F468604
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 606 | 295 | 606 | 328 |
Family's Representative Sequence
| Representative Sequence | 3300028380|Ga0268265_10497791|Ga0268265_104977911 |
| Length | 359 |
| Sequence | MTTAAPLEVRSLTKRFQLGTGVRRAHVHAVDDVSFELRPGTITALVGESGSGKSTVARLLAHLSEPSEGEVLFEGSDVSHVRRRRDVLRYRSQVQIIFQDPFSSLNPVKTVRHHVERPLRIHKIVPSRQVEQRVHELLRTVGLVPPEDIAAKYPHELSGGQRQRVAIARALAVEPKVVLADEPISMLDVSIRIGILNLMSKLKEEHGIAFLYVTHDLASARYVADDILVMYAGQIVERGPIEDVLAAPLHPYTRLLLDAVPDPATKTEAQQIELRKSDASAAVDPTEGCRFRARCPLAIEVCSQITPTLVEASPRQAARCHVTAEMGVSELDATVAGVHTLLRRLASRGDTELKPALAR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 2 | 3300001978 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 | Metagenome | Rhizosphere |
| 3 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 4 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 5 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 6 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 7 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 8 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 9 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 10 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 11 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 14 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 16 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 18 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 20 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 28 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 40 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 43 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 45 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 53 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 55 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 56 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 58 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 59 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 60 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 61 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 62 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 63 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 64 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 65 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 66 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 67 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 68 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 69 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 71 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 72 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 73 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 74 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 75 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 77 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 78 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 79 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 80 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 81 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 82 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 83 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 84 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 85 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 87 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 115 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300027252 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300027552 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 188 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 192 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 193 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 194 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 195 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 196 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 197 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 198 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 199 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 200 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 201 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 202 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 203 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 204 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 205 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 206 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 207 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 208 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 209 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 210 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 211 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 212 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 213 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 214 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 215 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 216 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 217 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 218 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 219 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 220 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 221 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 222 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 223 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 224 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 225 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 226 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 259 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 260 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 261 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 262 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 263 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 264 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 265 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 266 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 267 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 268 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 269 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 270 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 271 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 272 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 273 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 274 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 275 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 276 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 277 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 278 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 279 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 280 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 281 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 282 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 283 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 284 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 285 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 286 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 287 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 288 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 289 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 290 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 291 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 294 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 295 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.33 |
| Nodule | 0 |
| Rhizoplane | 14.36 |
| Rhizosphere | 85.31 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24746J21847_1000628 | 3300001977 | Bacteria | 5399 |
| 2 | JGI24747J21853_1000115 | 3300001978 | Bacteria | 3682 |
| 3 | JGI24747J21853_1000673 | 3300001978 | Bacteria | 2264 |
| 4 | JGI24737J22298_10040617 | 3300001990 | Bacteria | 1427 |
| 5 | JGI24750J21931_1001624 | 3300002070 | Bacteria | 2762 |
| 6 | JGI24745J21846_1000282 | 3300002073 | Bacteria | 4315 |
| 7 | JGI24738J21930_10000115 | 3300002075 | Bacteria | 18938 |
| 8 | JGI24749J21850_1002054 | 3300002076 | Bacteria | 2844 |
| 9 | JGI24744J21845_10000862 | 3300002077 | Bacteria | 5731 |
| 10 | JGI24034J26672_10009253 | 3300002239 | Bacteria | 1450 |
| 11 | JGI24742J22300_10005553 | 3300002244 | Bacteria | 2072 |
| 12 | Ga0070676_10007560 | 3300005328 | Bacteria | 5837 |
| 13 | Ga0070683_100004388 | 3300005329 | Bacteria | 11609 |
| 14 | Ga0070683_100005135 | 3300005329 | Bacteria | 10887 |
| 15 | Ga0070683_100014617 | 3300005329 | Bacteria | 6874 |
| 16 | Ga0070683_100172134 | 3300005329 | Bacteria | 2055 |
| 17 | Ga0070690_100027735 | 3300005330 | Bacteria | 3502 |
| 18 | Ga0070670_100004139 | 3300005331 | Bacteria | 12123 |
| 19 | Ga0068869_100003359 | 3300005334 | Bacteria | 9771 |
| 20 | Ga0068869_100335283 | 3300005334 | Bacteria | 1230 |
| 21 | Ga0070682_100005430 | 3300005337 | Bacteria | 7101 |
| 22 | Ga0070682_100007259 | 3300005337 | Bacteria | 6246 |
| 23 | Ga0068868_100001391 | 3300005338 | Bacteria | 16682 |
| 24 | Ga0068868_100075068 | 3300005338 | Bacteria | 2701 |
| 25 | Ga0068868_100117079 | 3300005338 | Bacteria | 2171 |
| 26 | Ga0068868_100127166 | 3300005338 | Bacteria | 2083 |
| 27 | Ga0070660_100005269 | 3300005339 | Bacteria | 8940 |
| 28 | Ga0070660_100010779 | 3300005339 | Bacteria | 6470 |
| 29 | Ga0070689_100004949 | 3300005340 | Bacteria | 9043 |
| 30 | Ga0070689_100223482 | 3300005340 | Bacteria | 1545 |
| 31 | Ga0070687_100000229 | 3300005343 | Bacteria | 19233 |
| 32 | Ga0070661_100000590 | 3300005344 | Bacteria | 27434 |
| 33 | Ga0070692_10003402 | 3300005345 | Bacteria | 6450 |
| 34 | Ga0070692_10006536 | 3300005345 | Bacteria | 5069 |
| 35 | Ga0070668_100021641 | 3300005347 | Bacteria | 4858 |
| 36 | Ga0070668_100030539 | 3300005347 | Bacteria | 4097 |
| 37 | Ga0070668_100130769 | 3300005347 | Bacteria | 2015 |
| 38 | Ga0070671_100007239 | 3300005355 | Bacteria | 8872 |
| 39 | Ga0070671_100043679 | 3300005355 | Bacteria | 3725 |
| 40 | Ga0070674_100009442 | 3300005356 | Bacteria | 5841 |
| 41 | Ga0070674_100083116 | 3300005356 | Bacteria | 2292 |
| 42 | Ga0070673_100000944 | 3300005364 | Bacteria | 16453 |
| 43 | Ga0070673_100096799 | 3300005364 | Bacteria | 2423 |
| 44 | Ga0070673_100204864 | 3300005364 | Bacteria | 1700 |
| 45 | Ga0070688_100000244 | 3300005365 | Bacteria | 28822 |
| 46 | Ga0070688_100018307 | 3300005365 | Bacteria | 4040 |
| 47 | Ga0070688_100071942 | 3300005365 | Bacteria | 2215 |
| 48 | Ga0070688_100117118 | 3300005365 | Bacteria | 1779 |
| 49 | Ga0070659_100008419 | 3300005366 | Bacteria | 7533 |
| 50 | Ga0070659_100271738 | 3300005366 | Bacteria | 1409 |
| 51 | Ga0070703_10002303 | 3300005406 | Bacteria | 5525 |
| 52 | Ga0070714_100006112 | 3300005435 | Bacteria | 9252 |
| 53 | Ga0070714_100037937 | 3300005435 | Bacteria | 4052 |
| 54 | Ga0070714_100122279 | 3300005435 | Bacteria | 2316 |
| 55 | Ga0070713_100003728 | 3300005436 | Bacteria | 10089 |
| 56 | Ga0070713_100004726 | 3300005436 | Bacteria | 9206 |
| 57 | Ga0070710_10001039 | 3300005437 | Bacteria | 13184 |
| 58 | Ga0070710_10001523 | 3300005437 | Bacteria | 10945 |
| 59 | Ga0070701_10000326 | 3300005438 | Bacteria | 15682 |
| 60 | Ga0070701_10003880 | 3300005438 | Bacteria | 5971 |
| 61 | Ga0070705_100009155 | 3300005440 | Bacteria | 4914 |
| 62 | Ga0070700_100004636 | 3300005441 | Bacteria | 7201 |
| 63 | Ga0070700_100066424 | 3300005441 | Bacteria | 2289 |
| 64 | Ga0070694_100001729 | 3300005444 | Bacteria | 12874 |
| 65 | Ga0070694_100004742 | 3300005444 | Bacteria | 8187 |
| 66 | Ga0070663_100009511 | 3300005455 | Bacteria | 6022 |
| 67 | Ga0070663_100042870 | 3300005455 | Bacteria | 3182 |
| 68 | Ga0070678_100007296 | 3300005456 | Bacteria | 6546 |
| 69 | Ga0070678_100159517 | 3300005456 | Bacteria | 1826 |
| 70 | Ga0068867_100005224 | 3300005459 | Bacteria | 9164 |
| 71 | Ga0068867_100008148 | 3300005459 | Bacteria | 7405 |
| 72 | Ga0070685_10014939 | 3300005466 | Bacteria | 4120 |
| 73 | Ga0070685_10111282 | 3300005466 | Bacteria | 1687 |
| 74 | Ga0070685_10125790 | 3300005466 | Bacteria | 1597 |
| 75 | Ga0070698_100225867 | 3300005471 | Bacteria | 1806 |
| 76 | Ga0070679_100076305 | 3300005530 | Bacteria | 3342 |
| 77 | Ga0070679_100079855 | 3300005530 | Bacteria | 3261 |
| 78 | Ga0070684_100000278 | 3300005535 | Bacteria | 35483 |
| 79 | Ga0070684_100005865 | 3300005535 | Bacteria | 9454 |
| 80 | Ga0070684_100006983 | 3300005535 | Bacteria | 8769 |
| 81 | Ga0070684_100010109 | 3300005535 | Bacteria | 7463 |
| 82 | Ga0068853_100011556 | 3300005539 | Bacteria | 7177 |
| 83 | Ga0068853_100020179 | 3300005539 | Bacteria | 5540 |
| 84 | Ga0070672_100092698 | 3300005543 | Bacteria | 2439 |
| 85 | Ga0070686_100004116 | 3300005544 | Bacteria | 8005 |
| 86 | Ga0070686_100010757 | 3300005544 | Bacteria | 5172 |
| 87 | Ga0070686_100042116 | 3300005544 | Bacteria | 2858 |
| 88 | Ga0070695_100003280 | 3300005545 | Bacteria | 9454 |
| 89 | Ga0070695_100086344 | 3300005545 | Bacteria | 2085 |
| 90 | Ga0070696_100094705 | 3300005546 | Bacteria | 2131 |
| 91 | Ga0070693_100006632 | 3300005547 | Bacteria | 5619 |
| 92 | Ga0070693_100077900 | 3300005547 | Bacteria | 1969 |
| 93 | Ga0070665_100102764 | 3300005548 | Bacteria | 2862 |
| 94 | Ga0070665_100110056 | 3300005548 | Bacteria | 2757 |
| 95 | Ga0070665_100222123 | 3300005548 | Bacteria | 1889 |
| 96 | Ga0070704_100000158 | 3300005549 | Bacteria | 26451 |
| 97 | Ga0070704_100023010 | 3300005549 | Bacteria | 4062 |
| 98 | Ga0070704_100172513 | 3300005549 | Bacteria | 1721 |
| 99 | Ga0068855_100015776 | 3300005563 | Bacteria | 9089 |
| 100 | Ga0068855_100021021 | 3300005563 | Bacteria | 7825 |
| 101 | Ga0068855_100026022 | 3300005563 | Bacteria | 6999 |
| 102 | Ga0070664_100024670 | 3300005564 | Bacteria | 4977 |
| 103 | Ga0070664_100036570 | 3300005564 | Bacteria | 4125 |
| 104 | Ga0068857_100000596 | 3300005577 | Bacteria | 26505 |
| 105 | Ga0068856_100026039 | 3300005614 | Bacteria | 5705 |
| 106 | Ga0070702_100000280 | 3300005615 | Bacteria | 17417 |
| 107 | Ga0070702_100001320 | 3300005615 | Bacteria | 10049 |
| 108 | Ga0070702_100085068 | 3300005615 | Bacteria | 1903 |
| 109 | Ga0070702_100122162 | 3300005615 | Bacteria | 1632 |
| 110 | Ga0070702_100196790 | 3300005615 | Bacteria | 1331 |
| 111 | Ga0068852_100016395 | 3300005616 | Bacteria | 5776 |
| 112 | Ga0068859_100002498 | 3300005617 | Bacteria | 18699 |
| 113 | Ga0068859_100183929 | 3300005617 | Bacteria | 2173 |
| 114 | Ga0068864_100000140 | 3300005618 | Bacteria | 69827 |
| 115 | Ga0068864_100152508 | 3300005618 | Bacteria | 2094 |
| 116 | Ga0068864_100372373 | 3300005618 | Bacteria | 1352 |
| 117 | Ga0068864_100485129 | 3300005618 | Bacteria | 1187 |
| 118 | Ga0068866_10002156 | 3300005718 | Bacteria | 8196 |
| 119 | Ga0068866_10060060 | 3300005718 | Bacteria | 1969 |
| 120 | Ga0068861_100001125 | 3300005719 | Bacteria | 16597 |
| 121 | Ga0068861_100168168 | 3300005719 | Bacteria | 1815 |
| 122 | Ga0068870_10000135 | 3300005840 | Bacteria | 25577 |
| 123 | Ga0068863_100018428 | 3300005841 | Bacteria | 6681 |
| 124 | Ga0068863_100054410 | 3300005841 | Bacteria | 3792 |
| 125 | Ga0068860_100003390 | 3300005843 | Bacteria | 16396 |
| 126 | Ga0068860_100069743 | 3300005843 | Bacteria | 3342 |
| 127 | Ga0068860_100209682 | 3300005843 | Bacteria | 1890 |
| 128 | Ga0068862_100004234 | 3300005844 | Bacteria | 12156 |
| 129 | Ga0081455_10000091 | 3300005937 | Bacteria | 97617 |
| 130 | Ga0081455_10003576 | 3300005937 | Bacteria | 17837 |
| 131 | Ga0081455_10232370 | 3300005937 | Bacteria | 1360 |
| 132 | Ga0081540_1001344 | 3300005983 | Bacteria | 21413 |
| 133 | Ga0081540_1031742 | 3300005983 | Bacteria | 2896 |
| 134 | Ga0081539_10080617 | 3300005985 | Bacteria | 1712 |
| 135 | Ga0070717_10016472 | 3300006028 | Bacteria | 5731 |
| 136 | Ga0070717_10022083 | 3300006028 | Bacteria | 5024 |
| 137 | Ga0070717_10571144 | 3300006028 | Bacteria | 1025 |
| 138 | Ga0075365_10075304 | 3300006038 | Bacteria | 2278 |
| 139 | Ga0075432_10011193 | 3300006058 | Bacteria | 3048 |
| 140 | Ga0070715_10041429 | 3300006163 | Bacteria | 1930 |
| 141 | Ga0070716_100232448 | 3300006173 | Bacteria | 1245 |
| 142 | Ga0070712_100021015 | 3300006175 | Bacteria | 4280 |
| 143 | Ga0070712_100031765 | 3300006175 | Bacteria | 3560 |
| 144 | Ga0070712_100180225 | 3300006175 | Bacteria | 1645 |
| 145 | Ga0070712_100376533 | 3300006175 | Bacteria | 1168 |
| 146 | Ga0097621_100004183 | 3300006237 | Bacteria | 10013 |
| 147 | Ga0068871_100001664 | 3300006358 | Bacteria | 14947 |
| 148 | Ga0068871_100104557 | 3300006358 | Bacteria | 2375 |
| 149 | Ga0068871_100435660 | 3300006358 | Bacteria | 1173 |
| 150 | Ga0075428_100001400 | 3300006844 | Bacteria | 25647 |
| 151 | Ga0075430_100001022 | 3300006846 | Bacteria | 22142 |
| 152 | Ga0075431_100188006 | 3300006847 | Bacteria | 2117 |
| 153 | Ga0075433_10002104 | 3300006852 | Bacteria | 15091 |
| 154 | Ga0075433_10002835 | 3300006852 | Bacteria | 13271 |
| 155 | Ga0075433_10003427 | 3300006852 | Bacteria | 12228 |
| 156 | Ga0075433_10058778 | 3300006852 | Bacteria | 3364 |
| 157 | Ga0075434_100001215 | 3300006871 | Bacteria | 21397 |
| 158 | Ga0075434_100004190 | 3300006871 | Bacteria | 12921 |
| 159 | Ga0075434_100085660 | 3300006871 | Bacteria | 3151 |
| 160 | Ga0075429_100000941 | 3300006880 | Bacteria | 23046 |
| 161 | Ga0068865_100001838 | 3300006881 | Bacteria | 12466 |
| 162 | Ga0068865_100009549 | 3300006881 | Bacteria | 6022 |
| 163 | Ga0068865_100246705 | 3300006881 | Bacteria | 1407 |
| 164 | Ga0068865_100466068 | 3300006881 | Bacteria | 1047 |
| 165 | Ga0075436_100000785 | 3300006914 | Bacteria | 21078 |
| 166 | Ga0097620_100002498 | 3300006931 | Bacteria | 18699 |
| 167 | Ga0097620_100183938 | 3300006931 | Bacteria | 2173 |
| 168 | Ga0075435_100001483 | 3300007076 | Bacteria | 15080 |
| 169 | Ga0075435_100016572 | 3300007076 | Bacteria | 5558 |
| 170 | Ga0075435_100016976 | 3300007076 | Bacteria | 5498 |
| 171 | Ga0075435_100057327 | 3300007076 | Bacteria | 3151 |
| 172 | Ga0075435_100086912 | 3300007076 | Bacteria | 2575 |
| 173 | Ga0105251_10012354 | 3300009011 | Bacteria | 4834 |
| 174 | Ga0105250_10009975 | 3300009092 | Bacteria | 3977 |
| 175 | Ga0105240_10064357 | 3300009093 | Bacteria | 4557 |
| 176 | Ga0111539_10001115 | 3300009094 | Bacteria | 35484 |
| 177 | Ga0105245_10001824 | 3300009098 | Bacteria | 19388 |
| 178 | Ga0105245_10013551 | 3300009098 | Bacteria | 7101 |
| 179 | Ga0105247_10028201 | 3300009101 | Bacteria | 3397 |
| 180 | Ga0105247_10073089 | 3300009101 | Bacteria | 2148 |
| 181 | Ga0114129_10001230 | 3300009147 | Bacteria | 34074 |
| 182 | Ga0114129_10005318 | 3300009147 | Bacteria | 18171 |
| 183 | Ga0114129_10005599 | 3300009147 | Bacteria | 17775 |
| 184 | Ga0114129_10131109 | 3300009147 | Bacteria | 3442 |
| 185 | Ga0105243_10001397 | 3300009148 | Bacteria | 21344 |
| 186 | Ga0105243_10205065 | 3300009148 | Bacteria | 1732 |
| 187 | Ga0105241_10000586 | 3300009174 | Bacteria | 27472 |
| 188 | Ga0105242_10001675 | 3300009176 | Bacteria | 17533 |
| 189 | Ga0105242_10039377 | 3300009176 | Bacteria | 3804 |
| 190 | Ga0105248_10021456 | 3300009177 | Bacteria | 7153 |
| 191 | Ga0105248_10048114 | 3300009177 | Bacteria | 4783 |
| 192 | Ga0105248_10263335 | 3300009177 | Bacteria | 1941 |
| 193 | Ga0105237_10041507 | 3300009545 | Bacteria | 4639 |
| 194 | Ga0105238_10045650 | 3300009551 | Bacteria | 4426 |
| 195 | Ga0105238_10096336 | 3300009551 | Bacteria | 2945 |
| 196 | Ga0105238_10411241 | 3300009551 | Bacteria | 1347 |
| 197 | Ga0105249_10001526 | 3300009553 | Bacteria | 20306 |
| 198 | Ga0105249_10001802 | 3300009553 | Bacteria | 18618 |
| 199 | Ga0105249_10180693 | 3300009553 | Bacteria | 2052 |
| 200 | Ga0105239_10004973 | 3300010375 | Bacteria | 15695 |
| 201 | Ga0105239_10040455 | 3300010375 | Bacteria | 5107 |
| 202 | Ga0105239_10045367 | 3300010375 | Bacteria | 4817 |
| 203 | Ga0105246_10003116 | 3300011119 | Bacteria | 10069 |
| 204 | Ga0157373_10001384 | 3300013100 | Bacteria | 18594 |
| 205 | Ga0157371_10016190 | 3300013102 | Bacteria | 5571 |
| 206 | Ga0157370_10254199 | 3300013104 | Bacteria | 1625 |
| 207 | Ga0157369_10122789 | 3300013105 | Bacteria | 2755 |
| 208 | Ga0157374_10003666 | 3300013296 | Bacteria | 12912 |
| 209 | Ga0157374_10006362 | 3300013296 | Bacteria | 10021 |
| 210 | Ga0157374_10093346 | 3300013296 | Bacteria | 2873 |
| 211 | Ga0157378_10002087 | 3300013297 | Bacteria | 17868 |
| 212 | Ga0157378_10030426 | 3300013297 | Bacteria | 4770 |
| 213 | Ga0157378_10072592 | 3300013297 | Bacteria | 3092 |
| 214 | Ga0157378_10469481 | 3300013297 | Bacteria | 1252 |
| 215 | Ga0163162_10003585 | 3300013306 | Bacteria | 14856 |
| 216 | Ga0163162_10014349 | 3300013306 | Bacteria | 7742 |
| 217 | Ga0163162_10376955 | 3300013306 | Bacteria | 1552 |
| 218 | Ga0163162_10402907 | 3300013306 | Bacteria | 1501 |
| 219 | Ga0157372_10003728 | 3300013307 | Bacteria | 16364 |
| 220 | Ga0157375_10004460 | 3300013308 | Bacteria | 12156 |
| 221 | Ga0157375_10136062 | 3300013308 | Bacteria | 2581 |
| 222 | Ga0157375_10420337 | 3300013308 | Bacteria | 1503 |
| 223 | Ga0163163_10006523 | 3300014325 | Bacteria | 10214 |
| 224 | Ga0163163_10307800 | 3300014325 | Bacteria | 1637 |
| 225 | Ga0157380_10005060 | 3300014326 | Bacteria | 9202 |
| 226 | Ga0157380_10024103 | 3300014326 | Bacteria | 4600 |
| 227 | Ga0182008_10027678 | 3300014497 | Bacteria | 2869 |
| 228 | Ga0157377_10000449 | 3300014745 | Bacteria | 17724 |
| 229 | Ga0157377_10281712 | 3300014745 | Bacteria | 1090 |
| 230 | Ga0157379_10002609 | 3300014968 | Bacteria | 15148 |
| 231 | Ga0157379_10144179 | 3300014968 | Bacteria | 2148 |
| 232 | Ga0157379_10160943 | 3300014968 | Bacteria | 2026 |
| 233 | Ga0157376_10060228 | 3300014969 | Bacteria | 3187 |
| 234 | Ga0157376_10110532 | 3300014969 | Bacteria | 2418 |
| 235 | Ga0207666_1000053 | 3300025271 | Bacteria | 20633 |
| 236 | Ga0207673_1000140 | 3300025290 | Bacteria | 6977 |
| 237 | Ga0207697_10000314 | 3300025315 | Bacteria | 27127 |
| 238 | Ga0207653_10002698 | 3300025885 | Bacteria | 5638 |
| 239 | Ga0207682_10000104 | 3300025893 | Bacteria | 38531 |
| 240 | Ga0207692_10001611 | 3300025898 | Bacteria | 8502 |
| 241 | Ga0207692_10016066 | 3300025898 | Bacteria | 3305 |
| 242 | Ga0207642_10004154 | 3300025899 | Bacteria | 4650 |
| 243 | Ga0207642_10182659 | 3300025899 | Bacteria | 1144 |
| 244 | Ga0207710_10001384 | 3300025900 | Bacteria | 12153 |
| 245 | Ga0207710_10011813 | 3300025900 | Bacteria | 3673 |
| 246 | Ga0207688_10000236 | 3300025901 | Bacteria | 25129 |
| 247 | Ga0207647_10002772 | 3300025904 | Bacteria | 13221 |
| 248 | Ga0207647_10020705 | 3300025904 | Bacteria | 4406 |
| 249 | Ga0207699_10005502 | 3300025906 | Bacteria | 6068 |
| 250 | Ga0207699_10016465 | 3300025906 | Bacteria | 3869 |
| 251 | Ga0207645_10001219 | 3300025907 | Bacteria | 21210 |
| 252 | Ga0207645_10030804 | 3300025907 | Bacteria | 3457 |
| 253 | Ga0207643_10000035 | 3300025908 | Bacteria | 90905 |
| 254 | Ga0207643_10024559 | 3300025908 | Bacteria | 3326 |
| 255 | Ga0207654_10055610 | 3300025911 | Bacteria | 2292 |
| 256 | Ga0207707_10005181 | 3300025912 | Bacteria | 11427 |
| 257 | Ga0207695_10122946 | 3300025913 | Bacteria | 2561 |
| 258 | Ga0207671_10165585 | 3300025914 | Bacteria | 1714 |
| 259 | Ga0207693_10003111 | 3300025915 | Bacteria | 14278 |
| 260 | Ga0207693_10084222 | 3300025915 | Bacteria | 2491 |
| 261 | Ga0207693_10213278 | 3300025915 | Bacteria | 1517 |
| 262 | Ga0207663_10055590 | 3300025916 | Bacteria | 2484 |
| 263 | Ga0207663_10071431 | 3300025916 | Bacteria | 2240 |
| 264 | Ga0207660_10001787 | 3300025917 | Bacteria | 14363 |
| 265 | Ga0207662_10000401 | 3300025918 | Bacteria | 19287 |
| 266 | Ga0207657_10001276 | 3300025919 | Bacteria | 26816 |
| 267 | Ga0207657_10002085 | 3300025919 | Bacteria | 21637 |
| 268 | Ga0207657_10041809 | 3300025919 | Bacteria | 4050 |
| 269 | Ga0207649_10000309 | 3300025920 | Bacteria | 37243 |
| 270 | Ga0207652_10003742 | 3300025921 | Bacteria | 12479 |
| 271 | Ga0207652_10045624 | 3300025921 | Bacteria | 3737 |
| 272 | Ga0207652_10056662 | 3300025921 | Bacteria | 3374 |
| 273 | Ga0207652_10185463 | 3300025921 | Bacteria | 1871 |
| 274 | Ga0207646_10182242 | 3300025922 | Bacteria | 1897 |
| 275 | Ga0207681_10002035 | 3300025923 | Bacteria | 12973 |
| 276 | Ga0207694_10065048 | 3300025924 | Bacteria | 2843 |
| 277 | Ga0207650_10045783 | 3300025925 | Bacteria | 3219 |
| 278 | Ga0207659_10000633 | 3300025926 | Bacteria | 20867 |
| 279 | Ga0207687_10000959 | 3300025927 | Bacteria | 19627 |
| 280 | Ga0207687_10105437 | 3300025927 | Bacteria | 2083 |
| 281 | Ga0207687_10220570 | 3300025927 | Bacteria | 1493 |
| 282 | Ga0207700_10000001 | 3300025928 | Bacteria | 1122509 |
| 283 | Ga0207700_10011701 | 3300025928 | Bacteria | 5611 |
| 284 | Ga0207664_10011969 | 3300025929 | Bacteria | 6194 |
| 285 | Ga0207644_10002922 | 3300025931 | Bacteria | 11009 |
| 286 | Ga0207644_10006179 | 3300025931 | Bacteria | 7809 |
| 287 | Ga0207644_10033856 | 3300025931 | Bacteria | 3573 |
| 288 | Ga0207644_10073756 | 3300025931 | Bacteria | 2503 |
| 289 | Ga0207690_10010832 | 3300025932 | Bacteria | 5434 |
| 290 | Ga0207690_10170454 | 3300025932 | Bacteria | 1630 |
| 291 | Ga0207706_10004534 | 3300025933 | Bacteria | 13034 |
| 292 | Ga0207686_10001230 | 3300025934 | Bacteria | 14841 |
| 293 | Ga0207686_10015044 | 3300025934 | Bacteria | 4318 |
| 294 | Ga0207686_10028894 | 3300025934 | Bacteria | 3264 |
| 295 | Ga0207709_10035428 | 3300025935 | Bacteria | 2950 |
| 296 | Ga0207709_10041155 | 3300025935 | Bacteria | 2772 |
| 297 | Ga0207670_10002361 | 3300025936 | Bacteria | 9889 |
| 298 | Ga0207670_10101397 | 3300025936 | Bacteria | 2056 |
| 299 | Ga0207670_10380160 | 3300025936 | Bacteria | 1125 |
| 300 | Ga0207669_10000340 | 3300025937 | Bacteria | 21244 |
| 301 | Ga0207669_10050346 | 3300025937 | Bacteria | 2489 |
| 302 | Ga0207704_10004184 | 3300025938 | Bacteria | 6589 |
| 303 | Ga0207704_10096173 | 3300025938 | Bacteria | 1960 |
| 304 | Ga0207665_10001875 | 3300025939 | Bacteria | 14170 |
| 305 | Ga0207691_10001336 | 3300025940 | Bacteria | 24608 |
| 306 | Ga0207691_10097690 | 3300025940 | Bacteria | 2624 |
| 307 | Ga0207711_10004667 | 3300025941 | Bacteria | 11635 |
| 308 | Ga0207711_10064405 | 3300025941 | Bacteria | 3166 |
| 309 | Ga0207711_10086673 | 3300025941 | Bacteria | 2746 |
| 310 | Ga0207689_10000168 | 3300025942 | Bacteria | 57089 |
| 311 | Ga0207689_10083231 | 3300025942 | Bacteria | 2631 |
| 312 | Ga0207661_10001339 | 3300025944 | Bacteria | 16526 |
| 313 | Ga0207661_10007085 | 3300025944 | Bacteria | 7965 |
| 314 | Ga0207661_10007905 | 3300025944 | Bacteria | 7582 |
| 315 | Ga0207661_10010717 | 3300025944 | Bacteria | 6607 |
| 316 | Ga0207679_10000035 | 3300025945 | Bacteria | 144173 |
| 317 | Ga0207679_10039273 | 3300025945 | Bacteria | 3379 |
| 318 | Ga0207679_10164432 | 3300025945 | Bacteria | 1820 |
| 319 | Ga0207679_10243865 | 3300025945 | Bacteria | 1524 |
| 320 | Ga0207667_10006315 | 3300025949 | Bacteria | 14372 |
| 321 | Ga0207651_10000233 | 3300025960 | Bacteria | 24032 |
| 322 | Ga0207651_10210410 | 3300025960 | Bacteria | 1565 |
| 323 | Ga0207712_10007633 | 3300025961 | Bacteria | 6838 |
| 324 | Ga0207668_10001502 | 3300025972 | Bacteria | 13629 |
| 325 | Ga0207668_10101399 | 3300025972 | Bacteria | 2140 |
| 326 | Ga0207640_10000693 | 3300025981 | Bacteria | 19614 |
| 327 | Ga0207658_10001140 | 3300025986 | Bacteria | 21328 |
| 328 | Ga0207658_10118034 | 3300025986 | Bacteria | 2110 |
| 329 | Ga0207677_10002446 | 3300026023 | Bacteria | 9750 |
| 330 | Ga0207677_10015236 | 3300026023 | Bacteria | 4515 |
| 331 | Ga0207703_10006941 | 3300026035 | Bacteria | 9012 |
| 332 | Ga0207703_10032135 | 3300026035 | Bacteria | 4153 |
| 333 | Ga0207639_10006305 | 3300026041 | Bacteria | 8057 |
| 334 | Ga0207678_10003989 | 3300026067 | Bacteria | 13277 |
| 335 | Ga0207678_10032323 | 3300026067 | Bacteria | 4560 |
| 336 | Ga0207678_10038465 | 3300026067 | Bacteria | 4156 |
| 337 | Ga0207678_10496748 | 3300026067 | Bacteria | 1063 |
| 338 | Ga0207708_10000810 | 3300026075 | Bacteria | 23491 |
| 339 | Ga0207708_10000906 | 3300026075 | Bacteria | 22273 |
| 340 | Ga0207708_10004388 | 3300026075 | Bacteria | 10396 |
| 341 | Ga0207702_10009427 | 3300026078 | Bacteria | 8199 |
| 342 | Ga0207702_10015689 | 3300026078 | Bacteria | 6272 |
| 343 | Ga0207641_10005232 | 3300026088 | Bacteria | 11099 |
| 344 | Ga0207641_10093042 | 3300026088 | Bacteria | 2642 |
| 345 | Ga0207641_10234748 | 3300026088 | Bacteria | 1706 |
| 346 | Ga0207648_10002655 | 3300026089 | Bacteria | 19080 |
| 347 | Ga0207648_10009659 | 3300026089 | Bacteria | 9225 |
| 348 | Ga0207676_10000849 | 3300026095 | Bacteria | 23691 |
| 349 | Ga0207676_10080583 | 3300026095 | Bacteria | 2643 |
| 350 | Ga0207674_10000535 | 3300026116 | Bacteria | 49820 |
| 351 | Ga0207674_10000863 | 3300026116 | Bacteria | 39645 |
| 352 | Ga0207674_10045208 | 3300026116 | Bacteria | 4531 |
| 353 | Ga0207675_100000365 | 3300026118 | Bacteria | 43342 |
| 354 | Ga0207675_100105597 | 3300026118 | Bacteria | 2655 |
| 355 | Ga0207675_100332477 | 3300026118 | Bacteria | 1485 |
| 356 | Ga0207683_10000252 | 3300026121 | Bacteria | 47809 |
| 357 | Ga0207683_10000667 | 3300026121 | Bacteria | 31542 |
| 358 | Ga0207683_10132264 | 3300026121 | Bacteria | 2244 |
| 359 | Ga0207683_10586539 | 3300026121 | Bacteria | 1031 |
| 360 | Ga0207698_10005113 | 3300026142 | Bacteria | 8061 |
| 361 | Ga0207698_10009827 | 3300026142 | Bacteria | 6114 |
| 362 | Ga0207698_10389939 | 3300026142 | Bacteria | 1328 |
| 363 | Ga0209973_1000555 | 3300027252 | Bacteria | 2882 |
| 364 | Ga0209982_1011965 | 3300027552 | Bacteria | 1299 |
| 365 | Ga0210002_1000993 | 3300027617 | Bacteria | 3934 |
| 366 | Ga0209998_10000681 | 3300027717 | Bacteria | 9091 |
| 367 | Ga0207428_10000415 | 3300027907 | Bacteria | 53058 |
| 368 | Ga0207428_10000636 | 3300027907 | Bacteria | 41316 |
| 369 | Ga0268266_10013796 | 3300028379 | Bacteria | 6956 |
| 370 | Ga0268266_10044143 | 3300028379 | Bacteria | 3810 |
| 371 | Ga0268266_10085152 | 3300028379 | Bacteria | 2761 |
| 372 | Ga0268265_10015552 | 3300028380 | Bacteria | 5209 |
| 373 | Ga0268265_10395432 | 3300028380 | Bacteria | 1276 |
| 374 | Ga0268265_10497791 | 3300028380 | Bacteria | 1148 |
| 375 | Ga0268264_10002536 | 3300028381 | Bacteria | 16046 |
| 376 | Ga0265338_10063888 | 3300028800 | Bacteria | 3206 |
| 377 | Ga0265330_10068968 | 3300031235 | Bacteria | 1531 |
| 378 | Ga0265339_10025207 | 3300031249 | Bacteria | 3415 |
| 379 | Ga0265331_10020915 | 3300031250 | Bacteria | 3354 |
| 380 | Ga0265327_10017052 | 3300031251 | Bacteria | 4578 |
| 381 | Ga0265316_10204790 | 3300031344 | Bacteria | 1461 |
| 382 | Ga0265313_10049645 | 3300031595 | Bacteria | 2018 |
| 383 | Ga0265313_10111922 | 3300031595 | Bacteria | 1199 |
| 384 | Ga0265314_10009250 | 3300031711 | Bacteria | 8346 |
| 385 | Ga0373930_0003780 | 3300034816 | Bacteria | 2427 |
| 386 | Ga0373959_0026438 | 3300034820 | Bacteria | 1147 |
| 387 | Ga0373928_0002818 | 3300035084 | Bacteria | 3347 |
| 388 | Ga0373928_0007888 | 3300035084 | Bacteria | 2061 |
| 389 | Ga0373940_0007701 | 3300035088 | Bacteria | 2440 |
| 390 | Ga0373949_0001131 | 3300035090 | Bacteria | 8057 |
| 391 | Ga0373932_0001355 | 3300035112 | Bacteria | 6865 |
| 392 | Ga0373932_0009796 | 3300035112 | Bacteria | 2311 |
| 393 | Ga0373939_0001134 | 3300035114 | Bacteria | 6565 |
| 394 | Ga0373941_0001699 | 3300035115 | Bacteria | 4717 |
| 395 | Ga0373960_0003108 | 3300035121 | Bacteria | 3749 |
| 396 | Ga0373960_0013833 | 3300035121 | Bacteria | 2032 |
| 397 | Ga0373943_0010005 | 3300035170 | Bacteria | 4253 |
| 398 | Ga0373946_0006407 | 3300035171 | Bacteria | 4266 |
| 399 | Ga0373931_0003872 | 3300035691 | Bacteria | 6769 |
| 400 | Ga0373927_0015576 | 3300035695 | Bacteria | 5023 |
| 401 | Ga0373947_0008622 | 3300035725 | Bacteria | 5869 |
| 402 | Ga0373925_0063842 | 3300037068 | Bacteria | 2772 |
| 403 | Ga0395899_0064458 | 3300037312 | Bacteria | 2694 |
| 404 | Ga0395900_0011462 | 3300037418 | Bacteria | 9075 |
| 405 | Ga0395900_0017381 | 3300037418 | Bacteria | 7342 |
| 406 | Ga0395900_0085144 | 3300037418 | Bacteria | 3249 |
| 407 | Ga0395900_0279652 | 3300037418 | Bacteria | 1661 |
| 408 | Ga0395898_0004053 | 3300037466 | Bacteria | 16091 |
| 409 | Ga0395898_0011385 | 3300037466 | Bacteria | 9237 |
| 410 | Ga0395898_0016748 | 3300037466 | Bacteria | 7490 |
| 411 | Ga0395898_0039649 | 3300037466 | Bacteria | 4661 |
| 412 | Ga0395898_0090718 | 3300037466 | Bacteria | 2940 |
| 413 | Ga0395898_0382448 | 3300037466 | Bacteria | 1342 |
| 414 | Ga0395905_0003646 | 3300037471 | Bacteria | 16334 |
| 415 | Ga0395905_0036137 | 3300037471 | Bacteria | 4639 |
| 416 | Ga0395905_0042787 | 3300037471 | Bacteria | 4249 |
| 417 | Ga0395905_0229688 | 3300037471 | Bacteria | 1735 |
| 418 | Ga0395905_0430476 | 3300037471 | Bacteria | 1216 |
| 419 | Ga0395901_0002084 | 3300038443 | Bacteria | 20504 |
| 420 | Ga0395901_0002362 | 3300038443 | Bacteria | 19195 |
| 421 | Ga0395901_0005585 | 3300038443 | Bacteria | 12733 |
| 422 | Ga0395901_0051497 | 3300038443 | Bacteria | 4281 |
| 423 | Ga0395901_0059366 | 3300038443 | Bacteria | 3979 |
| 424 | Ga0395901_0383372 | 3300038443 | Bacteria | 1446 |
| 425 | Ga0451577_0233390 | 3300042876 | Bacteria | 1664 |
| 426 | Ga0466969_0028617 | 3300044656 | Bacteria | 2848 |
| 427 | Ga0466964_0042742 | 3300044706 | Bacteria | 1837 |
| 428 | Ga0466970_0197020 | 3300044765 | Bacteria | 1120 |
| 429 | Ga0466959_0068084 | 3300045049 | Bacteria | 2580 |
| 430 | Ga0466958_0026768 | 3300045836 | Bacteria | 3409 |
| 431 | Ga0466967_0001857 | 3300045976 | Bacteria | 12727 |
| 432 | Ga0466967_0040162 | 3300045976 | Bacteria | 4027 |
| 433 | Ga0466967_0165456 | 3300045976 | Bacteria | 2078 |
| 434 | Ga0466967_0204450 | 3300045976 | Bacteria | 1871 |
| 435 | Ga0495603_0005620 | 3300046455 | Bacteria | 7495 |
| 436 | Ga0495590_0024629 | 3300046457 | Bacteria | 2120 |
| 437 | Ga0495629_0001287 | 3300046459 | Bacteria | 19724 |
| 438 | Ga0495629_0136839 | 3300046459 | Bacteria | 1705 |
| 439 | Ga0495580_0129620 | 3300046472 | Bacteria | 1750 |
| 440 | Ga0495580_0307560 | 3300046472 | Bacteria | 1079 |
| 441 | Ga0495582_0009997 | 3300046473 | Bacteria | 5222 |
| 442 | Ga0495582_0022599 | 3300046473 | Bacteria | 3442 |
| 443 | Ga0495582_0061834 | 3300046473 | Bacteria | 2068 |
| 444 | Ga0495605_0051542 | 3300046474 | Bacteria | 2004 |
| 445 | Ga0495605_0053103 | 3300046474 | Bacteria | 1967 |
| 446 | Ga0495639_0020639 | 3300046475 | Bacteria | 2879 |
| 447 | Ga0495662_0079017 | 3300046476 | Bacteria | 1599 |
| 448 | Ga0495585_0145449 | 3300046492 | Bacteria | 1239 |
| 449 | Ga0495594_0004071 | 3300046499 | Bacteria | 7515 |
| 450 | Ga0495616_0130686 | 3300046513 | Bacteria | 1151 |
| 451 | Ga0495637_0028646 | 3300046520 | Bacteria | 2486 |
| 452 | Ga0495644_0008466 | 3300046523 | Bacteria | 3962 |
| 453 | Ga0495663_0033157 | 3300046525 | Bacteria | 1541 |
| 454 | Ga0495598_0004009 | 3300046537 | Bacteria | 3163 |
| 455 | Ga0495667_0051691 | 3300046559 | Bacteria | 2710 |
| 456 | Ga0495656_0004292 | 3300046615 | Bacteria | 4871 |
| 457 | Ga0495635_0091172 | 3300046663 | Bacteria | 2085 |
| 458 | Ga0495659_0014029 | 3300046664 | Bacteria | 2617 |
| 459 | Ga0495659_0027997 | 3300046664 | Bacteria | 1948 |
| 460 | Ga0495661_0105665 | 3300046665 | Bacteria | 1577 |
| 461 | Ga0495647_0018449 | 3300046681 | Bacteria | 2484 |
| 462 | Ga0495647_0018673 | 3300046681 | Bacteria | 2472 |
| 463 | Ga0495658_0008547 | 3300046683 | Bacteria | 5078 |
| 464 | Ga0495658_0036006 | 3300046683 | Bacteria | 2728 |
| 465 | Ga0495658_0042792 | 3300046683 | Bacteria | 2530 |
| 466 | Ga0495613_0023263 | 3300046689 | Bacteria | 4616 |
| 467 | Ga0495613_0127639 | 3300046689 | Bacteria | 1823 |
| 468 | Ga0495670_0161051 | 3300046691 | Bacteria | 1179 |
| 469 | Ga0495671_0036865 | 3300046692 | Bacteria | 2476 |
| 470 | Ga0495581_0005360 | 3300047315 | Bacteria | 7419 |
| 471 | Ga0495581_0008046 | 3300047315 | Bacteria | 6103 |
| 472 | Ga0495581_0017198 | 3300047315 | Bacteria | 4203 |
| 473 | Ga0495636_0039539 | 3300047318 | Bacteria | 1954 |
| 474 | Ga0495636_0040583 | 3300047318 | Bacteria | 1930 |
| 475 | Ga0495676_0046069 | 3300047321 | Bacteria | 3544 |
| 476 | Ga0495680_0016363 | 3300047322 | Bacteria | 6376 |
| 477 | Ga0495677_0037618 | 3300047445 | Bacteria | 1768 |
| 478 | Ga0495593_0005907 | 3300047673 | Bacteria | 7210 |
| 479 | Ga0495614_0026782 | 3300048089 | Bacteria | 2485 |
| 480 | Ga0496100_0014653 | 3300048903 | Bacteria | 4557 |
| 481 | Ga0496100_0015937 | 3300048903 | Bacteria | 4401 |
| 482 | Ga0496100_0025189 | 3300048903 | Bacteria | 3636 |
| 483 | Ga0496100_0130498 | 3300048903 | Bacteria | 1769 |
| 484 | Ga0496101_0007580 | 3300048904 | Bacteria | 7044 |
| 485 | Ga0496101_0007689 | 3300048904 | Bacteria | 7002 |
| 486 | Ga0496101_0073634 | 3300048904 | Bacteria | 2509 |
| 487 | Ga0496101_0076314 | 3300048904 | Bacteria | 2468 |
| 488 | Ga0496102_0005971 | 3300048905 | Bacteria | 10371 |
| 489 | Ga0496102_0013176 | 3300048905 | Bacteria | 7154 |
| 490 | Ga0496102_0013322 | 3300048905 | Bacteria | 7122 |
| 491 | Ga0496102_0032372 | 3300048905 | Bacteria | 4696 |
| 492 | Ga0496102_0245530 | 3300048905 | Bacteria | 1688 |
| 493 | Ga0496103_0000959 | 3300048906 | Bacteria | 20463 |
| 494 | Ga0496103_0001098 | 3300048906 | Bacteria | 18838 |
| 495 | Ga0496103_0003949 | 3300048906 | Bacteria | 9011 |
| 496 | Ga0496103_0008320 | 3300048906 | Bacteria | 6164 |
| 497 | Ga0496103_0036968 | 3300048906 | Bacteria | 2991 |
| 498 | Ga0496103_0100236 | 3300048906 | Bacteria | 1833 |
| 499 | Ga0496104_0008532 | 3300048907 | Bacteria | 9107 |
| 500 | Ga0496104_0014701 | 3300048907 | Bacteria | 7072 |
| 501 | Ga0496104_0028388 | 3300048907 | Bacteria | 5186 |
| 502 | Ga0496104_0116041 | 3300048907 | Bacteria | 2569 |
| 503 | Ga0496104_0174272 | 3300048907 | Bacteria | 2061 |
| 504 | Ga0496104_0261607 | 3300048907 | Bacteria | 1643 |
| 505 | Ga0496105_0011949 | 3300048908 | Bacteria | 6875 |
| 506 | Ga0496105_0022682 | 3300048908 | Bacteria | 5086 |
| 507 | Ga0496105_0051522 | 3300048908 | Bacteria | 3400 |
| 508 | Ga0496105_0140930 | 3300048908 | Bacteria | 1984 |
| 509 | Ga0496106_0001801 | 3300048909 | Bacteria | 16011 |
| 510 | Ga0496106_0008645 | 3300048909 | Bacteria | 7536 |
| 511 | Ga0496106_0014782 | 3300048909 | Bacteria | 5771 |
| 512 | Ga0496107_0012134 | 3300048910 | Bacteria | 6010 |
| 513 | Ga0496107_0020565 | 3300048910 | Bacteria | 4663 |
| 514 | Ga0496107_0022086 | 3300048910 | Bacteria | 4495 |
| 515 | Ga0496107_0159835 | 3300048910 | Bacteria | 1669 |
| 516 | Ga0496107_0205186 | 3300048910 | Bacteria | 1465 |
| 517 | Ga0496108_0006621 | 3300048911 | Bacteria | 9390 |
| 518 | Ga0496108_0013281 | 3300048911 | Bacteria | 6713 |
| 519 | Ga0496108_0022558 | 3300048911 | Bacteria | 5176 |
| 520 | Ga0496108_0033044 | 3300048911 | Bacteria | 4299 |
| 521 | Ga0496108_0235081 | 3300048911 | Bacteria | 1594 |
| 522 | Ga0496108_0366825 | 3300048911 | Bacteria | 1257 |
| 523 | Ga0496109_0000575 | 3300048912 | Bacteria | 30741 |
| 524 | Ga0496109_0008219 | 3300048912 | Bacteria | 8856 |
| 525 | Ga0496109_0008788 | 3300048912 | Bacteria | 8603 |
| 526 | Ga0496109_0008961 | 3300048912 | Bacteria | 8521 |
| 527 | Ga0496109_0010798 | 3300048912 | Bacteria | 7819 |
| 528 | Ga0496109_0013319 | 3300048912 | Bacteria | 7126 |
| 529 | Ga0496109_0015848 | 3300048912 | Bacteria | 6580 |
| 530 | Ga0496109_0020464 | 3300048912 | Bacteria | 5844 |
| 531 | Ga0496109_0067299 | 3300048912 | Bacteria | 3281 |
| 532 | Ga0496110_0011859 | 3300048913 | Bacteria | 7157 |
| 533 | Ga0496110_0033746 | 3300048913 | Bacteria | 4429 |
| 534 | Ga0496110_0134571 | 3300048913 | Bacteria | 2233 |
| 535 | Ga0496110_0247597 | 3300048913 | Bacteria | 1622 |
| 536 | Ga0496110_0255844 | 3300048913 | Bacteria | 1594 |
| 537 | Ga0496111_0002998 | 3300048914 | Bacteria | 10336 |
| 538 | Ga0496111_0021033 | 3300048914 | Bacteria | 4550 |
| 539 | Ga0496111_0031145 | 3300048914 | Bacteria | 3798 |
| 540 | Ga0496111_0137423 | 3300048914 | Bacteria | 1811 |
| 541 | Ga0496111_0307869 | 3300048914 | Bacteria | 1174 |
| 542 | Ga0496112_0001207 | 3300048915 | Bacteria | 19399 |
| 543 | Ga0496112_0001598 | 3300048915 | Bacteria | 17516 |
| 544 | Ga0496112_0019989 | 3300048915 | Bacteria | 6339 |
| 545 | Ga0496112_0045243 | 3300048915 | Bacteria | 4315 |
| 546 | Ga0496112_0053498 | 3300048915 | Bacteria | 3965 |
| 547 | Ga0496112_0076779 | 3300048915 | Bacteria | 3304 |
| 548 | Ga0496112_0092349 | 3300048915 | Bacteria | 2996 |
| 549 | Ga0496112_0138463 | 3300048915 | Bacteria | 2404 |
| 550 | Ga0496112_0142496 | 3300048915 | Bacteria | 2366 |
| 551 | Ga0496112_0188595 | 3300048915 | Bacteria | 2024 |
| 552 | Ga0496113_0016623 | 3300048916 | Bacteria | 5086 |
| 553 | Ga0496113_0023132 | 3300048916 | Bacteria | 4404 |
| 554 | Ga0496113_0042241 | 3300048916 | Bacteria | 3368 |
| 555 | Ga0496113_0042805 | 3300048916 | Bacteria | 3347 |
| 556 | Ga0496113_0126814 | 3300048916 | Bacteria | 1999 |
| 557 | Ga0496113_0365763 | 3300048916 | Unclassified | 1157 |
| 558 | Ga0496114_0001599 | 3300048917 | Bacteria | 17174 |
| 559 | Ga0496114_0004424 | 3300048917 | Bacteria | 10906 |
| 560 | Ga0496114_0014385 | 3300048917 | Bacteria | 6350 |
| 561 | Ga0496114_0164052 | 3300048917 | Bacteria | 1934 |
| 562 | Ga0496114_0207578 | 3300048917 | Bacteria | 1717 |
| 563 | Ga0496114_0362032 | 3300048917 | Bacteria | 1283 |
| 564 | Ga0496115_0007947 | 3300048918 | Bacteria | 7828 |
| 565 | Ga0496115_0009498 | 3300048918 | Bacteria | 7223 |
| 566 | Ga0496115_0014202 | 3300048918 | Bacteria | 6025 |
| 567 | Ga0501067_0011161 | 3300049583 | Bacteria | 4969 |
| 568 | Ga0501067_0020485 | 3300049583 | Bacteria | 3660 |
| 569 | Ga0501068_0015159 | 3300049584 | Bacteria | 4422 |
| 570 | Ga0501069_0093723 | 3300049585 | Bacteria | 1699 |
| 571 | Ga0501071_0234941 | 3300049587 | Bacteria | 1382 |
| 572 | Ga0501072_0003295 | 3300049588 | Bacteria | 12146 |
| 573 | Ga0501073_0048465 | 3300049589 | Bacteria | 2982 |
| 574 | Ga0501079_0063257 | 3300049741 | Bacteria | 2855 |
| 575 | Ga0501080_0117392 | 3300049742 | Bacteria | 2466 |
| 576 | Ga0501083_0005263 | 3300049744 | Bacteria | 9153 |
| 577 | nmdc:mga0yw44_19425_c1 | 3300050492 | Bacteria | 3748 |
| 578 | nmdc:mga05p37_2767_c1 | 3300050507 | Bacteria | 20388 |
| 579 | nmdc:mga05p37_281_c1 | 3300050507 | Bacteria | 50198 |
| 580 | nmdc:mga05p37_433371_c1 | 3300050507 | Bacteria | 1527 |
| 581 | nmdc:mga05p37_5072_c1 | 3300050507 | Bacteria | 15436 |
| 582 | nmdc:mga05p37_938_c1 | 3300050507 | Bacteria | 32835 |
| 583 | nmdc:mga06r32_2024_c1 | 3300050510 | Bacteria | 18126 |
| 584 | nmdc:mga06r32_206215_c1 | 3300050510 | Bacteria | 1954 |
| 585 | nmdc:mga08y16_912_c1 | 3300050511 | Bacteria | 28635 |
| 586 | nmdc:mga0n895_121014_c1 | 3300050512 | Bacteria | 2639 |
| 587 | nmdc:mga0n895_151006_c1 | 3300050512 | Bacteria | 2353 |
| 588 | nmdc:mga0n895_17769_c1 | 3300050512 | Bacteria | 6565 |
| 589 | nmdc:mga0n895_372343_c1 | 3300050512 | Bacteria | 1446 |
| 590 | nmdc:mga0n895_4467_c1 | 3300050512 | Bacteria | 11495 |
| 591 | nmdc:mga0n895_806446_c1 | 3300050512 | Bacteria | 929 |
| 592 | nmdc:mga0rr50_1630_c1 | 3300050513 | Bacteria | 12338 |
| 593 | nmdc:mga0rr50_3485_c1 | 3300050513 | Bacteria | 9064 |
| 594 | nmdc:mga0rr50_6418_c1 | 3300050513 | Bacteria | 7154 |
| 595 | nmdc:mga0rr50_73341_c1 | 3300050513 | Bacteria | 2617 |
| 596 | nmdc:mga08x19_4456_c1 | 3300050514 | Bacteria | 8296 |
| 597 | nmdc:mga0a205_1771_c1 | 3300050515 | Bacteria | 18694 |
| 598 | nmdc:mga0a205_2393_c1 | 3300050515 | Bacteria | 7699 |
| 599 | nmdc:mga0a205_2745_c1 | 3300050515 | Bacteria | 15553 |
| 600 | nmdc:mga0a205_571_c1 | 3300050515 | Bacteria | 29236 |
| 601 | Ga0495601_0173008 | 3300053077 | Bacteria | 1412 |
| 602 | Ga0495619_0000234 | 3300053085 | Bacteria | 40516 |
| 603 | Ga0495619_0012321 | 3300053085 | Bacteria | 5382 |
| 604 | Ga0501084_0123656 | 3300054114 | Bacteria | 2176 |
| 605 | Ga0501082_0037598 | 3300060353 | Bacteria | 4174 |
| 606 | Ga0530510_0007443 | 3300061734 | Bacteria | 7622 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300001990 | JGI24737J22298_10040617 | JGI24737J22298_100406172 | 270 |
| 2 | 3300048909 | Ga0496106_0001801 | Ga0496106_0001801_15071_15889 | 272 |
| 3 | 3300048915 | Ga0496112_0076779 | Ga0496112_0076779_2364_3182 | 272 |
| 4 | 3300050512 | nmdc:mga0n895_17769_c1 | nmdc:mga0n895_17769_c1_71_889 | 272 |
| 5 | 3300049587 | Ga0501071_0234941 | Ga0501071_0234941_323_1201 | 286 |
| 6 | 3300050512 | nmdc:mga0n895_806446_c1 | nmdc:mga0n895_806446_c1_10_897 | 290 |
| 7 | 3300048913 | Ga0496110_0033746 | Ga0496110_0033746_83_961 | 292 |
| 8 | 3300005339 | Ga0070660_100005269 | Ga0070660_1000052695 | 296 |
| 9 | 3300005530 | Ga0070679_100076305 | Ga0070679_1000763052 | 296 |
| 10 | 3300006852 | Ga0075433_10002835 | Ga0075433_100028356 | 296 |
| 11 | 3300006871 | Ga0075434_100004190 | Ga0075434_1000041907 | 296 |
| 12 | 3300006914 | Ga0075436_100000785 | Ga0075436_1000007852 | 296 |
| 13 | 3300007076 | Ga0075435_100001483 | Ga0075435_1000014836 | 296 |
| 14 | 3300025919 | Ga0207657_10002085 | Ga0207657_1000208514 | 296 |
| 15 | 3300025921 | Ga0207652_10056662 | Ga0207652_100566622 | 296 |
| 16 | 3300037471 | Ga0395905_0229688 | Ga0395905_0229688_808_1713 | 296 |
| 17 | 3300050507 | nmdc:mga05p37_2767_c1 | nmdc:mga05p37_2767_c1_5714_6691 | 296 |
| 18 | 3300050507 | nmdc:mga05p37_433371_c1 | nmdc:mga05p37_433371_c1_36_935 | 296 |
| 19 | 3300050512 | nmdc:mga0n895_4467_c1 | nmdc:mga0n895_4467_c1_2606_3583 | 296 |
| 20 | 3300050513 | nmdc:mga0rr50_3485_c1 | nmdc:mga0rr50_3485_c1_2502_3479 | 296 |
| 21 | 3300050514 | nmdc:mga08x19_4456_c1 | nmdc:mga08x19_4456_c1_5261_6238 | 296 |
| 22 | 3300050515 | nmdc:mga0a205_1771_c1 | nmdc:mga0a205_1771_c1_12916_13893 | 296 |
| 23 | 3300005471 | Ga0070698_100225867 | Ga0070698_1002258672 | 297 |
| 24 | 3300005937 | Ga0081455_10232370 | Ga0081455_102323702 | 298 |
| 25 | 3300005338 | Ga0068868_100075068 | Ga0068868_1000750682 | 299 |
| 26 | 3300005719 | Ga0068861_100168168 | Ga0068861_1001681682 | 299 |
| 27 | 3300006358 | Ga0068871_100435660 | Ga0068871_1004356601 | 299 |
| 28 | 3300014969 | Ga0157376_10060228 | Ga0157376_100602282 | 299 |
| 29 | 3300025972 | Ga0207668_10101399 | Ga0207668_101013992 | 299 |
| 30 | 3300026075 | Ga0207708_10004388 | Ga0207708_100043888 | 299 |
| 31 | 3300046474 | Ga0495605_0051542 | Ga0495605_0051542_887_1888 | 299 |
| 32 | 3300046513 | Ga0495616_0130686 | Ga0495616_0130686_80_1081 | 299 |
| 33 | 3300046520 | Ga0495637_0028646 | Ga0495637_0028646_147_1148 | 299 |
| 34 | 3300046523 | Ga0495644_0008466 | Ga0495644_0008466_2363_3364 | 299 |
| 35 | 3300046525 | Ga0495663_0033157 | Ga0495663_0033157_355_1356 | 299 |
| 36 | 3300046537 | Ga0495598_0004009 | Ga0495598_0004009_1697_2698 | 299 |
| 37 | 3300046615 | Ga0495656_0004292 | Ga0495656_0004292_2597_3598 | 299 |
| 38 | 3300046665 | Ga0495661_0105665 | Ga0495661_0105665_243_1244 | 299 |
| 39 | 3300047318 | Ga0495636_0039539 | Ga0495636_0039539_252_1253 | 299 |
| 40 | 3300050512 | nmdc:mga0n895_121014_c1 | nmdc:mga0n895_121014_c1_225_1226 | 299 |
| 41 | 3300007076 | Ga0075435_100016976 | Ga0075435_1000169765 | 301 |
| 42 | 3300044765 | Ga0466970_0197020 | Ga0466970_0197020_138_1106 | 305 |
| 43 | 3300005615 | Ga0070702_100196790 | Ga0070702_1001967902 | 307 |
| 44 | 3300006028 | Ga0070717_10571144 | Ga0070717_105711441 | 307 |
| 45 | 3300006881 | Ga0068865_100246705 | Ga0068865_1002467052 | 307 |
| 46 | 3300013297 | Ga0157378_10469481 | Ga0157378_104694811 | 307 |
| 47 | 3300014745 | Ga0157377_10281712 | Ga0157377_102817121 | 307 |
| 48 | 3300025907 | Ga0207645_10030804 | Ga0207645_100308043 | 307 |
| 49 | 3300025940 | Ga0207691_10097690 | Ga0207691_100976902 | 307 |
| 50 | 3300025945 | Ga0207679_10243865 | Ga0207679_102438652 | 307 |
| 51 | 3300049583 | Ga0501067_0020485 | Ga0501067_0020485_169_1113 | 307 |
| 52 | 3300048917 | Ga0496114_0164052 | Ga0496114_0164052_666_1661 | 308 |
| 53 | 3300006028 | Ga0070717_10016472 | Ga0070717_100164722 | 309 |
| 54 | 3300025929 | Ga0207664_10011969 | Ga0207664_100119692 | 309 |
| 55 | 3300048912 | Ga0496109_0067299 | Ga0496109_0067299_858_1865 | 309 |
| 56 | 3300048913 | Ga0496110_0255844 | Ga0496110_0255844_161_1168 | 309 |
| 57 | 3300048915 | Ga0496112_0019989 | Ga0496112_0019989_2325_3332 | 309 |
| 58 | 3300006175 | Ga0070712_100031765 | Ga0070712_1000317654 | 310 |
| 59 | 3300006881 | Ga0068865_100466068 | Ga0068865_1004660681 | 310 |
| 60 | 3300048904 | Ga0496101_0007580 | Ga0496101_0007580_5281_6246 | 310 |
| 61 | 3300048907 | Ga0496104_0014701 | Ga0496104_0014701_4895_5860 | 310 |
| 62 | 3300048913 | Ga0496110_0011859 | Ga0496110_0011859_4871_5836 | 310 |
| 63 | 3300048915 | Ga0496112_0001207 | Ga0496112_0001207_9148_10113 | 310 |
| 64 | 3300048916 | Ga0496113_0365763 | Ga0496113_0365763_153_1118 | 310 |
| 65 | 3300048917 | Ga0496114_0004424 | Ga0496114_0004424_1216_2181 | 310 |
| 66 | 3300049585 | Ga0501069_0093723 | Ga0501069_0093723_91_1053 | 310 |
| 67 | 3300005435 | Ga0070714_100122279 | Ga0070714_1001222792 | 311 |
| 68 | 3300045976 | Ga0466967_0165456 | Ga0466967_0165456_148_1110 | 311 |
| 69 | 3300046492 | Ga0495585_0145449 | Ga0495585_0145449_17_976 | 311 |
| 70 | 3300005436 | Ga0070713_100004726 | Ga0070713_1000047262 | 312 |
| 71 | 3300006175 | Ga0070712_100180225 | Ga0070712_1001802252 | 312 |
| 72 | 3300025915 | Ga0207693_10084222 | Ga0207693_100842223 | 312 |
| 73 | 3300025928 | Ga0207700_10000001 | Ga0207700_10000001618 | 312 |
| 74 | 3300028800 | Ga0265338_10063888 | Ga0265338_100638882 | 312 |
| 75 | 3300031235 | Ga0265330_10068968 | Ga0265330_100689682 | 312 |
| 76 | 3300031249 | Ga0265339_10025207 | Ga0265339_100252072 | 312 |
| 77 | 3300031250 | Ga0265331_10020915 | Ga0265331_100209153 | 312 |
| 78 | 3300031344 | Ga0265316_10204790 | Ga0265316_102047902 | 312 |
| 79 | 3300031595 | Ga0265313_10049645 | Ga0265313_100496452 | 312 |
| 80 | 3300031595 | Ga0265313_10111922 | Ga0265313_101119222 | 312 |
| 81 | 3300031711 | Ga0265314_10009250 | Ga0265314_100092503 | 312 |
| 82 | 3300009147 | Ga0114129_10005599 | Ga0114129_100055996 | 313 |
| 83 | 3300025916 | Ga0207663_10055590 | Ga0207663_100555902 | 313 |
| 84 | 3300037466 | Ga0395898_0011385 | Ga0395898_0011385_1710_2687 | 313 |
| 85 | 3300037471 | Ga0395905_0042787 | Ga0395905_0042787_2875_3852 | 313 |
| 86 | 3300038443 | Ga0395901_0002084 | Ga0395901_0002084_10011_10988 | 313 |
| 87 | 3300046664 | Ga0495659_0014029 | Ga0495659_0014029_692_1669 | 313 |
| 88 | 3300048910 | Ga0496107_0205186 | Ga0496107_0205186_87_1064 | 313 |
| 89 | 3300048911 | Ga0496108_0366825 | Ga0496108_0366825_216_1193 | 313 |
| 90 | 3300048912 | Ga0496109_0015848 | Ga0496109_0015848_3316_4293 | 313 |
| 91 | 3300048914 | Ga0496111_0307869 | Ga0496111_0307869_33_1010 | 313 |
| 92 | 3300048915 | Ga0496112_0045243 | Ga0496112_0045243_1346_2323 | 313 |
| 93 | 3300005718 | Ga0068866_10060060 | Ga0068866_100600602 | 314 |
| 94 | 3300048915 | Ga0496112_0001598 | Ga0496112_0001598_14864_15832 | 314 |
| 95 | 3300005535 | Ga0070684_100010109 | Ga0070684_1000101095 | 316 |
| 96 | 3300025944 | Ga0207661_10007085 | Ga0207661_100070852 | 316 |
| 97 | 3300046459 | Ga0495629_0136839 | Ga0495629_0136839_497_1513 | 316 |
| 98 | 3300046559 | Ga0495667_0051691 | Ga0495667_0051691_217_1233 | 316 |
| 99 | 3300046689 | Ga0495613_0127639 | Ga0495613_0127639_302_1318 | 316 |
| 100 | 3300048911 | Ga0496108_0235081 | Ga0496108_0235081_507_1493 | 316 |
| 101 | 3300048912 | Ga0496109_0008788 | Ga0496109_0008788_3549_4535 | 316 |
| 102 | 3300053085 | Ga0495619_0012321 | Ga0495619_0012321_2913_3929 | 316 |
| 103 | 3300005329 | Ga0070683_100004388 | Ga0070683_1000043886 | 317 |
| 104 | 3300005329 | Ga0070683_100172134 | Ga0070683_1001721342 | 317 |
| 105 | 3300005347 | Ga0070668_100130769 | Ga0070668_1001307692 | 317 |
| 106 | 3300005365 | Ga0070688_100071942 | Ga0070688_1000719423 | 317 |
| 107 | 3300005456 | Ga0070678_100159517 | Ga0070678_1001595172 | 317 |
| 108 | 3300005466 | Ga0070685_10111282 | Ga0070685_101112822 | 317 |
| 109 | 3300005535 | Ga0070684_100000278 | Ga0070684_10000027817 | 317 |
| 110 | 3300005535 | Ga0070684_100006983 | Ga0070684_1000069832 | 317 |
| 111 | 3300005549 | Ga0070704_100172513 | Ga0070704_1001725132 | 317 |
| 112 | 3300005563 | Ga0068855_100015776 | Ga0068855_1000157763 | 317 |
| 113 | 3300005564 | Ga0070664_100036570 | Ga0070664_1000365704 | 317 |
| 114 | 3300005577 | Ga0068857_100000596 | Ga0068857_1000005966 | 317 |
| 115 | 3300005615 | Ga0070702_100122162 | Ga0070702_1001221622 | 317 |
| 116 | 3300005983 | Ga0081540_1001344 | Ga0081540_100134411 | 317 |
| 117 | 3300006844 | Ga0075428_100001400 | Ga0075428_10000140027 | 317 |
| 118 | 3300006847 | Ga0075431_100188006 | Ga0075431_1001880062 | 317 |
| 119 | 3300009147 | Ga0114129_10131109 | Ga0114129_101311092 | 317 |
| 120 | 3300010375 | Ga0105239_10045367 | Ga0105239_100453672 | 317 |
| 121 | 3300013104 | Ga0157370_10254199 | Ga0157370_102541992 | 317 |
| 122 | 3300013308 | Ga0157375_10136062 | Ga0157375_101360622 | 317 |
| 123 | 3300025944 | Ga0207661_10010717 | Ga0207661_100107172 | 317 |
| 124 | 3300025945 | Ga0207679_10039273 | Ga0207679_100392731 | 317 |
| 125 | 3300026116 | Ga0207674_10000863 | Ga0207674_1000086319 | 317 |
| 126 | 3300026118 | Ga0207675_100105597 | Ga0207675_1001055972 | 317 |
| 127 | 3300026121 | Ga0207683_10586539 | Ga0207683_105865391 | 317 |
| 128 | 3300037312 | Ga0395899_0064458 | Ga0395899_0064458_343_1326 | 317 |
| 129 | 3300037418 | Ga0395900_0017381 | Ga0395900_0017381_4740_5723 | 317 |
| 130 | 3300037418 | Ga0395900_0279652 | Ga0395900_0279652_234_1220 | 317 |
| 131 | 3300037466 | Ga0395898_0016748 | Ga0395898_0016748_2272_3255 | 317 |
| 132 | 3300037466 | Ga0395898_0039649 | Ga0395898_0039649_1715_2698 | 317 |
| 133 | 3300037466 | Ga0395898_0382448 | Ga0395898_0382448_15_1001 | 317 |
| 134 | 3300037471 | Ga0395905_0003646 | Ga0395905_0003646_7819_8802 | 317 |
| 135 | 3300038443 | Ga0395901_0005585 | Ga0395901_0005585_5043_6026 | 317 |
| 136 | 3300038443 | Ga0395901_0051497 | Ga0395901_0051497_66_1049 | 317 |
| 137 | 3300038443 | Ga0395901_0059366 | Ga0395901_0059366_2001_2984 | 317 |
| 138 | 3300046457 | Ga0495590_0024629 | Ga0495590_0024629_371_1354 | 317 |
| 139 | 3300046474 | Ga0495605_0053103 | Ga0495605_0053103_311_1294 | 317 |
| 140 | 3300046683 | Ga0495658_0042792 | Ga0495658_0042792_461_1444 | 317 |
| 141 | 3300046692 | Ga0495671_0036865 | Ga0495671_0036865_288_1271 | 317 |
| 142 | 3300047315 | Ga0495581_0008046 | Ga0495581_0008046_743_1726 | 317 |
| 143 | 3300047318 | Ga0495636_0040583 | Ga0495636_0040583_588_1571 | 317 |
| 144 | 3300048905 | Ga0496102_0245530 | Ga0496102_0245530_355_1338 | 317 |
| 145 | 3300048913 | Ga0496110_0247597 | Ga0496110_0247597_433_1410 | 317 |
| 146 | 3300048914 | Ga0496111_0021033 | Ga0496111_0021033_2373_3356 | 317 |
| 147 | 3300050507 | nmdc:mga05p37_5072_c1 | nmdc:mga05p37_5072_c1_12112_13107 | 317 |
| 148 | 3300050510 | nmdc:mga06r32_206215_c1 | nmdc:mga06r32_206215_c1_67_1050 | 317 |
| 149 | 3300053077 | Ga0495601_0173008 | Ga0495601_0173008_24_1007 | 317 |
| 150 | 3300006038 | Ga0075365_10075304 | Ga0075365_100753042 | 318 |
| 151 | 3300014497 | Ga0182008_10027678 | Ga0182008_100276783 | 318 |
| 152 | 3300044706 | Ga0466964_0042742 | Ga0466964_0042742_577_1551 | 318 |
| 153 | 3300045976 | Ga0466967_0001857 | Ga0466967_0001857_7280_8254 | 318 |
| 154 | 3300045976 | Ga0466967_0204450 | Ga0466967_0204450_22_996 | 318 |
| 155 | 3300050492 | nmdc:mga0yw44_19425_c1 | nmdc:mga0yw44_19425_c1_986_1993 | 318 |
| 156 | 3300001978 | JGI24747J21853_1000115 | JGI24747J21853_10001152 | 319 |
| 157 | 3300002077 | JGI24744J21845_10000862 | JGI24744J21845_100008624 | 319 |
| 158 | 3300002244 | JGI24742J22300_10005553 | JGI24742J22300_100055532 | 319 |
| 159 | 3300005329 | Ga0070683_100005135 | Ga0070683_1000051356 | 319 |
| 160 | 3300005330 | Ga0070690_100027735 | Ga0070690_1000277352 | 319 |
| 161 | 3300005337 | Ga0070682_100005430 | Ga0070682_1000054303 | 319 |
| 162 | 3300005338 | Ga0068868_100117079 | Ga0068868_1001170792 | 319 |
| 163 | 3300005340 | Ga0070689_100004949 | Ga0070689_1000049495 | 319 |
| 164 | 3300005345 | Ga0070692_10006536 | Ga0070692_100065364 | 319 |
| 165 | 3300005347 | Ga0070668_100030539 | Ga0070668_1000305393 | 319 |
| 166 | 3300005355 | Ga0070671_100043679 | Ga0070671_1000436792 | 319 |
| 167 | 3300005356 | Ga0070674_100009442 | Ga0070674_1000094422 | 319 |
| 168 | 3300005364 | Ga0070673_100096799 | Ga0070673_1000967992 | 319 |
| 169 | 3300005365 | Ga0070688_100018307 | Ga0070688_1000183072 | 319 |
| 170 | 3300005366 | Ga0070659_100008419 | Ga0070659_1000084192 | 319 |
| 171 | 3300005437 | Ga0070710_10001523 | Ga0070710_100015236 | 319 |
| 172 | 3300005438 | Ga0070701_10003880 | Ga0070701_100038804 | 319 |
| 173 | 3300005441 | Ga0070700_100004636 | Ga0070700_1000046362 | 319 |
| 174 | 3300005444 | Ga0070694_100004742 | Ga0070694_1000047422 | 319 |
| 175 | 3300005455 | Ga0070663_100042870 | Ga0070663_1000428702 | 319 |
| 176 | 3300005456 | Ga0070678_100007296 | Ga0070678_1000072964 | 319 |
| 177 | 3300005459 | Ga0068867_100005224 | Ga0068867_1000052244 | 319 |
| 178 | 3300005466 | Ga0070685_10014939 | Ga0070685_100149392 | 319 |
| 179 | 3300005530 | Ga0070679_100079855 | Ga0070679_1000798552 | 319 |
| 180 | 3300005535 | Ga0070684_100005865 | Ga0070684_1000058654 | 319 |
| 181 | 3300005539 | Ga0068853_100020179 | Ga0068853_1000201793 | 319 |
| 182 | 3300005544 | Ga0070686_100004116 | Ga0070686_1000041164 | 319 |
| 183 | 3300005546 | Ga0070696_100094705 | Ga0070696_1000947051 | 319 |
| 184 | 3300005547 | Ga0070693_100077900 | Ga0070693_1000779002 | 319 |
| 185 | 3300005548 | Ga0070665_100102764 | Ga0070665_1001027642 | 319 |
| 186 | 3300005549 | Ga0070704_100023010 | Ga0070704_1000230101 | 319 |
| 187 | 3300005563 | Ga0068855_100026022 | Ga0068855_1000260226 | 319 |
| 188 | 3300005615 | Ga0070702_100001320 | Ga0070702_1000013203 | 319 |
| 189 | 3300005616 | Ga0068852_100016395 | Ga0068852_1000163954 | 319 |
| 190 | 3300005617 | Ga0068859_100183929 | Ga0068859_1001839292 | 319 |
| 191 | 3300005618 | Ga0068864_100372373 | Ga0068864_1003723732 | 319 |
| 192 | 3300005718 | Ga0068866_10002156 | Ga0068866_100021563 | 319 |
| 193 | 3300005841 | Ga0068863_100054410 | Ga0068863_1000544103 | 319 |
| 194 | 3300005843 | Ga0068860_100069743 | Ga0068860_1000697432 | 319 |
| 195 | 3300006163 | Ga0070715_10041429 | Ga0070715_100414292 | 319 |
| 196 | 3300006175 | Ga0070712_100021015 | Ga0070712_1000210154 | 319 |
| 197 | 3300006358 | Ga0068871_100104557 | Ga0068871_1001045572 | 319 |
| 198 | 3300006881 | Ga0068865_100001838 | Ga0068865_1000018383 | 319 |
| 199 | 3300006931 | Ga0097620_100183938 | Ga0097620_1001839382 | 319 |
| 200 | 3300009098 | Ga0105245_10013551 | Ga0105245_100135512 | 319 |
| 201 | 3300009148 | Ga0105243_10205065 | Ga0105243_102050652 | 319 |
| 202 | 3300009176 | Ga0105242_10039377 | Ga0105242_100393773 | 319 |
| 203 | 3300009177 | Ga0105248_10021456 | Ga0105248_100214563 | 319 |
| 204 | 3300009177 | Ga0105248_10263335 | Ga0105248_102633352 | 319 |
| 205 | 3300009545 | Ga0105237_10041507 | Ga0105237_100415074 | 319 |
| 206 | 3300009551 | Ga0105238_10045650 | Ga0105238_100456503 | 319 |
| 207 | 3300009553 | Ga0105249_10001802 | Ga0105249_100018022 | 319 |
| 208 | 3300010375 | Ga0105239_10004973 | Ga0105239_100049736 | 319 |
| 209 | 3300013105 | Ga0157369_10122789 | Ga0157369_101227893 | 319 |
| 210 | 3300013296 | Ga0157374_10006362 | Ga0157374_100063623 | 319 |
| 211 | 3300013297 | Ga0157378_10030426 | Ga0157378_100304265 | 319 |
| 212 | 3300013306 | Ga0163162_10014349 | Ga0163162_100143496 | 319 |
| 213 | 3300013308 | Ga0157375_10420337 | Ga0157375_104203372 | 319 |
| 214 | 3300014326 | Ga0157380_10024103 | Ga0157380_100241033 | 319 |
| 215 | 3300014969 | Ga0157376_10110532 | Ga0157376_101105322 | 319 |
| 216 | 3300025898 | Ga0207692_10016066 | Ga0207692_100160663 | 319 |
| 217 | 3300025899 | Ga0207642_10004154 | Ga0207642_100041543 | 319 |
| 218 | 3300025904 | Ga0207647_10020705 | Ga0207647_100207053 | 319 |
| 219 | 3300025906 | Ga0207699_10016465 | Ga0207699_100164653 | 319 |
| 220 | 3300025911 | Ga0207654_10055610 | Ga0207654_100556102 | 319 |
| 221 | 3300025914 | Ga0207671_10165585 | Ga0207671_101655852 | 319 |
| 222 | 3300025915 | Ga0207693_10003111 | Ga0207693_100031115 | 319 |
| 223 | 3300025916 | Ga0207663_10071431 | Ga0207663_100714312 | 319 |
| 224 | 3300025919 | Ga0207657_10041809 | Ga0207657_100418092 | 319 |
| 225 | 3300025921 | Ga0207652_10045624 | Ga0207652_100456243 | 319 |
| 226 | 3300025921 | Ga0207652_10185463 | Ga0207652_101854632 | 319 |
| 227 | 3300025924 | Ga0207694_10065048 | Ga0207694_100650482 | 319 |
| 228 | 3300025931 | Ga0207644_10073756 | Ga0207644_100737562 | 319 |
| 229 | 3300025932 | Ga0207690_10010832 | Ga0207690_100108324 | 319 |
| 230 | 3300025934 | Ga0207686_10015044 | Ga0207686_100150444 | 319 |
| 231 | 3300025935 | Ga0207709_10041155 | Ga0207709_100411553 | 319 |
| 232 | 3300025936 | Ga0207670_10101397 | Ga0207670_101013971 | 319 |
| 233 | 3300025937 | Ga0207669_10050346 | Ga0207669_100503462 | 319 |
| 234 | 3300025938 | Ga0207704_10096173 | Ga0207704_100961732 | 319 |
| 235 | 3300025941 | Ga0207711_10064405 | Ga0207711_100644052 | 319 |
| 236 | 3300025944 | Ga0207661_10007905 | Ga0207661_100079052 | 319 |
| 237 | 3300025961 | Ga0207712_10007633 | Ga0207712_100076336 | 319 |
| 238 | 3300025986 | Ga0207658_10118034 | Ga0207658_101180342 | 319 |
| 239 | 3300026041 | Ga0207639_10006305 | Ga0207639_100063053 | 319 |
| 240 | 3300026067 | Ga0207678_10032323 | Ga0207678_100323234 | 319 |
| 241 | 3300026075 | Ga0207708_10000810 | Ga0207708_1000081016 | 319 |
| 242 | 3300026078 | Ga0207702_10015689 | Ga0207702_100156894 | 319 |
| 243 | 3300026088 | Ga0207641_10093042 | Ga0207641_100930422 | 319 |
| 244 | 3300026089 | Ga0207648_10009659 | Ga0207648_100096593 | 319 |
| 245 | 3300026116 | Ga0207674_10045208 | Ga0207674_100452083 | 319 |
| 246 | 3300026121 | Ga0207683_10000252 | Ga0207683_1000025220 | 319 |
| 247 | 3300026142 | Ga0207698_10005113 | Ga0207698_100051135 | 319 |
| 248 | 3300028379 | Ga0268266_10085152 | Ga0268266_100851522 | 319 |
| 249 | 3300028380 | Ga0268265_10497791 | Ga0268265_104977911 | 319 |
| 250 | 3300031251 | Ga0265327_10017052 | Ga0265327_100170522 | 319 |
| 251 | 3300037418 | Ga0395900_0011462 | Ga0395900_0011462_7970_8959 | 319 |
| 252 | 3300037466 | Ga0395898_0004053 | Ga0395898_0004053_7927_8916 | 319 |
| 253 | 3300038443 | Ga0395901_0002362 | Ga0395901_0002362_13262_14251 | 319 |
| 254 | 3300045976 | Ga0466967_0040162 | Ga0466967_0040162_1083_2099 | 319 |
| 255 | 3300046472 | Ga0495580_0129620 | Ga0495580_0129620_715_1731 | 319 |
| 256 | 3300046473 | Ga0495582_0022599 | Ga0495582_0022599_1456_2472 | 319 |
| 257 | 3300046473 | Ga0495582_0061834 | Ga0495582_0061834_593_1609 | 319 |
| 258 | 3300046475 | Ga0495639_0020639 | Ga0495639_0020639_313_1329 | 319 |
| 259 | 3300046476 | Ga0495662_0079017 | Ga0495662_0079017_248_1264 | 319 |
| 260 | 3300046664 | Ga0495659_0027997 | Ga0495659_0027997_211_1227 | 319 |
| 261 | 3300046681 | Ga0495647_0018449 | Ga0495647_0018449_894_1910 | 319 |
| 262 | 3300046683 | Ga0495658_0036006 | Ga0495658_0036006_279_1295 | 319 |
| 263 | 3300046691 | Ga0495670_0161051 | Ga0495670_0161051_51_1067 | 319 |
| 264 | 3300047315 | Ga0495581_0005360 | Ga0495581_0005360_2575_3591 | 319 |
| 265 | 3300047321 | Ga0495676_0046069 | Ga0495676_0046069_903_1919 | 319 |
| 266 | 3300047445 | Ga0495677_0037618 | Ga0495677_0037618_597_1616 | 319 |
| 267 | 3300048903 | Ga0496100_0025189 | Ga0496100_0025189_1062_2078 | 319 |
| 268 | 3300048904 | Ga0496101_0076314 | Ga0496101_0076314_556_1572 | 319 |
| 269 | 3300048905 | Ga0496102_0013176 | Ga0496102_0013176_2243_3259 | 319 |
| 270 | 3300048906 | Ga0496103_0001098 | Ga0496103_0001098_4331_5347 | 319 |
| 271 | 3300048907 | Ga0496104_0174272 | Ga0496104_0174272_680_1696 | 319 |
| 272 | 3300048907 | Ga0496104_0261607 | Ga0496104_0261607_505_1521 | 319 |
| 273 | 3300048908 | Ga0496105_0011949 | Ga0496105_0011949_4840_5856 | 319 |
| 274 | 3300048912 | Ga0496109_0010798 | Ga0496109_0010798_6125_7141 | 319 |
| 275 | 3300048912 | Ga0496109_0020464 | Ga0496109_0020464_3072_4088 | 319 |
| 276 | 3300048913 | Ga0496110_0134571 | Ga0496110_0134571_367_1383 | 319 |
| 277 | 3300048915 | Ga0496112_0053498 | Ga0496112_0053498_1034_2050 | 319 |
| 278 | 3300048915 | Ga0496112_0142496 | Ga0496112_0142496_289_1305 | 319 |
| 279 | 3300048916 | Ga0496113_0042241 | Ga0496113_0042241_1652_2668 | 319 |
| 280 | 3300048917 | Ga0496114_0001599 | Ga0496114_0001599_677_1693 | 319 |
| 281 | 3300048918 | Ga0496115_0014202 | Ga0496115_0014202_1082_2098 | 319 |
| 282 | 3300005356 | Ga0070674_100083116 | Ga0070674_1000831162 | 320 |
| 283 | 3300005364 | Ga0070673_100204864 | Ga0070673_1002048642 | 320 |
| 284 | 3300005366 | Ga0070659_100271738 | Ga0070659_1002717381 | 320 |
| 285 | 3300005435 | Ga0070714_100006112 | Ga0070714_1000061129 | 320 |
| 286 | 3300005548 | Ga0070665_100222123 | Ga0070665_1002221232 | 320 |
| 287 | 3300005618 | Ga0068864_100485129 | Ga0068864_1004851291 | 320 |
| 288 | 3300014325 | Ga0163163_10307800 | Ga0163163_103078002 | 320 |
| 289 | 3300025908 | Ga0207643_10024559 | Ga0207643_100245594 | 320 |
| 290 | 3300026095 | Ga0207676_10080583 | Ga0207676_100805833 | 320 |
| 291 | 3300026118 | Ga0207675_100332477 | Ga0207675_1003324772 | 320 |
| 292 | 3300026121 | Ga0207683_10132264 | Ga0207683_101322642 | 320 |
| 293 | 3300026142 | Ga0207698_10389939 | Ga0207698_103899392 | 320 |
| 294 | 3300037418 | Ga0395900_0085144 | Ga0395900_0085144_149_1138 | 320 |
| 295 | 3300037466 | Ga0395898_0090718 | Ga0395898_0090718_1884_2891 | 320 |
| 296 | 3300037471 | Ga0395905_0036137 | Ga0395905_0036137_2201_3208 | 320 |
| 297 | 3300038443 | Ga0395901_0383372 | Ga0395901_0383372_105_1094 | 320 |
| 298 | 3300044656 | Ga0466969_0028617 | Ga0466969_0028617_329_1345 | 320 |
| 299 | 3300045049 | Ga0466959_0068084 | Ga0466959_0068084_897_1913 | 320 |
| 300 | 3300045836 | Ga0466958_0026768 | Ga0466958_0026768_1373_2389 | 320 |
| 301 | 3300046472 | Ga0495580_0307560 | Ga0495580_0307560_45_1064 | 320 |
| 302 | 3300046663 | Ga0495635_0091172 | Ga0495635_0091172_330_1340 | 320 |
| 303 | 3300048917 | Ga0496114_0362032 | Ga0496114_0362032_25_1044 | 320 |
| 304 | 3300049583 | Ga0501067_0011161 | Ga0501067_0011161_554_1555 | 320 |
| 305 | 3300049584 | Ga0501068_0015159 | Ga0501068_0015159_2349_3350 | 320 |
| 306 | 3300049588 | Ga0501072_0003295 | Ga0501072_0003295_3033_4028 | 320 |
| 307 | 3300049589 | Ga0501073_0048465 | Ga0501073_0048465_731_1726 | 320 |
| 308 | 3300049741 | Ga0501079_0063257 | Ga0501079_0063257_1279_2274 | 320 |
| 309 | 3300049742 | Ga0501080_0117392 | Ga0501080_0117392_1076_2071 | 320 |
| 310 | 3300049744 | Ga0501083_0005263 | Ga0501083_0005263_4929_5924 | 320 |
| 311 | 3300050512 | nmdc:mga0n895_151006_c1 | nmdc:mga0n895_151006_c1_301_1308 | 320 |
| 312 | 3300054114 | Ga0501084_0123656 | Ga0501084_0123656_958_1953 | 320 |
| 313 | 3300060353 | Ga0501082_0037598 | Ga0501082_0037598_2178_3173 | 320 |
| 314 | 3300061734 | Ga0530510_0007443 | Ga0530510_0007443_2763_3764 | 320 |
| 315 | 3300005985 | Ga0081539_10080617 | Ga0081539_100806172 | 321 |
| 316 | 3300025922 | Ga0207646_10182242 | Ga0207646_101822422 | 321 |
| 317 | 3300037471 | Ga0395905_0430476 | Ga0395905_0430476_168_1175 | 321 |
| 318 | 3300042876 | Ga0451577_0233390 | Ga0451577_0233390_389_1408 | 321 |
| 319 | 3300048906 | Ga0496103_0100236 | Ga0496103_0100236_674_1693 | 321 |
| 320 | 3300048909 | Ga0496106_0008645 | Ga0496106_0008645_6197_7216 | 321 |
| 321 | 3300048910 | Ga0496107_0159835 | Ga0496107_0159835_289_1308 | 321 |
| 322 | 3300048915 | Ga0496112_0138463 | Ga0496112_0138463_460_1461 | 321 |
| 323 | 3300001977 | JGI24746J21847_1000628 | JGI24746J21847_10006282 | 327 |
| 324 | 3300001978 | JGI24747J21853_1000673 | JGI24747J21853_10006732 | 327 |
| 325 | 3300002070 | JGI24750J21931_1001624 | JGI24750J21931_10016243 | 327 |
| 326 | 3300002073 | JGI24745J21846_1000282 | JGI24745J21846_10002822 | 327 |
| 327 | 3300002075 | JGI24738J21930_10000115 | JGI24738J21930_100001155 | 327 |
| 328 | 3300002076 | JGI24749J21850_1002054 | JGI24749J21850_10020541 | 327 |
| 329 | 3300002239 | JGI24034J26672_10009253 | JGI24034J26672_100092532 | 327 |
| 330 | 3300005328 | Ga0070676_10007560 | Ga0070676_100075601 | 327 |
| 331 | 3300005329 | Ga0070683_100014617 | Ga0070683_1000146177 | 327 |
| 332 | 3300005331 | Ga0070670_100004139 | Ga0070670_1000041398 | 327 |
| 333 | 3300005334 | Ga0068869_100003359 | Ga0068869_1000033594 | 327 |
| 334 | 3300005334 | Ga0068869_100335283 | Ga0068869_1003352832 | 327 |
| 335 | 3300005337 | Ga0070682_100007259 | Ga0070682_1000072595 | 327 |
| 336 | 3300005338 | Ga0068868_100001391 | Ga0068868_1000013916 | 327 |
| 337 | 3300005338 | Ga0068868_100127166 | Ga0068868_1001271662 | 327 |
| 338 | 3300005339 | Ga0070660_100010779 | Ga0070660_1000107791 | 327 |
| 339 | 3300005340 | Ga0070689_100223482 | Ga0070689_1002234822 | 327 |
| 340 | 3300005343 | Ga0070687_100000229 | Ga0070687_10000022921 | 327 |
| 341 | 3300005344 | Ga0070661_100000590 | Ga0070661_10000059013 | 327 |
| 342 | 3300005345 | Ga0070692_10003402 | Ga0070692_100034023 | 327 |
| 343 | 3300005347 | Ga0070668_100021641 | Ga0070668_1000216414 | 327 |
| 344 | 3300005355 | Ga0070671_100007239 | Ga0070671_1000072395 | 327 |
| 345 | 3300005364 | Ga0070673_100000944 | Ga0070673_1000009442 | 327 |
| 346 | 3300005365 | Ga0070688_100000244 | Ga0070688_10000024415 | 327 |
| 347 | 3300005365 | Ga0070688_100117118 | Ga0070688_1001171182 | 327 |
| 348 | 3300005406 | Ga0070703_10002303 | Ga0070703_100023032 | 327 |
| 349 | 3300005435 | Ga0070714_100037937 | Ga0070714_1000379373 | 327 |
| 350 | 3300005436 | Ga0070713_100003728 | Ga0070713_1000037283 | 327 |
| 351 | 3300005437 | Ga0070710_10001039 | Ga0070710_100010399 | 327 |
| 352 | 3300005438 | Ga0070701_10000326 | Ga0070701_1000032610 | 327 |
| 353 | 3300005440 | Ga0070705_100009155 | Ga0070705_1000091552 | 327 |
| 354 | 3300005441 | Ga0070700_100066424 | Ga0070700_1000664243 | 327 |
| 355 | 3300005444 | Ga0070694_100001729 | Ga0070694_10000172910 | 327 |
| 356 | 3300005455 | Ga0070663_100009511 | Ga0070663_1000095115 | 327 |
| 357 | 3300005459 | Ga0068867_100008148 | Ga0068867_1000081485 | 327 |
| 358 | 3300005466 | Ga0070685_10125790 | Ga0070685_101257902 | 327 |
| 359 | 3300005539 | Ga0068853_100011556 | Ga0068853_1000115565 | 327 |
| 360 | 3300005543 | Ga0070672_100092698 | Ga0070672_1000926982 | 327 |
| 361 | 3300005544 | Ga0070686_100010757 | Ga0070686_1000107572 | 327 |
| 362 | 3300005544 | Ga0070686_100042116 | Ga0070686_1000421163 | 327 |
| 363 | 3300005545 | Ga0070695_100003280 | Ga0070695_1000032805 | 327 |
| 364 | 3300005545 | Ga0070695_100086344 | Ga0070695_1000863442 | 327 |
| 365 | 3300005547 | Ga0070693_100006632 | Ga0070693_1000066325 | 327 |
| 366 | 3300005548 | Ga0070665_100110056 | Ga0070665_1001100562 | 327 |
| 367 | 3300005549 | Ga0070704_100000158 | Ga0070704_10000015821 | 327 |
| 368 | 3300005563 | Ga0068855_100021021 | Ga0068855_1000210216 | 327 |
| 369 | 3300005564 | Ga0070664_100024670 | Ga0070664_1000246702 | 327 |
| 370 | 3300005614 | Ga0068856_100026039 | Ga0068856_1000260395 | 327 |
| 371 | 3300005615 | Ga0070702_100000280 | Ga0070702_1000002805 | 327 |
| 372 | 3300005615 | Ga0070702_100085068 | Ga0070702_1000850681 | 327 |
| 373 | 3300005617 | Ga0068859_100002498 | Ga0068859_1000024983 | 327 |
| 374 | 3300005618 | Ga0068864_100000140 | Ga0068864_10000014011 | 327 |
| 375 | 3300005618 | Ga0068864_100152508 | Ga0068864_1001525082 | 327 |
| 376 | 3300005719 | Ga0068861_100001125 | Ga0068861_1000011252 | 327 |
| 377 | 3300005840 | Ga0068870_10000135 | Ga0068870_1000013511 | 327 |
| 378 | 3300005841 | Ga0068863_100018428 | Ga0068863_1000184285 | 327 |
| 379 | 3300005843 | Ga0068860_100003390 | Ga0068860_1000033905 | 327 |
| 380 | 3300005843 | Ga0068860_100209682 | Ga0068860_1002096822 | 327 |
| 381 | 3300005844 | Ga0068862_100004234 | Ga0068862_1000042345 | 327 |
| 382 | 3300005937 | Ga0081455_10000091 | Ga0081455_10000091104 | 327 |
| 383 | 3300005937 | Ga0081455_10003576 | Ga0081455_100035763 | 327 |
| 384 | 3300005983 | Ga0081540_1031742 | Ga0081540_10317423 | 327 |
| 385 | 3300006028 | Ga0070717_10022083 | Ga0070717_100220833 | 327 |
| 386 | 3300006058 | Ga0075432_10011193 | Ga0075432_100111933 | 327 |
| 387 | 3300006173 | Ga0070716_100232448 | Ga0070716_1002324481 | 327 |
| 388 | 3300006175 | Ga0070712_100376533 | Ga0070712_1003765331 | 327 |
| 389 | 3300006237 | Ga0097621_100004183 | Ga0097621_10000418310 | 327 |
| 390 | 3300006358 | Ga0068871_100001664 | Ga0068871_1000016649 | 327 |
| 391 | 3300006846 | Ga0075430_100001022 | Ga0075430_1000010227 | 327 |
| 392 | 3300006852 | Ga0075433_10002104 | Ga0075433_1000210412 | 327 |
| 393 | 3300006852 | Ga0075433_10003427 | Ga0075433_100034276 | 327 |
| 394 | 3300006852 | Ga0075433_10058778 | Ga0075433_100587782 | 327 |
| 395 | 3300006871 | Ga0075434_100001215 | Ga0075434_10000121512 | 327 |
| 396 | 3300006871 | Ga0075434_100085660 | Ga0075434_1000856603 | 327 |
| 397 | 3300006880 | Ga0075429_100000941 | Ga0075429_10000094116 | 327 |
| 398 | 3300006881 | Ga0068865_100009549 | Ga0068865_1000095492 | 327 |
| 399 | 3300006931 | Ga0097620_100002498 | Ga0097620_10000249823 | 327 |
| 400 | 3300007076 | Ga0075435_100016572 | Ga0075435_1000165723 | 327 |
| 401 | 3300007076 | Ga0075435_100057327 | Ga0075435_1000573273 | 327 |
| 402 | 3300007076 | Ga0075435_100086912 | Ga0075435_1000869122 | 327 |
| 403 | 3300009011 | Ga0105251_10012354 | Ga0105251_100123541 | 327 |
| 404 | 3300009092 | Ga0105250_10009975 | Ga0105250_100099752 | 327 |
| 405 | 3300009093 | Ga0105240_10064357 | Ga0105240_100643573 | 327 |
| 406 | 3300009094 | Ga0111539_10001115 | Ga0111539_100011156 | 327 |
| 407 | 3300009098 | Ga0105245_10001824 | Ga0105245_100018246 | 327 |
| 408 | 3300009101 | Ga0105247_10028201 | Ga0105247_100282012 | 327 |
| 409 | 3300009101 | Ga0105247_10073089 | Ga0105247_100730892 | 327 |
| 410 | 3300009147 | Ga0114129_10001230 | Ga0114129_100012309 | 327 |
| 411 | 3300009147 | Ga0114129_10005318 | Ga0114129_100053186 | 327 |
| 412 | 3300009148 | Ga0105243_10001397 | Ga0105243_1000139716 | 327 |
| 413 | 3300009174 | Ga0105241_10000586 | Ga0105241_1000058610 | 327 |
| 414 | 3300009176 | Ga0105242_10001675 | Ga0105242_1000167511 | 327 |
| 415 | 3300009177 | Ga0105248_10048114 | Ga0105248_100481142 | 327 |
| 416 | 3300009551 | Ga0105238_10096336 | Ga0105238_100963362 | 327 |
| 417 | 3300009551 | Ga0105238_10411241 | Ga0105238_104112412 | 327 |
| 418 | 3300009553 | Ga0105249_10001526 | Ga0105249_1000152616 | 327 |
| 419 | 3300009553 | Ga0105249_10180693 | Ga0105249_101806932 | 327 |
| 420 | 3300010375 | Ga0105239_10040455 | Ga0105239_100404554 | 327 |
| 421 | 3300011119 | Ga0105246_10003116 | Ga0105246_100031165 | 327 |
| 422 | 3300013100 | Ga0157373_10001384 | Ga0157373_100013846 | 327 |
| 423 | 3300013102 | Ga0157371_10016190 | Ga0157371_100161905 | 327 |
| 424 | 3300013296 | Ga0157374_10003666 | Ga0157374_100036667 | 327 |
| 425 | 3300013296 | Ga0157374_10093346 | Ga0157374_100933462 | 327 |
| 426 | 3300013297 | Ga0157378_10002087 | Ga0157378_1000208713 | 327 |
| 427 | 3300013297 | Ga0157378_10072592 | Ga0157378_100725922 | 327 |
| 428 | 3300013306 | Ga0163162_10003585 | Ga0163162_1000358513 | 327 |
| 429 | 3300013306 | Ga0163162_10376955 | Ga0163162_103769552 | 327 |
| 430 | 3300013306 | Ga0163162_10402907 | Ga0163162_104029072 | 327 |
| 431 | 3300013307 | Ga0157372_10003728 | Ga0157372_100037287 | 327 |
| 432 | 3300013308 | Ga0157375_10004460 | Ga0157375_100044607 | 327 |
| 433 | 3300014325 | Ga0163163_10006523 | Ga0163163_1000652310 | 327 |
| 434 | 3300014326 | Ga0157380_10005060 | Ga0157380_100050605 | 327 |
| 435 | 3300014745 | Ga0157377_10000449 | Ga0157377_1000044915 | 327 |
| 436 | 3300014968 | Ga0157379_10002609 | Ga0157379_100026093 | 327 |
| 437 | 3300014968 | Ga0157379_10144179 | Ga0157379_101441792 | 327 |
| 438 | 3300014968 | Ga0157379_10160943 | Ga0157379_101609432 | 327 |
| 439 | 3300025271 | Ga0207666_1000053 | Ga0207666_100005310 | 327 |
| 440 | 3300025290 | Ga0207673_1000140 | Ga0207673_10001406 | 327 |
| 441 | 3300025315 | Ga0207697_10000314 | Ga0207697_1000031412 | 327 |
| 442 | 3300025885 | Ga0207653_10002698 | Ga0207653_100026982 | 327 |
| 443 | 3300025893 | Ga0207682_10000104 | Ga0207682_1000010413 | 327 |
| 444 | 3300025898 | Ga0207692_10001611 | Ga0207692_100016113 | 327 |
| 445 | 3300025899 | Ga0207642_10182659 | Ga0207642_101826592 | 327 |
| 446 | 3300025900 | Ga0207710_10001384 | Ga0207710_100013842 | 327 |
| 447 | 3300025900 | Ga0207710_10011813 | Ga0207710_100118133 | 327 |
| 448 | 3300025901 | Ga0207688_10000236 | Ga0207688_1000023613 | 327 |
| 449 | 3300025904 | Ga0207647_10002772 | Ga0207647_100027723 | 327 |
| 450 | 3300025906 | Ga0207699_10005502 | Ga0207699_100055022 | 327 |
| 451 | 3300025907 | Ga0207645_10001219 | Ga0207645_1000121916 | 327 |
| 452 | 3300025908 | Ga0207643_10000035 | Ga0207643_1000003515 | 327 |
| 453 | 3300025912 | Ga0207707_10005181 | Ga0207707_100051811 | 327 |
| 454 | 3300025913 | Ga0207695_10122946 | Ga0207695_101229462 | 327 |
| 455 | 3300025915 | Ga0207693_10213278 | Ga0207693_102132782 | 327 |
| 456 | 3300025917 | Ga0207660_10001787 | Ga0207660_1000178713 | 327 |
| 457 | 3300025918 | Ga0207662_10000401 | Ga0207662_100004015 | 327 |
| 458 | 3300025919 | Ga0207657_10001276 | Ga0207657_1000127615 | 327 |
| 459 | 3300025920 | Ga0207649_10000309 | Ga0207649_1000030910 | 327 |
| 460 | 3300025921 | Ga0207652_10003742 | Ga0207652_100037425 | 327 |
| 461 | 3300025923 | Ga0207681_10002035 | Ga0207681_100020352 | 327 |
| 462 | 3300025925 | Ga0207650_10045783 | Ga0207650_100457832 | 327 |
| 463 | 3300025926 | Ga0207659_10000633 | Ga0207659_1000063316 | 327 |
| 464 | 3300025927 | Ga0207687_10000959 | Ga0207687_1000095911 | 327 |
| 465 | 3300025927 | Ga0207687_10105437 | Ga0207687_101054371 | 327 |
| 466 | 3300025927 | Ga0207687_10220570 | Ga0207687_102205702 | 327 |
| 467 | 3300025928 | Ga0207700_10011701 | Ga0207700_100117015 | 327 |
| 468 | 3300025931 | Ga0207644_10002922 | Ga0207644_100029227 | 327 |
| 469 | 3300025931 | Ga0207644_10006179 | Ga0207644_100061793 | 327 |
| 470 | 3300025931 | Ga0207644_10033856 | Ga0207644_100338562 | 327 |
| 471 | 3300025932 | Ga0207690_10170454 | Ga0207690_101704541 | 327 |
| 472 | 3300025933 | Ga0207706_10004534 | Ga0207706_100045347 | 327 |
| 473 | 3300025934 | Ga0207686_10001230 | Ga0207686_100012307 | 327 |
| 474 | 3300025934 | Ga0207686_10028894 | Ga0207686_100288942 | 327 |
| 475 | 3300025935 | Ga0207709_10035428 | Ga0207709_100354282 | 327 |
| 476 | 3300025936 | Ga0207670_10002361 | Ga0207670_100023617 | 327 |
| 477 | 3300025936 | Ga0207670_10380160 | Ga0207670_103801601 | 327 |
| 478 | 3300025937 | Ga0207669_10000340 | Ga0207669_1000034011 | 327 |
| 479 | 3300025938 | Ga0207704_10004184 | Ga0207704_100041842 | 327 |
| 480 | 3300025939 | Ga0207665_10001875 | Ga0207665_1000187510 | 327 |
| 481 | 3300025940 | Ga0207691_10001336 | Ga0207691_1000133612 | 327 |
| 482 | 3300025941 | Ga0207711_10004667 | Ga0207711_100046678 | 327 |
| 483 | 3300025941 | Ga0207711_10086673 | Ga0207711_100866732 | 327 |
| 484 | 3300025942 | Ga0207689_10000168 | Ga0207689_1000016827 | 327 |
| 485 | 3300025942 | Ga0207689_10083231 | Ga0207689_100832313 | 327 |
| 486 | 3300025944 | Ga0207661_10001339 | Ga0207661_100013392 | 327 |
| 487 | 3300025945 | Ga0207679_10000035 | Ga0207679_10000035121 | 327 |
| 488 | 3300025945 | Ga0207679_10164432 | Ga0207679_101644322 | 327 |
| 489 | 3300025949 | Ga0207667_10006315 | Ga0207667_100063155 | 327 |
| 490 | 3300025960 | Ga0207651_10000233 | Ga0207651_100002332 | 327 |
| 491 | 3300025960 | Ga0207651_10210410 | Ga0207651_102104102 | 327 |
| 492 | 3300025972 | Ga0207668_10001502 | Ga0207668_1000150213 | 327 |
| 493 | 3300025981 | Ga0207640_10000693 | Ga0207640_100006937 | 327 |
| 494 | 3300025986 | Ga0207658_10001140 | Ga0207658_100011406 | 327 |
| 495 | 3300026023 | Ga0207677_10002446 | Ga0207677_100024464 | 327 |
| 496 | 3300026023 | Ga0207677_10015236 | Ga0207677_100152363 | 327 |
| 497 | 3300026035 | Ga0207703_10006941 | Ga0207703_100069417 | 327 |
| 498 | 3300026035 | Ga0207703_10032135 | Ga0207703_100321352 | 327 |
| 499 | 3300026067 | Ga0207678_10003989 | Ga0207678_100039898 | 327 |
| 500 | 3300026067 | Ga0207678_10038465 | Ga0207678_100384652 | 327 |
| 501 | 3300026067 | Ga0207678_10496748 | Ga0207678_104967481 | 327 |
| 502 | 3300026075 | Ga0207708_10000906 | Ga0207708_1000090616 | 327 |
| 503 | 3300026078 | Ga0207702_10009427 | Ga0207702_100094273 | 327 |
| 504 | 3300026088 | Ga0207641_10005232 | Ga0207641_100052324 | 327 |
| 505 | 3300026088 | Ga0207641_10234748 | Ga0207641_102347482 | 327 |
| 506 | 3300026089 | Ga0207648_10002655 | Ga0207648_100026558 | 327 |
| 507 | 3300026095 | Ga0207676_10000849 | Ga0207676_1000084910 | 327 |
| 508 | 3300026116 | Ga0207674_10000535 | Ga0207674_1000053516 | 327 |
| 509 | 3300026118 | Ga0207675_100000365 | Ga0207675_10000036516 | 327 |
| 510 | 3300026121 | Ga0207683_10000667 | Ga0207683_100006678 | 327 |
| 511 | 3300026142 | Ga0207698_10009827 | Ga0207698_100098275 | 327 |
| 512 | 3300027252 | Ga0209973_1000555 | Ga0209973_10005552 | 327 |
| 513 | 3300027552 | Ga0209982_1011965 | Ga0209982_10119652 | 327 |
| 514 | 3300027617 | Ga0210002_1000993 | Ga0210002_10009933 | 327 |
| 515 | 3300027717 | Ga0209998_10000681 | Ga0209998_100006816 | 327 |
| 516 | 3300027907 | Ga0207428_10000415 | Ga0207428_1000041527 | 327 |
| 517 | 3300027907 | Ga0207428_10000636 | Ga0207428_100006367 | 327 |
| 518 | 3300028379 | Ga0268266_10013796 | Ga0268266_100137963 | 327 |
| 519 | 3300028379 | Ga0268266_10044143 | Ga0268266_100441432 | 327 |
| 520 | 3300028380 | Ga0268265_10015552 | Ga0268265_100155525 | 327 |
| 521 | 3300028380 | Ga0268265_10395432 | Ga0268265_103954322 | 327 |
| 522 | 3300028381 | Ga0268264_10002536 | Ga0268264_1000253612 | 327 |
| 523 | 3300034816 | Ga0373930_0003780 | Ga0373930_0003780_188_1171 | 327 |
| 524 | 3300034820 | Ga0373959_0026438 | Ga0373959_0026438_101_1084 | 327 |
| 525 | 3300035084 | Ga0373928_0002818 | Ga0373928_0002818_919_1902 | 327 |
| 526 | 3300035084 | Ga0373928_0007888 | Ga0373928_0007888_380_1363 | 327 |
| 527 | 3300035088 | Ga0373940_0007701 | Ga0373940_0007701_1102_2085 | 327 |
| 528 | 3300035090 | Ga0373949_0001131 | Ga0373949_0001131_3455_4438 | 327 |
| 529 | 3300035112 | Ga0373932_0001355 | Ga0373932_0001355_3885_4868 | 327 |
| 530 | 3300035112 | Ga0373932_0009796 | Ga0373932_0009796_1307_2290 | 327 |
| 531 | 3300035114 | Ga0373939_0001134 | Ga0373939_0001134_1788_2771 | 327 |
| 532 | 3300035115 | Ga0373941_0001699 | Ga0373941_0001699_2674_3657 | 327 |
| 533 | 3300035121 | Ga0373960_0003108 | Ga0373960_0003108_1601_2584 | 327 |
| 534 | 3300035121 | Ga0373960_0013833 | Ga0373960_0013833_283_1266 | 327 |
| 535 | 3300035170 | Ga0373943_0010005 | Ga0373943_0010005_2670_3653 | 327 |
| 536 | 3300035171 | Ga0373946_0006407 | Ga0373946_0006407_928_1911 | 327 |
| 537 | 3300035691 | Ga0373931_0003872 | Ga0373931_0003872_1245_2228 | 327 |
| 538 | 3300035695 | Ga0373927_0015576 | Ga0373927_0015576_2562_3545 | 327 |
| 539 | 3300035725 | Ga0373947_0008622 | Ga0373947_0008622_2121_3104 | 327 |
| 540 | 3300037068 | Ga0373925_0063842 | Ga0373925_0063842_840_1823 | 327 |
| 541 | 3300046455 | Ga0495603_0005620 | Ga0495603_0005620_6036_7019 | 327 |
| 542 | 3300046459 | Ga0495629_0001287 | Ga0495629_0001287_8482_9465 | 327 |
| 543 | 3300046473 | Ga0495582_0009997 | Ga0495582_0009997_2785_3768 | 327 |
| 544 | 3300046499 | Ga0495594_0004071 | Ga0495594_0004071_2180_3163 | 327 |
| 545 | 3300046681 | Ga0495647_0018673 | Ga0495647_0018673_1057_2040 | 327 |
| 546 | 3300046683 | Ga0495658_0008547 | Ga0495658_0008547_1926_2909 | 327 |
| 547 | 3300046689 | Ga0495613_0023263 | Ga0495613_0023263_1188_2171 | 327 |
| 548 | 3300047315 | Ga0495581_0017198 | Ga0495581_0017198_2915_3898 | 327 |
| 549 | 3300047322 | Ga0495680_0016363 | Ga0495680_0016363_4578_5561 | 327 |
| 550 | 3300047673 | Ga0495593_0005907 | Ga0495593_0005907_4831_5814 | 327 |
| 551 | 3300048089 | Ga0495614_0026782 | Ga0495614_0026782_338_1321 | 327 |
| 552 | 3300048903 | Ga0496100_0014653 | Ga0496100_0014653_533_1516 | 327 |
| 553 | 3300048903 | Ga0496100_0015937 | Ga0496100_0015937_314_1297 | 327 |
| 554 | 3300048903 | Ga0496100_0130498 | Ga0496100_0130498_254_1237 | 327 |
| 555 | 3300048904 | Ga0496101_0007689 | Ga0496101_0007689_1881_2864 | 327 |
| 556 | 3300048904 | Ga0496101_0073634 | Ga0496101_0073634_1063_2046 | 327 |
| 557 | 3300048905 | Ga0496102_0005971 | Ga0496102_0005971_1673_2656 | 327 |
| 558 | 3300048905 | Ga0496102_0013322 | Ga0496102_0013322_226_1209 | 327 |
| 559 | 3300048905 | Ga0496102_0032372 | Ga0496102_0032372_597_1580 | 327 |
| 560 | 3300048906 | Ga0496103_0000959 | Ga0496103_0000959_4417_5400 | 327 |
| 561 | 3300048906 | Ga0496103_0003949 | Ga0496103_0003949_4032_5015 | 327 |
| 562 | 3300048906 | Ga0496103_0008320 | Ga0496103_0008320_1042_2025 | 327 |
| 563 | 3300048906 | Ga0496103_0036968 | Ga0496103_0036968_1114_2097 | 327 |
| 564 | 3300048907 | Ga0496104_0008532 | Ga0496104_0008532_6736_7719 | 327 |
| 565 | 3300048907 | Ga0496104_0028388 | Ga0496104_0028388_837_1820 | 327 |
| 566 | 3300048907 | Ga0496104_0116041 | Ga0496104_0116041_1063_2046 | 327 |
| 567 | 3300048908 | Ga0496105_0022682 | Ga0496105_0022682_923_1906 | 327 |
| 568 | 3300048908 | Ga0496105_0051522 | Ga0496105_0051522_1495_2478 | 327 |
| 569 | 3300048908 | Ga0496105_0140930 | Ga0496105_0140930_523_1506 | 327 |
| 570 | 3300048909 | Ga0496106_0014782 | Ga0496106_0014782_1685_2668 | 327 |
| 571 | 3300048910 | Ga0496107_0012134 | Ga0496107_0012134_1847_2830 | 327 |
| 572 | 3300048910 | Ga0496107_0020565 | Ga0496107_0020565_3182_4165 | 327 |
| 573 | 3300048910 | Ga0496107_0022086 | Ga0496107_0022086_3452_4435 | 327 |
| 574 | 3300048911 | Ga0496108_0006621 | Ga0496108_0006621_1063_2046 | 327 |
| 575 | 3300048911 | Ga0496108_0013281 | Ga0496108_0013281_533_1516 | 327 |
| 576 | 3300048911 | Ga0496108_0022558 | Ga0496108_0022558_2329_3312 | 327 |
| 577 | 3300048911 | Ga0496108_0033044 | Ga0496108_0033044_859_1842 | 327 |
| 578 | 3300048912 | Ga0496109_0000575 | Ga0496109_0000575_11243_12226 | 327 |
| 579 | 3300048912 | Ga0496109_0008219 | Ga0496109_0008219_3226_4209 | 327 |
| 580 | 3300048912 | Ga0496109_0008961 | Ga0496109_0008961_7330_8313 | 327 |
| 581 | 3300048912 | Ga0496109_0013319 | Ga0496109_0013319_1500_2483 | 327 |
| 582 | 3300048914 | Ga0496111_0002998 | Ga0496111_0002998_1575_2558 | 327 |
| 583 | 3300048914 | Ga0496111_0031145 | Ga0496111_0031145_923_1906 | 327 |
| 584 | 3300048914 | Ga0496111_0137423 | Ga0496111_0137423_382_1365 | 327 |
| 585 | 3300048915 | Ga0496112_0092349 | Ga0496112_0092349_923_1906 | 327 |
| 586 | 3300048915 | Ga0496112_0188595 | Ga0496112_0188595_524_1507 | 327 |
| 587 | 3300048916 | Ga0496113_0016623 | Ga0496113_0016623_923_1906 | 327 |
| 588 | 3300048916 | Ga0496113_0023132 | Ga0496113_0023132_3182_4165 | 327 |
| 589 | 3300048916 | Ga0496113_0042805 | Ga0496113_0042805_2061_3044 | 327 |
| 590 | 3300048916 | Ga0496113_0126814 | Ga0496113_0126814_923_1906 | 327 |
| 591 | 3300048917 | Ga0496114_0014385 | Ga0496114_0014385_2953_3936 | 327 |
| 592 | 3300048917 | Ga0496114_0207578 | Ga0496114_0207578_393_1376 | 327 |
| 593 | 3300048918 | Ga0496115_0007947 | Ga0496115_0007947_1837_2820 | 327 |
| 594 | 3300048918 | Ga0496115_0009498 | Ga0496115_0009498_5178_6161 | 327 |
| 595 | 3300050507 | nmdc:mga05p37_281_c1 | nmdc:mga05p37_281_c1_39631_40614 | 327 |
| 596 | 3300050507 | nmdc:mga05p37_938_c1 | nmdc:mga05p37_938_c1_14138_15121 | 327 |
| 597 | 3300050510 | nmdc:mga06r32_2024_c1 | nmdc:mga06r32_2024_c1_11792_12775 | 327 |
| 598 | 3300050511 | nmdc:mga08y16_912_c1 | nmdc:mga08y16_912_c1_22991_23974 | 327 |
| 599 | 3300050512 | nmdc:mga0n895_372343_c1 | nmdc:mga0n895_372343_c1_119_1102 | 327 |
| 600 | 3300050513 | nmdc:mga0rr50_1630_c1 | nmdc:mga0rr50_1630_c1_6190_7173 | 327 |
| 601 | 3300050513 | nmdc:mga0rr50_6418_c1 | nmdc:mga0rr50_6418_c1_3086_4069 | 327 |
| 602 | 3300050513 | nmdc:mga0rr50_73341_c1 | nmdc:mga0rr50_73341_c1_772_1755 | 327 |
| 603 | 3300050515 | nmdc:mga0a205_2393_c1 | nmdc:mga0a205_2393_c1_3917_4900 | 327 |
| 604 | 3300050515 | nmdc:mga0a205_2745_c1 | nmdc:mga0a205_2745_c1_7050_8033 | 327 |
| 605 | 3300050515 | nmdc:mga0a205_571_c1 | nmdc:mga0a205_571_c1_10014_10997 | 327 |
| 606 | 3300053085 | Ga0495619_0000234 | Ga0495619_0000234_23978_24961 | 327 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3tuj-assembly1.cif.gz_C | inward facing conformations of the metni methionine abc transporter: dm crystal form | 0.8943 | 4 | 258 |
| 2awo-assembly2.cif.gz_D | crystal structure of the adp-mg-bound e. coli malk (crystallized with adp-mg) | 0.892 | 5 | 255 |
| 4yer-assembly1.cif.gz_A | crystal structure of an abc transporter atp-binding protein (tm_1403) from thermotoga maritima msb8 at 2.35 a resolution | 0.8884 | 1 | 244 |
| 4yer-assembly1.cif.gz_B | crystal structure of an abc transporter atp-binding protein (tm_1403) from thermotoga maritima msb8 at 2.35 a resolution | 0.8861 | 1 | 244 |
| 6cvl-assembly1.cif.gz_C | crystal structure of the escherichia coli atpgs-bound metni methionine abc transporter in complex with its metq binding protein | 0.8852 | 4 | 258 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P33916_3_268_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9185 | 2 | 260 | 3.40.50.300 |
| af_P75796_10_305_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9046 | 2 | 264 | 3.40.50.300 |
| af_Q2G1F8_275_530_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.895 | 4 | 259 | 3.40.50.300 |
| af_P33916_3_268_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.8922 | 2 | 260 | 3.40.50.300 |
| af_Q2FVF0_1_268_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.8914 | 2 | 267 | 3.40.50.300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3S1TSN0-F1-model_v4 | deleted | 0.911 | 2 | 251 |
|
| AF-A0A2S9BS46-F1-model_v4 | Dipeptide/oligopeptide/nickel ABC transporter ATP-binding protein | 0.9103 | 16 | 258 |
GO:0005524
GO:0005886 GO:0016887 |
| AF-A0A7V9M7E5-F1-model_v4 | ABC transporter ATP-binding protein | 0.9098 | 1 | 256 |
GO:0005524
GO:0016887 |
| AF-A0A6G2QKZ1-F1-model_v4 | ATP-binding cassette domain-containing protein | 0.9095 | 2 | 258 |
GO:0005524
GO:0016887 |
| AF-A0A380NHC1-F1-model_v4 | Methionine import ATP-binding protein MetN 2 (EC 3.6.3.-) | 0.9083 | 5 | 256 |
GO:0005524
GO:0016887 GO:0033232 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar