 | 3300013105 | Ga0157369_10406837 | Ga0157369_104068372 | 113 |
| 198 | 3300013296 | Ga0157374_10935759 | Ga0157374_109357591 | 113 |
| 199 | 3300013308 | Ga0157375_10046872 | Ga0157375_100468724 | 113 |
| 200 | 3300013308 | Ga0157375_10091017 | Ga0157375_100910172 | 113 |
| 201 | 3300014969 | Ga0157376_10269634 | Ga0157376_102696341 | 113 |
| 202 | 3300014969 | Ga0157376_10278583 | Ga0157376_102785832 | 113 |
| 203 | 3300017792 | Ga0163161_10457212 | Ga0163161_104572122 | 113 |
| 204 | 3300025903 | Ga0207680_11053070 | Ga0207680_110530701 | 113 |
| 205 | 3300025909 | Ga0207705_10611205 | Ga0207705_106112052 | 113 |
| 206 | 3300025923 | Ga0207681_10382070 | Ga0207681_103820702 | 113 |
| 207 | 3300025925 | Ga0207650_10752760 | Ga0207650_107527602 | 113 |
| 208 | 3300025926 | Ga0207659_11654625 | Ga0207659_116546251 | 113 |
| 209 | 3300025931 | Ga0207644_10299739 | Ga0207644_102997392 | 113 |
| 210 | 3300025931 | Ga0207644_10739641 | Ga0207644_107396412 | 113 |
| 211 | 3300025932 | Ga0207690_10254731 | Ga0207690_102547313 | 113 |
| 212 | 3300025940 | Ga0207691_10007854 | Ga0207691_100078543 | 113 |
| 213 | 3300025940 | Ga0207691_11321354 | Ga0207691_113213541 | 113 |
| 214 | 3300025960 | Ga0207651_10671639 | Ga0207651_106716392 | 113 |
| 215 | 3300025960 | Ga0207651_10733838 | Ga0207651_107338382 | 113 |
| 216 | 3300025960 | Ga0207651_11859283 | Ga0207651_118592831 | 113 |
| 217 | 3300025986 | Ga0207658_10466023 | Ga0207658_104660232 | 113 |
| 218 | 3300026121 | Ga0207683_10494113 | Ga0207683_104941132 | 113 |
| 219 | 3300026142 | Ga0207698_10203294 | Ga0207698_102032942 | 113 |
| 220 | 3300035118 | Ga0373954_0277381 | Ga0373954_0277381_435_785 | 113 |
| 221 | 3300035170 | Ga0373943_0080560 | Ga0373943_0080560_397_744 | 113 |
| 222 | 3300041486 | Ga0451807_1932057 | Ga0451807_1932057_95_451 | 113 |
| 223 | 3300041512 | Ga0451853_3255850 | Ga0451853_3255850_122_475 | 113 |
| 224 | 3300046499 | Ga0495594_0081419 | Ga0495594_0081419_87_446 | 113 |
| 225 | 3300048909 | Ga0496106_0125030 | Ga0496106_0125030_234_626 | 113 |
| 226 | 3300050511 | nmdc:mga08y16_992478_c1 | nmdc:mga08y16_992478_c1_173_520 | 113 |
| 227 | 3300005290 | Ga0065712_10153387 | Ga0065712_101533872 | 114 |
| 228 | 3300005293 | Ga0065715_10432559 | Ga0065715_104325592 | 114 |
| 229 | 3300005329 | Ga0070683_100013920 | Ga0070683_1000139208 | 114 |
| 230 | 3300005329 | Ga0070683_100077653 | Ga0070683_1000776535 | 114 |
| 231 | 3300005330 | Ga0070690_100028336 | Ga0070690_1000283365 | 114 |
| 232 | 3300005334 | Ga0068869_100424523 | Ga0068869_1004245232 | 114 |
| 233 | 3300005335 | Ga0070666_10142396 | Ga0070666_101423963 | 114 |
| 234 | 3300005339 | Ga0070660_101042719 | Ga0070660_1010427191 | 114 |
| 235 | 3300005344 | Ga0070661_100383849 | Ga0070661_1003838491 | 114 |
| 236 | 3300005345 | Ga0070692_10113356 | Ga0070692_101133562 | 114 |
| 237 | 3300005347 | Ga0070668_100256563 | Ga0070668_1002565632 | 114 |
| 238 | 3300005353 | Ga0070669_100339727 | Ga0070669_1003397272 | 114 |
| 239 | 3300005355 | Ga0070671_100064212 | Ga0070671_1000642124 | 114 |
| 240 | 3300005364 | Ga0070673_100132883 | Ga0070673_1001328832 | 114 |
| 241 | 3300005366 | Ga0070659_100089438 | Ga0070659_1000894383 | 114 |
| 242 | 3300005435 | Ga0070714_100020496 | Ga0070714_1000204963 | 114 |
| 243 | 3300005436 | Ga0070713_100091619 | Ga0070713_1000916194 | 114 |
| 244 | 3300005436 | Ga0070713_100382937 | Ga0070713_1003829372 | 114 |
| 245 | 3300005441 | Ga0070700_101265346 | Ga0070700_1012653461 | 114 |
| 246 | 3300005456 | Ga0070678_100418894 | Ga0070678_1004188942 | 114 |
| 247 | 3300005457 | Ga0070662_100026179 | Ga0070662_1000261793 | 114 |
| 248 | 3300005459 | Ga0068867_100559880 | Ga0068867_1005598802 | 114 |
| 249 | 3300005459 | Ga0068867_100614607 | Ga0068867_1006146072 | 114 |
| 250 | 3300005468 | Ga0070707_101088759 | Ga0070707_1010887592 | 114 |
| 251 | 3300005530 | Ga0070679_100833668 | Ga0070679_1008336681 | 114 |
| 252 | 3300005535 | Ga0070684_100048231 | Ga0070684_1000482313 | 114 |
| 253 | 3300005535 | Ga0070684_100066609 | Ga0070684_1000666094 | 114 |
| 254 | 3300005535 | Ga0070684_100084687 | Ga0070684_1000846872 | 114 |
| 255 | 3300005543 | Ga0070672_101529016 | Ga0070672_1015290162 | 114 |
| 256 | 3300005544 | Ga0070686_100251582 | Ga0070686_1002515822 | 114 |
| 257 | 3300005547 | Ga0070693_100042229 | Ga0070693_1000422291 | 114 |
| 258 | 3300005547 | Ga0070693_101456421 | Ga0070693_1014564211 | 114 |
| 259 | 3300005548 | Ga0070665_100914874 | Ga0070665_1009148742 | 114 |
| 260 | 3300005564 | Ga0070664_100442056 | Ga0070664_1004420562 | 114 |
| 261 | 3300005577 | Ga0068857_100027836 | Ga0068857_1000278366 | 114 |
| 262 | 3300005577 | Ga0068857_100167916 | Ga0068857_1001679163 | 114 |
| 263 | 3300005614 | Ga0068856_100182673 | Ga0068856_1001826733 | 114 |
| 264 | 3300005614 | Ga0068856_100858637 | Ga0068856_1008586372 | 114 |
| 265 | 3300005615 | Ga0070702_101450618 | Ga0070702_1014506181 | 114 |
| 266 | 3300005617 | Ga0068859_100387711 | Ga0068859_1003877112 | 114 |
| 267 | 3300005617 | Ga0068859_100726635 | Ga0068859_1007266352 | 114 |
| 268 | 3300005617 | Ga0068859_100972072 | Ga0068859_1009720722 | 114 |
| 269 | 3300005618 | Ga0068864_100227816 | Ga0068864_1002278162 | 114 |
| 270 | 3300005618 | Ga0068864_100534049 | Ga0068864_1005340492 | 114 |
| 271 | 3300005841 | Ga0068863_100979838 | Ga0068863_1009798382 | 114 |
| 272 | 3300005841 | Ga0068863_101185900 | Ga0068863_1011859002 | 114 |
| 273 | 3300005841 | Ga0068863_102157800 | Ga0068863_1021578002 | 114 |
| 274 | 3300005842 | Ga0068858_100621230 | Ga0068858_1006212303 | 114 |
| 275 | 3300005842 | Ga0068858_101724773 | Ga0068858_1017247731 | 114 |
| 276 | 3300005843 | Ga0068860_100174441 | Ga0068860_1001744414 | 114 |
| 277 | 3300005843 | Ga0068860_100605705 | Ga0068860_1006057052 | 114 |
| 278 | 3300005985 | Ga0081539_10000107 | Ga0081539_100001075 | 114 |
| 279 | 3300006237 | Ga0097621_100080773 | Ga0097621_1000807732 | 114 |
| 280 | 3300006237 | Ga0097621_100272800 | Ga0097621_1002728002 | 114 |
| 281 | 3300006237 | Ga0097621_100527038 | Ga0097621_1005270382 | 114 |
| 282 | 3300006358 | Ga0068871_100036875 | Ga0068871_1000368753 | 114 |
| 283 | 3300006358 | Ga0068871_100076589 | Ga0068871_1000765893 | 114 |
| 284 | 3300006914 | Ga0075436_100398240 | Ga0075436_1003982401 | 114 |
| 285 | 3300006931 | Ga0097620_100387716 | Ga0097620_1003877162 | 114 |
| 286 | 3300006931 | Ga0097620_100726585 | Ga0097620_1007265852 | 114 |
| 287 | 3300006931 | Ga0097620_100972055 | Ga0097620_1009720552 | 114 |
| 288 | 3300009093 | Ga0105240_10260044 | Ga0105240_102600443 | 114 |
| 289 | 3300009093 | Ga0105240_10352799 | Ga0105240_103527992 | 114 |
| 290 | 3300009094 | Ga0111539_10576590 | Ga0111539_105765902 | 114 |
| 291 | 3300009094 | Ga0111539_12011896 | Ga0111539_120118961 | 114 |
| 292 | 3300009098 | Ga0105245_10051376 | Ga0105245_100513761 | 114 |
| 293 | 3300009098 | Ga0105245_10904286 | Ga0105245_109042862 | 114 |
| 294 | 3300009101 | Ga0105247_10349361 | Ga0105247_103493612 | 114 |
| 295 | 3300009148 | Ga0105243_10172170 | Ga0105243_101721703 | 114 |
| 296 | 3300009148 | Ga0105243_10453705 | Ga0105243_104537052 | 114 |
| 297 | 3300009148 | Ga0105243_11010973 | Ga0105243_110109732 | 114 |
| 298 | 3300009174 | Ga0105241_10022046 | Ga0105241_100220463 | 114 |
| 299 | 3300009174 | Ga0105241_10342345 | Ga0105241_103423452 | 114 |
| 300 | 3300009176 | Ga0105242_10277304 | Ga0105242_102773042 | 114 |
| 301 | 3300009176 | Ga0105242_10445251 | Ga0105242_104452512 | 114 |
| 302 | 3300009176 | Ga0105242_10908045 | Ga0105242_109080452 | 114 |
| 303 | 3300009176 | Ga0105242_11778285 | Ga0105242_117782852 | 114 |
| 304 | 3300009176 | Ga0105242_12890881 | Ga0105242_128908812 | 114 |
| 305 | 3300009177 | Ga0105248_10299332 | Ga0105248_102993322 | 114 |
| 306 | 3300009177 | Ga0105248_11169942 | Ga0105248_111699422 | 114 |
| 307 | 3300009545 | Ga0105237_10007630 | Ga0105237_100076302 | 114 |
| 308 | 3300009545 | Ga0105237_10117354 | Ga0105237_101173543 | 114 |
| 309 | 3300009551 | Ga0105238_10028601 | Ga0105238_100286012 | 114 |
| 310 | 3300009551 | Ga0105238_10444324 | Ga0105238_104443242 | 114 |
| 311 | 3300010375 | Ga0105239_10072582 | Ga0105239_100725825 | 114 |
| 312 | 3300011119 | Ga0105246_10082103 | Ga0105246_100821032 | 114 |
| 313 | 3300011119 | Ga0105246_10388114 | Ga0105246_103881142 | 114 |
| 314 | 3300013296 | Ga0157374_10069144 | Ga0157374_100691442 | 114 |
| 315 | 3300013297 | Ga0157378_11233712 | Ga0157378_112337121 | 114 |
| 316 | 3300013306 | Ga0163162_11078576 | Ga0163162_110785762 | 114 |
| 317 | 3300013306 | Ga0163162_11346214 | Ga0163162_113462142 | 114 |
| 318 | 3300013307 | Ga0157372_10167184 | Ga0157372_101671842 | 114 |
| 319 | 3300013307 | Ga0157372_12026260 | Ga0157372_120262601 | 114 |
| 320 | 3300013307 | Ga0157372_12640316 | Ga0157372_126403161 | 114 |
| 321 | 3300013308 | Ga0157375_10319657 | Ga0157375_103196572 | 114 |
| 322 | 3300014325 | Ga0163163_10032629 | Ga0163163_100326296 | 114 |
| 323 | 3300014325 | Ga0163163_10052703 | Ga0163163_100527034 | 114 |
| 324 | 3300014325 | Ga0163163_10293699 | Ga0163163_102936991 | 114 |
| 325 | 3300014325 | Ga0163163_12113362 | Ga0163163_121133622 | 114 |
| 326 | 3300014745 | Ga0157377_10514528 | Ga0157377_105145282 | 114 |
| 327 | 3300014968 | Ga0157379_10092626 | Ga0157379_100926265 | 114 |
| 328 | 3300014968 | Ga0157379_10203719 | Ga0157379_102037193 | 114 |
| 329 | 3300014969 | Ga0157376_10290139 | Ga0157376_102901392 | 114 |
| 330 | 3300014969 | Ga0157376_10964056 | Ga0157376_109640562 | 114 |
| 331 | 3300025899 | Ga0207642_10425636 | Ga0207642_104256362 | 114 |
| 332 | 3300025914 | Ga0207671_10111517 | Ga0207671_101115173 | 114 |
| 333 | 3300025919 | Ga0207657_11136118 | Ga0207657_111361182 | 114 |
| 334 | 3300025920 | Ga0207649_10560367 | Ga0207649_105603672 | 114 |
| 335 | 3300025921 | Ga0207652_11555816 | Ga0207652_115558161 | 114 |
| 336 | 3300025923 | Ga0207681_10153151 | Ga0207681_101531512 | 114 |
| 337 | 3300025924 | Ga0207694_10123683 | Ga0207694_101236832 | 114 |
| 338 | 3300025924 | Ga0207694_10177248 | Ga0207694_101772482 | 114 |
| 339 | 3300025924 | Ga0207694_10943579 | Ga0207694_109435792 | 114 |
| 340 | 3300025925 | Ga0207650_10266673 | Ga0207650_102666733 | 114 |
| 341 | 3300025927 | Ga0207687_10241897 | Ga0207687_102418972 | 114 |
| 342 | 3300025928 | Ga0207700_10224061 | Ga0207700_102240613 | 114 |
| 343 | 3300025928 | Ga0207700_10503959 | Ga0207700_105039592 | 114 |
| 344 | 3300025929 | Ga0207664_10015746 | Ga0207664_100157463 | 114 |
| 345 | 3300025931 | Ga0207644_10028408 | Ga0207644_100284082 | 114 |
| 346 | 3300025932 | Ga0207690_10033662 | Ga0207690_100336624 | 114 |
| 347 | 3300025933 | Ga0207706_10009564 | Ga0207706_100095648 | 114 |
| 348 | 3300025934 | Ga0207686_10076996 | Ga0207686_100769962 | 114 |
| 349 | 3300025934 | Ga0207686_10514703 | Ga0207686_105147032 | 114 |
| 350 | 3300025934 | Ga0207686_11051624 | Ga0207686_110516242 | 114 |
| 351 | 3300025934 | Ga0207686_11205194 | Ga0207686_112051941 | 114 |
| 352 | 3300025935 | Ga0207709_10560553 | Ga0207709_105605532 | 114 |
| 353 | 3300025940 | Ga0207691_11418518 | Ga0207691_114185181 | 114 |
| 354 | 3300025941 | Ga0207711_10098267 | Ga0207711_100982673 | 114 |
| 355 | 3300025941 | Ga0207711_10223248 | Ga0207711_102232482 | 114 |
| 356 | 3300025941 | Ga0207711_10298672 | Ga0207711_102986722 | 114 |
| 357 | 3300025942 | Ga0207689_10106792 | Ga0207689_101067922 | 114 |
| 358 | 3300025944 | Ga0207661_10682358 | Ga0207661_106823581 | 114 |
| 359 | 3300025949 | Ga0207667_10054354 | Ga0207667_100543545 | 114 |
| 360 | 3300025949 | Ga0207667_10305514 | Ga0207667_103055143 | 114 |
| 361 | 3300025949 | Ga0207667_10395103 | Ga0207667_103951032 | 114 |
| 362 | 3300025960 | Ga0207651_10482096 | Ga0207651_104820962 | 114 |
| 363 | 3300025961 | Ga0207712_10524372 | Ga0207712_105243722 | 114 |
| 364 | 3300025972 | Ga0207668_10919325 | Ga0207668_109193251 | 114 |
| 365 | 3300025986 | Ga0207658_11093658 | Ga0207658_110936582 | 114 |
| 366 | 3300026023 | Ga0207677_10888139 | Ga0207677_108881392 | 114 |
| 367 | 3300026035 | Ga0207703_10572833 | Ga0207703_105728332 | 114 |
| 368 | 3300026078 | Ga0207702_10201499 | Ga0207702_102014992 | 114 |
| 369 | 3300026088 | Ga0207641_10954468 | Ga0207641_109544682 | 114 |
| 370 | 3300026088 | Ga0207641_11056146 | Ga0207641_110561462 | 114 |
| 371 | 3300026088 | Ga0207641_11507280 | Ga0207641_115072801 | 114 |
| 372 | 3300026088 | Ga0207641_11773029 | Ga0207641_117730292 | 114 |
| 373 | 3300026089 | Ga0207648_10095443 | Ga0207648_100954432 | 114 |
| 374 | 3300026095 | Ga0207676_10269539 | Ga0207676_102695392 | 114 |
| 375 | 3300026095 | Ga0207676_10579707 | Ga0207676_105797072 | 114 |
| 376 | 3300026116 | Ga0207674_10002402 | Ga0207674_100024022 | 114 |
| 377 | 3300026116 | Ga0207674_10063731 | Ga0207674_100637312 | 114 |
| 378 | 3300026121 | Ga0207683_10340418 | Ga0207683_103404182 | 114 |
| 379 | 3300026121 | Ga0207683_10435992 | Ga0207683_104359922 | 114 |
| 380 | 3300028379 | Ga0268266_10617871 | Ga0268266_106178711 | 114 |
| 381 | 3300028381 | Ga0268264_10351629 | Ga0268264_103516292 | 114 |
| 382 | 3300035086 | Ga0373934_0004220 | Ga0373934_0004220_701_1051 | 114 |
| 383 | 3300035086 | Ga0373934_0073813 | Ga0373934_0073813_353_703 | 114 |
| 384 | 3300035089 | Ga0373944_0434048 | Ga0373944_0434048_132_485 | 114 |
| 385 | 3300035111 | Ga0373923_0089127 | Ga0373923_0089127_593_943 | 114 |
| 386 | 3300035116 | Ga0373945_0337312 | Ga0373945_0337312_66_431 | 114 |
| 387 | 3300035116 | Ga0373945_0539606 | Ga0373945_0539606_78_443 | 114 |
| 388 | 3300035117 | Ga0373953_0028711 | Ga0373953_0028711_1392_1742 | 114 |
| 389 | 3300035118 | Ga0373954_0113213 | Ga0373954_0113213_932_1282 | 114 |
| 390 | 3300035118 | Ga0373954_0220625 | Ga0373954_0220625_139_489 | 114 |
| 391 | 3300035171 | Ga0373946_0103421 | Ga0373946_0103421_908_1261 | 114 |
| 392 | 3300035171 | Ga0373946_0166072 | Ga0373946_0166072_557_922 | 114 |
| 393 | 3300035172 | Ga0373955_0043756 | Ga0373955_0043756_353_703 | 114 |
| 394 | 3300035692 | Ga0373935_0570471 | Ga0373935_0570471_17_382 | 114 |
| 395 | 3300035695 | Ga0373927_0293595 | Ga0373927_0293595_300_710 | 114 |
| 396 | 3300035695 | Ga0373927_0755681 | Ga0373927_0755681_208_573 | 114 |
| 397 | 3300035724 | Ga0373933_0016820 | Ga0373933_0016820_3139_3489 | 114 |
| 398 | 3300035724 | Ga0373933_0242982 | Ga0373933_0242982_101_451 | 114 |
| 399 | 3300035725 | Ga0373947_0750270 | Ga0373947_0750270_82_447 | 114 |
| 400 | 3300036401 | Ga0373937_0002833 | Ga0373937_0002833_2866_3216 | 114 |
| 401 | 3300036401 | Ga0373937_0050047 | Ga0373937_0050047_3390_3740 | 114 |
| 402 | 3300036401 | Ga0373937_1297583 | Ga0373937_1297583_34_399 | 114 |
| 403 | 3300046459 | Ga0495629_0175954 | Ga0495629_0175954_1055_1405 | 114 |
| 404 | 3300046459 | Ga0495629_0381033 | Ga0495629_0381033_177_542 | 114 |
| 405 | 3300046462 | Ga0495651_0072396 | Ga0495651_0072396_203_553 | 114 |
| 406 | 3300046463 | Ga0495653_0307112 | Ga0495653_0307112_42_392 | 114 |
| 407 | 3300046472 | Ga0495580_0233259 | Ga0495580_0233259_41_406 | 114 |
| 408 | 3300046473 | Ga0495582_0019687 | Ga0495582_0019687_489_842 | 114 |
| 409 | 3300046475 | Ga0495639_0072652 | Ga0495639_0072652_1012_1365 | 114 |
| 410 | 3300046475 | Ga0495639_0100685 | Ga0495639_0100685_436_801 | 114 |
| 411 | 3300046476 | Ga0495662_0612988 | Ga0495662_0612988_54_419 | 114 |
| 412 | 3300046499 | Ga0495594_0614980 | Ga0495594_0614980_10_375 | 114 |
| 413 | 3300046511 | Ga0495608_0279332 | Ga0495608_0279332_28_378 | 114 |
| 414 | 3300046526 | Ga0495666_0432519 | Ga0495666_0432519_214_567 | 114 |
| 415 | 3300046535 | Ga0495586_0022880 | Ga0495586_0022880_2353_2706 | 114 |
| 416 | 3300046535 | Ga0495586_0169935 | Ga0495586_0169935_694_1044 | 114 |
| 417 | 3300046535 | Ga0495586_0179012 | Ga0495586_0179012_311_661 | 114 |
| 418 | 3300046663 | Ga0495635_0395092 | Ga0495635_0395092_136_501 | 114 |
| 419 | 3300046681 | Ga0495647_0037515 | Ga0495647_0037515_93_458 | 114 |
| 420 | 3300046683 | Ga0495658_0012808 | Ga0495658_0012808_1491_1844 | 114 |
| 421 | 3300046684 | Ga0495669_0105525 | Ga0495669_0105525_372_755 | 114 |
| 422 | 3300046689 | Ga0495613_0064712 | Ga0495613_0064712_675_1025 | 114 |
| 423 | 3300046809 | Ga0495600_0048293 | Ga0495600_0048293_1041_1391 | 114 |
| 424 | 3300047315 | Ga0495581_0104371 | Ga0495581_0104371_1159_1512 | 114 |
| 425 | 3300047444 | Ga0495675_0234666 | Ga0495675_0234666_190_540 | 114 |
| 426 | 3300047471 | Ga0495684_0016340 | Ga0495684_0016340_1619_1969 | 114 |
| 427 | 3300048903 | Ga0496100_0098574 | Ga0496100_0098574_1019_1384 | 114 |
| 428 | 3300048904 | Ga0496101_0861616 | Ga0496101_0861616_176_538 | 114 |
| 429 | 3300048907 | Ga0496104_0737410 | Ga0496104_0737410_404_769 | 114 |
| 430 | 3300048908 | Ga0496105_0100132 | Ga0496105_0100132_1776_2141 | 114 |
| 431 | 3300048915 | Ga0496112_0831531 | Ga0496112_0831531_407_784 | 114 |
| 432 | 3300048917 | Ga0496114_0032058 | Ga0496114_0032058_3902_4267 | 114 |
| 433 | 3300050511 | nmdc:mga08y16_1147862_c1 | nmdc:mga08y16_1147862_c1_217_597 | 114 |
| 434 | 3300053084 | Ga0495595_0219930 | Ga0495595_0219930_191_556 | 114 |
| 435 | 3300053085 | Ga0495619_0726624 | Ga0495619_0726624_113_478 | 114 |
| 436 | 3300053085 | Ga0495619_0747541 | Ga0495619_0747541_289_639 | 114 |
| 437 | 3300005329 | Ga0070683_100028255 | Ga0070683_1000282556 | 115 |
| 438 | 3300005331 | Ga0070670_100033660 | Ga0070670_1000336604 | 115 |
| 439 | 3300005344 | Ga0070661_100508413 | Ga0070661_1005084131 | 115 |
| 440 | 3300005353 | Ga0070669_101865957 | Ga0070669_1018659571 | 115 |
| 441 | 3300005356 | Ga0070674_100100329 | Ga0070674_1001003294 | 115 |
| 442 | 3300005455 | Ga0070663_100930727 | Ga0070663_1009307271 | 115 |
| 443 | 3300005536 | Ga0070697_101389876 | Ga0070697_1013898762 | 115 |
| 444 | 3300005539 | Ga0068853_100094588 | Ga0068853_1000945882 | 115 |
| 445 | 3300005564 | Ga0070664_101329569 | Ga0070664_1013295692 | 115 |
| 446 | 3300005564 | Ga0070664_101669021 | Ga0070664_1016690212 | 115 |
| 447 | 3300005578 | Ga0068854_100731167 | Ga0068854_1007311672 | 115 |
| 448 | 3300005614 | Ga0068856_100012612 | Ga0068856_1000126124 | 115 |
| 449 | 3300005618 | Ga0068864_100070523 | Ga0068864_1000705234 | 115 |
| 450 | 3300005842 | Ga0068858_100137898 | Ga0068858_1001378983 | 115 |
| 451 | 3300006844 | Ga0075428_100078641 | Ga0075428_1000786412 | 115 |
| 452 | 3300006846 | Ga0075430_100005932 | Ga0075430_1000059321 | 115 |
| 453 | 3300006880 | Ga0075429_100004117 | Ga0075429_1000041178 | 115 |
| 454 | 3300009098 | Ga0105245_10030565 | Ga0105245_100305652 | 115 |
| 455 | 3300009098 | Ga0105245_10195875 | Ga0105245_101958753 | 115 |
| 456 | 3300009177 | Ga0105248_10009327 | Ga0105248_1000932710 | 115 |
| 457 | 3300009177 | Ga0105248_11917817 | Ga0105248_119178172 | 115 |
| 458 | 3300009545 | Ga0105237_10008101 | Ga0105237_100081015 | 115 |
| 459 | 3300009551 | Ga0105238_10019149 | Ga0105238_100191494 | 115 |
| 460 | 3300009553 | Ga0105249_10131545 | Ga0105249_101315453 | 115 |
| 461 | 3300010375 | Ga0105239_10035610 | Ga0105239_100356104 | 115 |
| 462 | 3300011119 | Ga0105246_10013213 | Ga0105246_100132136 | 115 |
| 463 | 3300013105 | Ga0157369_10046007 | Ga0157369_100460073 | 115 |
| 464 | 3300013296 | Ga0157374_10020255 | Ga0157374_100202557 | 115 |
| 465 | 3300013306 | Ga0163162_11822797 | Ga0163162_118227972 | 115 |
| 466 | 3300013307 | Ga0157372_10109296 | Ga0157372_101092965 | 115 |
| 467 | 3300013308 | Ga0157375_10010496 | Ga0157375_100104967 | 115 |
| 468 | 3300014325 | Ga0163163_10189969 | Ga0163163_101899694 | 115 |
| 469 | 3300014326 | Ga0157380_13422617 | Ga0157380_134226172 | 115 |
| 470 | 3300014969 | Ga0157376_10565591 | Ga0157376_105655912 | 115 |
| 471 | 3300021388 | Ga0213875_10002951 | Ga0213875_100029517 | 115 |
| 472 | 3300025893 | Ga0207682_10000492 | Ga0207682_1000049214 | 115 |
| 473 | 3300025910 | Ga0207684_10580586 | Ga0207684_105805862 | 115 |
| 474 | 3300025914 | Ga0207671_10047654 | Ga0207671_100476545 | 115 |
| 475 | 3300025920 | Ga0207649_10276575 | Ga0207649_102765752 | 115 |
| 476 | 3300025923 | Ga0207681_10636690 | Ga0207681_106366902 | 115 |
| 477 | 3300025924 | Ga0207694_10021351 | Ga0207694_100213513 | 115 |
| 478 | 3300025925 | Ga0207650_10043864 | Ga0207650_100438644 | 115 |
| 479 | 3300025927 | Ga0207687_10018973 | Ga0207687_100189736 | 115 |
| 480 | 3300025927 | Ga0207687_10118089 | Ga0207687_101180892 | 115 |
| 481 | 3300025927 | Ga0207687_11479753 | Ga0207687_114797532 | 115 |
| 482 | 3300025931 | Ga0207644_10954039 | Ga0207644_109540392 | 115 |
| 483 | 3300025941 | Ga0207711_10055719 | Ga0207711_100557193 | 115 |
| 484 | 3300025944 | Ga0207661_10076551 | Ga0207661_100765513 | 115 |
| 485 | 3300025945 | Ga0207679_11081061 | Ga0207679_110810611 | 115 |
| 486 | 3300025961 | Ga0207712_10171159 | Ga0207712_101711592 | 115 |
| 487 | 3300026035 | Ga0207703_10103737 | Ga0207703_101037373 | 115 |
| 488 | 3300026041 | Ga0207639_10507008 | Ga0207639_105070082 | 115 |
| 489 | 3300026067 | Ga0207678_11167207 | Ga0207678_111672072 | 115 |
| 490 | 3300026078 | Ga0207702_10068041 | Ga0207702_100680412 | 115 |
| 491 | 3300026095 | Ga0207676_10056606 | Ga0207676_100566064 | 115 |
| 492 | 3300026142 | Ga0207698_11102149 | Ga0207698_111021491 | 115 |
| 493 | 3300032002 | Ga0307416_102371216 | Ga0307416_1023712162 | 115 |
| 494 | 3300035725 | Ga0373947_0406951 | Ga0373947_0406951_10_369 | 115 |
| 495 | 3300037068 | Ga0373925_0017602 | Ga0373925_0017602_2014_2373 | 115 |
| 496 | 3300037068 | Ga0373925_0156497 | Ga0373925_0156497_1023_1379 | 115 |
| 497 | 3300037853 | Ga0436364_1013559 | Ga0436364_1013559_3609_3962 | 115 |
| 498 | 3300042008 | Ga0439450_069731 | Ga0439450_069731_189_572 | 115 |
| 499 | 3300046472 | Ga0495580_0012630 | Ga0495580_0012630_549_908 | 115 |
| 500 | 3300046472 | Ga0495580_0063694 | Ga0495580_0063694_1571_1927 | 115 |
| 501 | 3300048912 | Ga0496109_0092907 | Ga0496109_0092907_1048_1398 | 115 |
| 502 | 3300048915 | Ga0496112_0119803 | Ga0496112_0119803_195_545 | 115 |
| 503 | 3300048915 | Ga0496112_0879191 | Ga0496112_0879191_367_735 | 115 |
| 504 | 3300048916 | Ga0496113_0593829 | Ga0496113_0593829_375_725 | 115 |
| 505 | 3300049570 | Ga0501033_0111762 | Ga0501033_0111762_831_1187 | 115 |
| 506 | 3300049572 | Ga0501036_0024755 | Ga0501036_0024755_4471_4827 | 115 |
| 507 | 3300049573 | Ga0501037_0077754 | Ga0501037_0077754_413_769 | 115 |
| 508 | 3300049574 | Ga0501038_0086320 | Ga0501038_0086320_930_1286 | 115 |
| 509 | 3300049575 | Ga0501039_0077687 | Ga0501039_0077687_1984_2340 | 115 |
| 510 | 3300049576 | Ga0501040_0017471 | Ga0501040_0017471_778_1134 | 115 |
| 511 | 3300049582 | Ga0501048_0127837 | Ga0501048_0127837_955_1311 | 115 |
| 512 | 3300049587 | Ga0501071_0295956 | Ga0501071_0295956_110_466 | 115 |
| 513 | 3300049588 | Ga0501072_0103922 | Ga0501072_0103922_1072_1428 | 115 |
| 514 | 3300049591 | Ga0501075_0026388 | Ga0501075_0026388_1477_1833 | 115 |
| 515 | 3300049592 | Ga0501076_0000473 | Ga0501076_0000473_7973_8329 | 115 |
| 516 | 3300049593 | Ga0501077_0150936 | Ga0501077_0150936_914_1270 | 115 |
| 517 | 3300049741 | Ga0501079_0243404 | Ga0501079_0243404_36_392 | 115 |
| 518 | 3300049742 | Ga0501080_0173446 | Ga0501080_0173446_1441_1797 | 115 |
| 519 | 3300049742 | Ga0501080_1825828 | Ga0501080_1825828_19_396 | 115 |
| 520 | 3300049743 | Ga0501081_0045419 | Ga0501081_0045419_1591_1947 | 115 |
| 521 | 3300049744 | Ga0501083_0200374 | Ga0501083_0200374_162_518 | 115 |
| 522 | 3300049824 | Ga0501045_0028924 | Ga0501045_0028924_1937_2293 | 115 |
| 523 | 3300050507 | nmdc:mga05p37_188453_c1 | nmdc:mga05p37_188453_c1_1129_1512 | 115 |
| 524 | 3300050508 | nmdc:mga09592_962_c1 | nmdc:mga09592_962_c1_22089_22472 | 115 |
| 525 | 3300050509 | nmdc:mga0qj67_488_c1 | nmdc:mga0qj67_488_c1_7202_7585 | 115 |
| 526 | 3300050511 | nmdc:mga08y16_842413_c1 | nmdc:mga08y16_842413_c1_413_781 | 115 |
| 527 | 3300053104 | Ga0500556_0092711 | Ga0500556_0092711_127_489 | 115 |
| 528 | 3300054114 | Ga0501084_0115964 | Ga0501084_0115964_1781_2137 | 115 |
| 529 | 3300060353 | Ga0501082_0006280 | Ga0501082_0006280_8913_9269 | 115 |
| 530 | 3300005290 | Ga0065712_10100903 | Ga0065712_101009035 | 116 |
| 531 | 3300005331 | Ga0070670_100047539 | Ga0070670_1000475393 | 116 |
| 532 | 3300005355 | Ga0070671_101398626 | Ga0070671_1013986261 | 116 |
| 533 | 3300005365 | Ga0070688_100966812 | Ga0070688_1009668122 | 116 |
| 534 | 3300005445 | Ga0070708_101325806 | Ga0070708_1013258061 | 116 |
| 535 | 3300005544 | Ga0070686_100653260 | Ga0070686_1006532602 | 116 |
| 536 | 3300005844 | Ga0068862_101323164 | Ga0068862_1013231641 | 116 |
| 537 | 3300006844 | Ga0075428_101429223 | Ga0075428_1014292231 | 116 |
| 538 | 3300006846 | Ga0075430_100007866 | Ga0075430_1000078662 | 116 |
| 539 | 3300006846 | Ga0075430_100010875 | Ga0075430_10001087510 | 116 |
| 540 | 3300006847 | Ga0075431_100007383 | Ga0075431_1000073834 | 116 |
| 541 | 3300006847 | Ga0075431_100007549 | Ga0075431_1000075493 | 116 |
| 542 | 3300006852 | Ga0075433_11223674 | Ga0075433_112236741 | 116 |
| 543 | 3300006871 | Ga0075434_100404685 | Ga0075434_1004046852 | 116 |
| 544 | 3300006880 | Ga0075429_100115968 | Ga0075429_1001159681 | 116 |
| 545 | 3300006880 | Ga0075429_100673112 | Ga0075429_1006731122 | 116 |
| 546 | 3300006880 | Ga0075429_100810923 | Ga0075429_1008109232 | 116 |
| 547 | 3300006880 | Ga0075429_100849905 | Ga0075429_1008499052 | 116 |
| 548 | 3300009147 | Ga0114129_10003784 | Ga0114129_1000378416 | 116 |
| 549 | 3300009147 | Ga0114129_10004070 | Ga0114129_100040702 | 116 |
| 550 | 3300009147 | Ga0114129_10169582 | Ga0114129_101695824 | 116 |
| 551 | 3300009147 | Ga0114129_10608086 | Ga0114129_106080862 | 116 |
| 552 | 3300009553 | Ga0105249_10078472 | Ga0105249_100784723 | 116 |
| 553 | 3300025917 | Ga0207660_10498190 | Ga0207660_104981902 | 116 |
| 554 | 3300025935 | Ga0207709_10968970 | Ga0207709_109689701 | 116 |
| 555 | 3300025938 | Ga0207704_11222186 | Ga0207704_112221862 | 116 |
| 556 | 3300025961 | Ga0207712_10325773 | Ga0207712_103257732 | 116 |
| 557 | 3300026075 | Ga0207708_11995871 | Ga0207708_119958711 | 116 |
| 558 | 3300026118 | Ga0207675_100208446 | Ga0207675_1002084462 | 116 |
| 559 | 3300028380 | Ga0268265_11307325 | Ga0268265_113073252 | 116 |
| 560 | 3300031711 | Ga0265314_10212004 | Ga0265314_102120042 | 116 |
| 561 | 3300031731 | Ga0307405_11401870 | Ga0307405_114018701 | 116 |
| 562 | 3300032126 | Ga0307415_100390918 | Ga0307415_1003909182 | 116 |
| 563 | 3300035695 | Ga0373927_0128678 | Ga0373927_0128678_226_594 | 116 |
| 564 | 3300035724 | Ga0373933_0879503 | Ga0373933_0879503_123_491 | 116 |
| 565 | 3300036401 | Ga0373937_0052873 | Ga0373937_0052873_68_436 | 116 |
| 566 | 3300041486 | Ga0451807_2712053 | Ga0451807_2712053_10_363 | 116 |
| 567 | 3300046454 | Ga0495592_0053013 | Ga0495592_0053013_1712_2080 | 116 |
| 568 | 3300046529 | Ga0495652_0366693 | Ga0495652_0366693_129_497 | 116 |
| 569 | 3300046535 | Ga0495586_0347828 | Ga0495586_0347828_388_768 | 116 |
| 570 | 3300046536 | Ga0495587_0001781 | Ga0495587_0001781_6802_7170 | 116 |
| 571 | 3300046543 | Ga0495645_0098410 | Ga0495645_0098410_450_818 | 116 |
| 572 | 3300046642 | Ga0495634_0176715 | Ga0495634_0176715_172_552 | 116 |
| 573 | 3300046683 | Ga0495658_0441712 | Ga0495658_0441712_36_386 | 116 |
| 574 | 3300046689 | Ga0495613_0242398 | Ga0495613_0242398_341_691 | 116 |
| 575 | 3300048907 | Ga0496104_0848973 | Ga0496104_0848973_64_432 | 116 |
| 576 | 3300048912 | Ga0496109_1870359 | Ga0496109_1870359_24_374 | 116 |
| 577 | 3300048913 | Ga0496110_1233961 | Ga0496110_1233961_91_459 | 116 |
| 578 | 3300048914 | Ga0496111_0960843 | Ga0496111_0960843_43_396 | 116 |
| 579 | 3300049572 | Ga0501036_1355123 | Ga0501036_1355123_145_513 | 116 |
| 580 | 3300049575 | Ga0501039_0218043 | Ga0501039_0218043_788_1156 | 116 |
| 581 | 3300049577 | Ga0501041_0038116 | Ga0501041_0038116_901_1269 | 116 |
| 582 | 3300049578 | Ga0501042_0131831 | Ga0501042_0131831_1097_1465 | 116 |
| 583 | 3300049580 | Ga0501046_0073723 | Ga0501046_0073723_1185_1553 | 116 |
| 584 | 3300049584 | Ga0501068_0385253 | Ga0501068_0385253_47_415 | 116 |
| 585 | 3300049587 | Ga0501071_0009788 | Ga0501071_0009788_2075_2443 | 116 |
| 586 | 3300049587 | Ga0501071_0856440 | Ga0501071_0856440_230_586 | 116 |
| 587 | 3300049588 | Ga0501072_0083258 | Ga0501072_0083258_639_1007 | 116 |
| 588 | 3300049591 | Ga0501075_1189946 | Ga0501075_1189946_102_470 | 116 |
| 589 | 3300049592 | Ga0501076_0114613 | Ga0501076_0114613_720_1088 | 116 |
| 590 | 3300049741 | Ga0501079_1555058 | Ga0501079_1555058_32_388 | 116 |
| 591 | 3300049824 | Ga0501045_0945660 | Ga0501045_0945660_210_593 | 116 |
| 592 | 3300050507 | nmdc:mga05p37_1198508_c1 | nmdc:mga05p37_1198508_c1_259_618 | 116 |
| 593 | 3300050507 | nmdc:mga05p37_1622571_c1 | nmdc:mga05p37_1622571_c1_193_555 | 116 |
| 594 | 3300050507 | nmdc:mga05p37_177038_c1 | nmdc:mga05p37_177038_c1_2086_2469 | 116 |
| 595 | 3300050507 | nmdc:mga05p37_25424_c1 | nmdc:mga05p37_25424_c1_2856_3221 | 116 |
| 596 | 3300050508 | nmdc:mga09592_685558_c1 | nmdc:mga09592_685558_c1_291_656 | 116 |
| 597 | 3300050508 | nmdc:mga09592_841214_c1 | nmdc:mga09592_841214_c1_270_629 | 116 |
| 598 | 3300050508 | nmdc:mga09592_85652_c1 | nmdc:mga09592_85652_c1_1758_2123 | 116 |
| 599 | 3300050509 | nmdc:mga0qj67_25428_c1 | nmdc:mga0qj67_25428_c1_2905_3270 | 116 |
| 600 | 3300050509 | nmdc:mga0qj67_339222_c1 | nmdc:mga0qj67_339222_c1_652_1017 | 116 |
| 601 | 3300050509 | nmdc:mga0qj67_659271_c1 | nmdc:mga0qj67_659271_c1_365_730 | 116 |
| 602 | 3300050510 | nmdc:mga06r32_202080_c1 | nmdc:mga06r32_202080_c1_350_715 | 116 |
| 603 | 3300050510 | nmdc:mga06r32_222071_c1 | nmdc:mga06r32_222071_c1_802_1167 | 116 |
| 604 | 3300050510 | nmdc:mga06r32_436632_c1 | nmdc:mga06r32_436632_c1_97_462 | 116 |
| 605 | 3300050510 | nmdc:mga06r32_569319_c1 | nmdc:mga06r32_569319_c1_425_784 | 116 |
| 606 | 3300050515 | nmdc:mga0a205_1111194_c1 | nmdc:mga0a205_1111194_c1_118_501 | 116 |
| 607 | 3300053085 | Ga0495619_0189657 | Ga0495619_0189657_343_693 | 116 |
| 608 | 3300054114 | Ga0501084_0088650 | Ga0501084_0088650_673_1041 | 116 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4lb5-assembly1.cif.gz_A-2 | crystal structure of pkz zalpha in complex with ds(cg)6 (hexagonal form) | 0.9177 | 17 | 71 |
| 5zuo-assembly1.cif.gz_A | crystal structure of bz junction in diverse sequence | 0.9177 | 28 | 71 |
| 2mh2-assembly1.cif.gz_A | structural insights into the dna recognition and protein interaction domains reveal fundamental homologous dna pairing properties of hop2 | 0.903 | 18 | 71 |
| 2k4b-assembly1.cif.gz_A | copr repressor structure | 0.8933 | 18 | 71 |
| 7ne9-assembly1.cif.gz_DDD | a single sensor controls large variations in zinc quotas in a marine cyanobacterium | 0.8902 | 12 | 70 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1saxB01 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9303 | 17 | 71 | 1.10.10.10 |
| 1sd6A01 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9281 | 12 | 71 | 1.10.10.10 |
| af_Q58793_245_317_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.924 | 7 | 70 | 1.10.10.10 |
| 5zuoA00 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9177 | 28 | 71 | 1.10.10.10 |
| 4lb5A00 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9177 | 17 | 71 | 1.10.10.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7C3DR54-F1-model_v4 | ArsR family transcriptional regulator | 0.9815 | 5 | 75 |
GO:0003700
|
| AF-A0A812QMK9-F1-model_v4 | deleted | 0.9763 | 5 | 104 |
|
| AF-A0A532DH07-F1-model_v4 | Helix-turn-helix transcriptional regulator | 0.959 | 5 | 78 |
GO:0003700
|
| AF-M6KC98-F1-model_v4 | DNA-binding helix-turn-helix protein | 0.956 | 5 | 71 |
GO:0003677
GO:0003700 |
| AF-A0A2Z3HKI1-F1-model_v4 | ArsR family transcriptional regulator | 0.9544 | 4 | 71 |
GO:0003700
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar