F468604

General Info

Members Datasets Scaffolds Average Seq Length
606 295 606 328

Family's Representative Sequence

Representative Sequence 3300028380|Ga0268265_10497791|Ga0268265_104977911
Length 359
Sequence MTTAAPLEVRSLTKRFQLGTGVRRAHVHAVDDVSFELRPGTITALVGESGSGKSTVARLLAHLSEPSEGEVLFEGSDVSHVRRRRDVLRYRSQVQIIFQDPFSSLNPVKTVRHHVERPLRIHKIVPSRQVEQRVHELLRTVGLVPPEDIAAKYPHELSGGQRQRVAIARALAVEPKVVLADEPISMLDVSIRIGILNLMSKLKEEHGIAFLYVTHDLASARYVADDILVMYAGQIVERGPIEDVLAAPLHPYTRLLLDAVPDPATKTEAQQIELRKSDASAAVDPTEGCRFRARCPLAIEVCSQITPTLVEASPRQAARCHVTAEMGVSELDATVAGVHTLLRRLASRGDTELKPALAR

Samples

Sample ID Description Type Environment
1 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
2 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
5 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
6 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
7 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
8 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
9 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
10 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
30 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
31 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
32 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
33 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
34 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
35 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
36 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
37 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
38 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
39 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
40 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
41 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
42 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
43 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
44 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
45 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
46 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
47 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
48 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
49 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
50 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
51 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
52 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
53 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
54 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
55 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
56 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
57 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
58 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
59 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
60 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
61 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
62 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
63 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
64 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
65 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
66 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
67 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
68 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
69 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
70 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
71 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
72 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
73 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
74 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
75 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
77 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
78 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
79 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
80 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
81 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
82 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
83 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
84 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
85 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
86 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
87 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
88 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
89 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
90 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
91 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
92 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
93 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
94 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
95 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
96 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
97 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
98 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
99 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
100 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
101 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
102 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
103 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
104 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
105 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
106 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
107 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
108 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
109 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
110 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
111 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
112 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
113 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
114 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
115 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
116 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
117 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
118 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
120 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
184 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
185 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
186 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
187 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
188 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
192 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
193 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
194 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
195 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
196 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
197 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
198 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
199 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
200 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
201 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
202 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
203 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
204 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
205 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
206 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
207 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
208 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
209 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
210 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
211 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
212 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
213 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
214 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
215 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
216 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
217 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
218 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
219 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
220 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
221 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
222 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
223 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
224 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
225 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
226 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
227 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
228 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
229 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
230 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
231 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
232 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
233 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
234 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
235 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
236 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
237 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
238 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
239 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
240 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
241 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
242 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
243 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
244 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
245 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
246 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
247 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
248 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
249 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
250 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
251 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
252 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
253 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
254 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
255 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
256 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
257 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
258 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
259 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
260 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
261 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
262 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
263 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
264 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
265 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
266 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
267 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
268 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
269 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
270 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
271 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
272 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
273 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
274 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
275 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
276 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
277 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
278 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
279 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
280 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
281 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
282 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
283 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
284 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
285 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
286 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
287 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
288 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
289 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
290 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
291 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
292 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
293 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
294 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
295 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.33
Nodule 0
Rhizoplane 14.36
Rhizosphere 85.31
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24746J21847_1000628 3300001977 Bacteria 5399
2 JGI24747J21853_1000115 3300001978 Bacteria 3682
3 JGI24747J21853_1000673 3300001978 Bacteria 2264
4 JGI24737J22298_10040617 3300001990 Bacteria 1427
5 JGI24750J21931_1001624 3300002070 Bacteria 2762
6 JGI24745J21846_1000282 3300002073 Bacteria 4315
7 JGI24738J21930_10000115 3300002075 Bacteria 18938
8 JGI24749J21850_1002054 3300002076 Bacteria 2844
9 JGI24744J21845_10000862 3300002077 Bacteria 5731
10 JGI24034J26672_10009253 3300002239 Bacteria 1450
11 JGI24742J22300_10005553 3300002244 Bacteria 2072
12 Ga0070676_10007560 3300005328 Bacteria 5837
13 Ga0070683_100004388 3300005329 Bacteria 11609
14 Ga0070683_100005135 3300005329 Bacteria 10887
15 Ga0070683_100014617 3300005329 Bacteria 6874
16 Ga0070683_100172134 3300005329 Bacteria 2055
17 Ga0070690_100027735 3300005330 Bacteria 3502
18 Ga0070670_100004139 3300005331 Bacteria 12123
19 Ga0068869_100003359 3300005334 Bacteria 9771
20 Ga0068869_100335283 3300005334 Bacteria 1230
21 Ga0070682_100005430 3300005337 Bacteria 7101
22 Ga0070682_100007259 3300005337 Bacteria 6246
23 Ga0068868_100001391 3300005338 Bacteria 16682
24 Ga0068868_100075068 3300005338 Bacteria 2701
25 Ga0068868_100117079 3300005338 Bacteria 2171
26 Ga0068868_100127166 3300005338 Bacteria 2083
27 Ga0070660_100005269 3300005339 Bacteria 8940
28 Ga0070660_100010779 3300005339 Bacteria 6470
29 Ga0070689_100004949 3300005340 Bacteria 9043
30 Ga0070689_100223482 3300005340 Bacteria 1545
31 Ga0070687_100000229 3300005343 Bacteria 19233
32 Ga0070661_100000590 3300005344 Bacteria 27434
33 Ga0070692_10003402 3300005345 Bacteria 6450
34 Ga0070692_10006536 3300005345 Bacteria 5069
35 Ga0070668_100021641 3300005347 Bacteria 4858
36 Ga0070668_100030539 3300005347 Bacteria 4097
37 Ga0070668_100130769 3300005347 Bacteria 2015
38 Ga0070671_100007239 3300005355 Bacteria 8872
39 Ga0070671_100043679 3300005355 Bacteria 3725
40 Ga0070674_100009442 3300005356 Bacteria 5841
41 Ga0070674_100083116 3300005356 Bacteria 2292
42 Ga0070673_100000944 3300005364 Bacteria 16453
43 Ga0070673_100096799 3300005364 Bacteria 2423
44 Ga0070673_100204864 3300005364 Bacteria 1700
45 Ga0070688_100000244 3300005365 Bacteria 28822
46 Ga0070688_100018307 3300005365 Bacteria 4040
47 Ga0070688_100071942 3300005365 Bacteria 2215
48 Ga0070688_100117118 3300005365 Bacteria 1779
49 Ga0070659_100008419 3300005366 Bacteria 7533
50 Ga0070659_100271738 3300005366 Bacteria 1409
51 Ga0070703_10002303 3300005406 Bacteria 5525
52 Ga0070714_100006112 3300005435 Bacteria 9252
53 Ga0070714_100037937 3300005435 Bacteria 4052
54 Ga0070714_100122279 3300005435 Bacteria 2316
55 Ga0070713_100003728 3300005436 Bacteria 10089
56 Ga0070713_100004726 3300005436 Bacteria 9206
57 Ga0070710_10001039 3300005437 Bacteria 13184
58 Ga0070710_10001523 3300005437 Bacteria 10945
59 Ga0070701_10000326 3300005438 Bacteria 15682
60 Ga0070701_10003880 3300005438 Bacteria 5971
61 Ga0070705_100009155 3300005440 Bacteria 4914
62 Ga0070700_100004636 3300005441 Bacteria 7201
63 Ga0070700_100066424 3300005441 Bacteria 2289
64 Ga0070694_100001729 3300005444 Bacteria 12874
65 Ga0070694_100004742 3300005444 Bacteria 8187
66 Ga0070663_100009511 3300005455 Bacteria 6022
67 Ga0070663_100042870 3300005455 Bacteria 3182
68 Ga0070678_100007296 3300005456 Bacteria 6546
69 Ga0070678_100159517 3300005456 Bacteria 1826
70 Ga0068867_100005224 3300005459 Bacteria 9164
71 Ga0068867_100008148 3300005459 Bacteria 7405
72 Ga0070685_10014939 3300005466 Bacteria 4120
73 Ga0070685_10111282 3300005466 Bacteria 1687
74 Ga0070685_10125790 3300005466 Bacteria 1597
75 Ga0070698_100225867 3300005471 Bacteria 1806
76 Ga0070679_100076305 3300005530 Bacteria 3342
77 Ga0070679_100079855 3300005530 Bacteria 3261
78 Ga0070684_100000278 3300005535 Bacteria 35483
79 Ga0070684_100005865 3300005535 Bacteria 9454
80 Ga0070684_100006983 3300005535 Bacteria 8769
81 Ga0070684_100010109 3300005535 Bacteria 7463
82 Ga0068853_100011556 3300005539 Bacteria 7177
83 Ga0068853_100020179 3300005539 Bacteria 5540
84 Ga0070672_100092698 3300005543 Bacteria 2439
85 Ga0070686_100004116 3300005544 Bacteria 8005
86 Ga0070686_100010757 3300005544 Bacteria 5172
87 Ga0070686_100042116 3300005544 Bacteria 2858
88 Ga0070695_100003280 3300005545 Bacteria 9454
89 Ga0070695_100086344 3300005545 Bacteria 2085
90 Ga0070696_100094705 3300005546 Bacteria 2131
91 Ga0070693_100006632 3300005547 Bacteria 5619
92 Ga0070693_100077900 3300005547 Bacteria 1969
93 Ga0070665_100102764 3300005548 Bacteria 2862
94 Ga0070665_100110056 3300005548 Bacteria 2757
95 Ga0070665_100222123 3300005548 Bacteria 1889
96 Ga0070704_100000158 3300005549 Bacteria 26451
97 Ga0070704_100023010 3300005549 Bacteria 4062
98 Ga0070704_100172513 3300005549 Bacteria 1721
99 Ga0068855_100015776 3300005563 Bacteria 9089
100 Ga0068855_100021021 3300005563 Bacteria 7825
101 Ga0068855_100026022 3300005563 Bacteria 6999
102 Ga0070664_100024670 3300005564 Bacteria 4977
103 Ga0070664_100036570 3300005564 Bacteria 4125
104 Ga0068857_100000596 3300005577 Bacteria 26505
105 Ga0068856_100026039 3300005614 Bacteria 5705
106 Ga0070702_100000280 3300005615 Bacteria 17417
107 Ga0070702_100001320 3300005615 Bacteria 10049
108 Ga0070702_100085068 3300005615 Bacteria 1903
109 Ga0070702_100122162 3300005615 Bacteria 1632
110 Ga0070702_100196790 3300005615 Bacteria 1331
111 Ga0068852_100016395 3300005616 Bacteria 5776
112 Ga0068859_100002498 3300005617 Bacteria 18699
113 Ga0068859_100183929 3300005617 Bacteria 2173
114 Ga0068864_100000140 3300005618 Bacteria 69827
115 Ga0068864_100152508 3300005618 Bacteria 2094
116 Ga0068864_100372373 3300005618 Bacteria 1352
117 Ga0068864_100485129 3300005618 Bacteria 1187
118 Ga0068866_10002156 3300005718 Bacteria 8196
119 Ga0068866_10060060 3300005718 Bacteria 1969
120 Ga0068861_100001125 3300005719 Bacteria 16597
121 Ga0068861_100168168 3300005719 Bacteria 1815
122 Ga0068870_10000135 3300005840 Bacteria 25577
123 Ga0068863_100018428 3300005841 Bacteria 6681
124 Ga0068863_100054410 3300005841 Bacteria 3792
125 Ga0068860_100003390 3300005843 Bacteria 16396
126 Ga0068860_100069743 3300005843 Bacteria 3342
127 Ga0068860_100209682 3300005843 Bacteria 1890
128 Ga0068862_100004234 3300005844 Bacteria 12156
129 Ga0081455_10000091 3300005937 Bacteria 97617
130 Ga0081455_10003576 3300005937 Bacteria 17837
131 Ga0081455_10232370 3300005937 Bacteria 1360
132 Ga0081540_1001344 3300005983 Bacteria 21413
133 Ga0081540_1031742 3300005983 Bacteria 2896
134 Ga0081539_10080617 3300005985 Bacteria 1712
135 Ga0070717_10016472 3300006028 Bacteria 5731
136 Ga0070717_10022083 3300006028 Bacteria 5024
137 Ga0070717_10571144 3300006028 Bacteria 1025
138 Ga0075365_10075304 3300006038 Bacteria 2278
139 Ga0075432_10011193 3300006058 Bacteria 3048
140 Ga0070715_10041429 3300006163 Bacteria 1930
141 Ga0070716_100232448 3300006173 Bacteria 1245
142 Ga0070712_100021015 3300006175 Bacteria 4280
143 Ga0070712_100031765 3300006175 Bacteria 3560
144 Ga0070712_100180225 3300006175 Bacteria 1645
145 Ga0070712_100376533 3300006175 Bacteria 1168
146 Ga0097621_100004183 3300006237 Bacteria 10013
147 Ga0068871_100001664 3300006358 Bacteria 14947
148 Ga0068871_100104557 3300006358 Bacteria 2375
149 Ga0068871_100435660 3300006358 Bacteria 1173
150 Ga0075428_100001400 3300006844 Bacteria 25647
151 Ga0075430_100001022 3300006846 Bacteria 22142
152 Ga0075431_100188006 3300006847 Bacteria 2117
153 Ga0075433_10002104 3300006852 Bacteria 15091
154 Ga0075433_10002835 3300006852 Bacteria 13271
155 Ga0075433_10003427 3300006852 Bacteria 12228
156 Ga0075433_10058778 3300006852 Bacteria 3364
157 Ga0075434_100001215 3300006871 Bacteria 21397
158 Ga0075434_100004190 3300006871 Bacteria 12921
159 Ga0075434_100085660 3300006871 Bacteria 3151
160 Ga0075429_100000941 3300006880 Bacteria 23046
161 Ga0068865_100001838 3300006881 Bacteria 12466
162 Ga0068865_100009549 3300006881 Bacteria 6022
163 Ga0068865_100246705 3300006881 Bacteria 1407
164 Ga0068865_100466068 3300006881 Bacteria 1047
165 Ga0075436_100000785 3300006914 Bacteria 21078
166 Ga0097620_100002498 3300006931 Bacteria 18699
167 Ga0097620_100183938 3300006931 Bacteria 2173
168 Ga0075435_100001483 3300007076 Bacteria 15080
169 Ga0075435_100016572 3300007076 Bacteria 5558
170 Ga0075435_100016976 3300007076 Bacteria 5498
171 Ga0075435_100057327 3300007076 Bacteria 3151
172 Ga0075435_100086912 3300007076 Bacteria 2575
173 Ga0105251_10012354 3300009011 Bacteria 4834
174 Ga0105250_10009975 3300009092 Bacteria 3977
175 Ga0105240_10064357 3300009093 Bacteria 4557
176 Ga0111539_10001115 3300009094 Bacteria 35484
177 Ga0105245_10001824 3300009098 Bacteria 19388
178 Ga0105245_10013551 3300009098 Bacteria 7101
179 Ga0105247_10028201 3300009101 Bacteria 3397
180 Ga0105247_10073089 3300009101 Bacteria 2148
181 Ga0114129_10001230 3300009147 Bacteria 34074
182 Ga0114129_10005318 3300009147 Bacteria 18171
183 Ga0114129_10005599 3300009147 Bacteria 17775
184 Ga0114129_10131109 3300009147 Bacteria 3442
185 Ga0105243_10001397 3300009148 Bacteria 21344
186 Ga0105243_10205065 3300009148 Bacteria 1732
187 Ga0105241_10000586 3300009174 Bacteria 27472
188 Ga0105242_10001675 3300009176 Bacteria 17533
189 Ga0105242_10039377 3300009176 Bacteria 3804
190 Ga0105248_10021456 3300009177 Bacteria 7153
191 Ga0105248_10048114 3300009177 Bacteria 4783
192 Ga0105248_10263335 3300009177 Bacteria 1941
193 Ga0105237_10041507 3300009545 Bacteria 4639
194 Ga0105238_10045650 3300009551 Bacteria 4426
195 Ga0105238_10096336 3300009551 Bacteria 2945
196 Ga0105238_10411241 3300009551 Bacteria 1347
197 Ga0105249_10001526 3300009553 Bacteria 20306
198 Ga0105249_10001802 3300009553 Bacteria 18618
199 Ga0105249_10180693 3300009553 Bacteria 2052
200 Ga0105239_10004973 3300010375 Bacteria 15695
201 Ga0105239_10040455 3300010375 Bacteria 5107
202 Ga0105239_10045367 3300010375 Bacteria 4817
203 Ga0105246_10003116 3300011119 Bacteria 10069
204 Ga0157373_10001384 3300013100 Bacteria 18594
205 Ga0157371_10016190 3300013102 Bacteria 5571
206 Ga0157370_10254199 3300013104 Bacteria 1625
207 Ga0157369_10122789 3300013105 Bacteria 2755
208 Ga0157374_10003666 3300013296 Bacteria 12912
209 Ga0157374_10006362 3300013296 Bacteria 10021
210 Ga0157374_10093346 3300013296 Bacteria 2873
211 Ga0157378_10002087 3300013297 Bacteria 17868
212 Ga0157378_10030426 3300013297 Bacteria 4770
213 Ga0157378_10072592 3300013297 Bacteria 3092
214 Ga0157378_10469481 3300013297 Bacteria 1252
215 Ga0163162_10003585 3300013306 Bacteria 14856
216 Ga0163162_10014349 3300013306 Bacteria 7742
217 Ga0163162_10376955 3300013306 Bacteria 1552
218 Ga0163162_10402907 3300013306 Bacteria 1501
219 Ga0157372_10003728 3300013307 Bacteria 16364
220 Ga0157375_10004460 3300013308 Bacteria 12156
221 Ga0157375_10136062 3300013308 Bacteria 2581
222 Ga0157375_10420337 3300013308 Bacteria 1503
223 Ga0163163_10006523 3300014325 Bacteria 10214
224 Ga0163163_10307800 3300014325 Bacteria 1637
225 Ga0157380_10005060 3300014326 Bacteria 9202
226 Ga0157380_10024103 3300014326 Bacteria 4600
227 Ga0182008_10027678 3300014497 Bacteria 2869
228 Ga0157377_10000449 3300014745 Bacteria 17724
229 Ga0157377_10281712 3300014745 Bacteria 1090
230 Ga0157379_10002609 3300014968 Bacteria 15148
231 Ga0157379_10144179 3300014968 Bacteria 2148
232 Ga0157379_10160943 3300014968 Bacteria 2026
233 Ga0157376_10060228 3300014969 Bacteria 3187
234 Ga0157376_10110532 3300014969 Bacteria 2418
235 Ga0207666_1000053 3300025271 Bacteria 20633
236 Ga0207673_1000140 3300025290 Bacteria 6977
237 Ga0207697_10000314 3300025315 Bacteria 27127
238 Ga0207653_10002698 3300025885 Bacteria 5638
239 Ga0207682_10000104 3300025893 Bacteria 38531
240 Ga0207692_10001611 3300025898 Bacteria 8502
241 Ga0207692_10016066 3300025898 Bacteria 3305
242 Ga0207642_10004154 3300025899 Bacteria 4650
243 Ga0207642_10182659 3300025899 Bacteria 1144
244 Ga0207710_10001384 3300025900 Bacteria 12153
245 Ga0207710_10011813 3300025900 Bacteria 3673
246 Ga0207688_10000236 3300025901 Bacteria 25129
247 Ga0207647_10002772 3300025904 Bacteria 13221
248 Ga0207647_10020705 3300025904 Bacteria 4406
249 Ga0207699_10005502 3300025906 Bacteria 6068
250 Ga0207699_10016465 3300025906 Bacteria 3869
251 Ga0207645_10001219 3300025907 Bacteria 21210
252 Ga0207645_10030804 3300025907 Bacteria 3457
253 Ga0207643_10000035 3300025908 Bacteria 90905
254 Ga0207643_10024559 3300025908 Bacteria 3326
255 Ga0207654_10055610 3300025911 Bacteria 2292
256 Ga0207707_10005181 3300025912 Bacteria 11427
257 Ga0207695_10122946 3300025913 Bacteria 2561
258 Ga0207671_10165585 3300025914 Bacteria 1714
259 Ga0207693_10003111 3300025915 Bacteria 14278
260 Ga0207693_10084222 3300025915 Bacteria 2491
261 Ga0207693_10213278 3300025915 Bacteria 1517
262 Ga0207663_10055590 3300025916 Bacteria 2484
263 Ga0207663_10071431 3300025916 Bacteria 2240
264 Ga0207660_10001787 3300025917 Bacteria 14363
265 Ga0207662_10000401 3300025918 Bacteria 19287
266 Ga0207657_10001276 3300025919 Bacteria 26816
267 Ga0207657_10002085 3300025919 Bacteria 21637
268 Ga0207657_10041809 3300025919 Bacteria 4050
269 Ga0207649_10000309 3300025920 Bacteria 37243
270 Ga0207652_10003742 3300025921 Bacteria 12479
271 Ga0207652_10045624 3300025921 Bacteria 3737
272 Ga0207652_10056662 3300025921 Bacteria 3374
273 Ga0207652_10185463 3300025921 Bacteria 1871
274 Ga0207646_10182242 3300025922 Bacteria 1897
275 Ga0207681_10002035 3300025923 Bacteria 12973
276 Ga0207694_10065048 3300025924 Bacteria 2843
277 Ga0207650_10045783 3300025925 Bacteria 3219
278 Ga0207659_10000633 3300025926 Bacteria 20867
279 Ga0207687_10000959 3300025927 Bacteria 19627
280 Ga0207687_10105437 3300025927 Bacteria 2083
281 Ga0207687_10220570 3300025927 Bacteria 1493
282 Ga0207700_10000001 3300025928 Bacteria 1122509
283 Ga0207700_10011701 3300025928 Bacteria 5611
284 Ga0207664_10011969 3300025929 Bacteria 6194
285 Ga0207644_10002922 3300025931 Bacteria 11009
286 Ga0207644_10006179 3300025931 Bacteria 7809
287 Ga0207644_10033856 3300025931 Bacteria 3573
288 Ga0207644_10073756 3300025931 Bacteria 2503
289 Ga0207690_10010832 3300025932 Bacteria 5434
290 Ga0207690_10170454 3300025932 Bacteria 1630
291 Ga0207706_10004534 3300025933 Bacteria 13034
292 Ga0207686_10001230 3300025934 Bacteria 14841
293 Ga0207686_10015044 3300025934 Bacteria 4318
294 Ga0207686_10028894 3300025934 Bacteria 3264
295 Ga0207709_10035428 3300025935 Bacteria 2950
296 Ga0207709_10041155 3300025935 Bacteria 2772
297 Ga0207670_10002361 3300025936 Bacteria 9889
298 Ga0207670_10101397 3300025936 Bacteria 2056
299 Ga0207670_10380160 3300025936 Bacteria 1125
300 Ga0207669_10000340 3300025937 Bacteria 21244
301 Ga0207669_10050346 3300025937 Bacteria 2489
302 Ga0207704_10004184 3300025938 Bacteria 6589
303 Ga0207704_10096173 3300025938 Bacteria 1960
304 Ga0207665_10001875 3300025939 Bacteria 14170
305 Ga0207691_10001336 3300025940 Bacteria 24608
306 Ga0207691_10097690 3300025940 Bacteria 2624
307 Ga0207711_10004667 3300025941 Bacteria 11635
308 Ga0207711_10064405 3300025941 Bacteria 3166
309 Ga0207711_10086673 3300025941 Bacteria 2746
310 Ga0207689_10000168 3300025942 Bacteria 57089
311 Ga0207689_10083231 3300025942 Bacteria 2631
312 Ga0207661_10001339 3300025944 Bacteria 16526
313 Ga0207661_10007085 3300025944 Bacteria 7965
314 Ga0207661_10007905 3300025944 Bacteria 7582
315 Ga0207661_10010717 3300025944 Bacteria 6607
316 Ga0207679_10000035 3300025945 Bacteria 144173
317 Ga0207679_10039273 3300025945 Bacteria 3379
318 Ga0207679_10164432 3300025945 Bacteria 1820
319 Ga0207679_10243865 3300025945 Bacteria 1524
320 Ga0207667_10006315 3300025949 Bacteria 14372
321 Ga0207651_10000233 3300025960 Bacteria 24032
322 Ga0207651_10210410 3300025960 Bacteria 1565
323 Ga0207712_10007633 3300025961 Bacteria 6838
324 Ga0207668_10001502 3300025972 Bacteria 13629
325 Ga0207668_10101399 3300025972 Bacteria 2140
326 Ga0207640_10000693 3300025981 Bacteria 19614
327 Ga0207658_10001140 3300025986 Bacteria 21328
328 Ga0207658_10118034 3300025986 Bacteria 2110
329 Ga0207677_10002446 3300026023 Bacteria 9750
330 Ga0207677_10015236 3300026023 Bacteria 4515
331 Ga0207703_10006941 3300026035 Bacteria 9012
332 Ga0207703_10032135 3300026035 Bacteria 4153
333 Ga0207639_10006305 3300026041 Bacteria 8057
334 Ga0207678_10003989 3300026067 Bacteria 13277
335 Ga0207678_10032323 3300026067 Bacteria 4560
336 Ga0207678_10038465 3300026067 Bacteria 4156
337 Ga0207678_10496748 3300026067 Bacteria 1063
338 Ga0207708_10000810 3300026075 Bacteria 23491
339 Ga0207708_10000906 3300026075 Bacteria 22273
340 Ga0207708_10004388 3300026075 Bacteria 10396
341 Ga0207702_10009427 3300026078 Bacteria 8199
342 Ga0207702_10015689 3300026078 Bacteria 6272
343 Ga0207641_10005232 3300026088 Bacteria 11099
344 Ga0207641_10093042 3300026088 Bacteria 2642
345 Ga0207641_10234748 3300026088 Bacteria 1706
346 Ga0207648_10002655 3300026089 Bacteria 19080
347 Ga0207648_10009659 3300026089 Bacteria 9225
348 Ga0207676_10000849 3300026095 Bacteria 23691
349 Ga0207676_10080583 3300026095 Bacteria 2643
350 Ga0207674_10000535 3300026116 Bacteria 49820
351 Ga0207674_10000863 3300026116 Bacteria 39645
352 Ga0207674_10045208 3300026116 Bacteria 4531
353 Ga0207675_100000365 3300026118 Bacteria 43342
354 Ga0207675_100105597 3300026118 Bacteria 2655
355 Ga0207675_100332477 3300026118 Bacteria 1485
356 Ga0207683_10000252 3300026121 Bacteria 47809
357 Ga0207683_10000667 3300026121 Bacteria 31542
358 Ga0207683_10132264 3300026121 Bacteria 2244
359 Ga0207683_10586539 3300026121 Bacteria 1031
360 Ga0207698_10005113 3300026142 Bacteria 8061
361 Ga0207698_10009827 3300026142 Bacteria 6114
362 Ga0207698_10389939 3300026142 Bacteria 1328
363 Ga0209973_1000555 3300027252 Bacteria 2882
364 Ga0209982_1011965 3300027552 Bacteria 1299
365 Ga0210002_1000993 3300027617 Bacteria 3934
366 Ga0209998_10000681 3300027717 Bacteria 9091
367 Ga0207428_10000415 3300027907 Bacteria 53058
368 Ga0207428_10000636 3300027907 Bacteria 41316
369 Ga0268266_10013796 3300028379 Bacteria 6956
370 Ga0268266_10044143 3300028379 Bacteria 3810
371 Ga0268266_10085152 3300028379 Bacteria 2761
372 Ga0268265_10015552 3300028380 Bacteria 5209
373 Ga0268265_10395432 3300028380 Bacteria 1276
374 Ga0268265_10497791 3300028380 Bacteria 1148
375 Ga0268264_10002536 3300028381 Bacteria 16046
376 Ga0265338_10063888 3300028800 Bacteria 3206
377 Ga0265330_10068968 3300031235 Bacteria 1531
378 Ga0265339_10025207 3300031249 Bacteria 3415
379 Ga0265331_10020915 3300031250 Bacteria 3354
380 Ga0265327_10017052 3300031251 Bacteria 4578
381 Ga0265316_10204790 3300031344 Bacteria 1461
382 Ga0265313_10049645 3300031595 Bacteria 2018
383 Ga0265313_10111922 3300031595 Bacteria 1199
384 Ga0265314_10009250 3300031711 Bacteria 8346
385 Ga0373930_0003780 3300034816 Bacteria 2427
386 Ga0373959_0026438 3300034820 Bacteria 1147
387 Ga0373928_0002818 3300035084 Bacteria 3347
388 Ga0373928_0007888 3300035084 Bacteria 2061
389 Ga0373940_0007701 3300035088 Bacteria 2440
390 Ga0373949_0001131 3300035090 Bacteria 8057
391 Ga0373932_0001355 3300035112 Bacteria 6865
392 Ga0373932_0009796 3300035112 Bacteria 2311
393 Ga0373939_0001134 3300035114 Bacteria 6565
394 Ga0373941_0001699 3300035115 Bacteria 4717
395 Ga0373960_0003108 3300035121 Bacteria 3749
396 Ga0373960_0013833 3300035121 Bacteria 2032
397 Ga0373943_0010005 3300035170 Bacteria 4253
398 Ga0373946_0006407 3300035171 Bacteria 4266
399 Ga0373931_0003872 3300035691 Bacteria 6769
400 Ga0373927_0015576 3300035695 Bacteria 5023
401 Ga0373947_0008622 3300035725 Bacteria 5869
402 Ga0373925_0063842 3300037068 Bacteria 2772
403 Ga0395899_0064458 3300037312 Bacteria 2694
404 Ga0395900_0011462 3300037418 Bacteria 9075
405 Ga0395900_0017381 3300037418 Bacteria 7342
406 Ga0395900_0085144 3300037418 Bacteria 3249
407 Ga0395900_0279652 3300037418 Bacteria 1661
408 Ga0395898_0004053 3300037466 Bacteria 16091
409 Ga0395898_0011385 3300037466 Bacteria 9237
410 Ga0395898_0016748 3300037466 Bacteria 7490
411 Ga0395898_0039649 3300037466 Bacteria 4661
412 Ga0395898_0090718 3300037466 Bacteria 2940
413 Ga0395898_0382448 3300037466 Bacteria 1342
414 Ga0395905_0003646 3300037471 Bacteria 16334
415 Ga0395905_0036137 3300037471 Bacteria 4639
416 Ga0395905_0042787 3300037471 Bacteria 4249
417 Ga0395905_0229688 3300037471 Bacteria 1735
418 Ga0395905_0430476 3300037471 Bacteria 1216
419 Ga0395901_0002084 3300038443 Bacteria 20504
420 Ga0395901_0002362 3300038443 Bacteria 19195
421 Ga0395901_0005585 3300038443 Bacteria 12733
422 Ga0395901_0051497 3300038443 Bacteria 4281
423 Ga0395901_0059366 3300038443 Bacteria 3979
424 Ga0395901_0383372 3300038443 Bacteria 1446
425 Ga0451577_0233390 3300042876 Bacteria 1664
426 Ga0466969_0028617 3300044656 Bacteria 2848
427 Ga0466964_0042742 3300044706 Bacteria 1837
428 Ga0466970_0197020 3300044765 Bacteria 1120
429 Ga0466959_0068084 3300045049 Bacteria 2580
430 Ga0466958_0026768 3300045836 Bacteria 3409
431 Ga0466967_0001857 3300045976 Bacteria 12727
432 Ga0466967_0040162 3300045976 Bacteria 4027
433 Ga0466967_0165456 3300045976 Bacteria 2078
434 Ga0466967_0204450 3300045976 Bacteria 1871
435 Ga0495603_0005620 3300046455 Bacteria 7495
436 Ga0495590_0024629 3300046457 Bacteria 2120
437 Ga0495629_0001287 3300046459 Bacteria 19724
438 Ga0495629_0136839 3300046459 Bacteria 1705
439 Ga0495580_0129620 3300046472 Bacteria 1750
440 Ga0495580_0307560 3300046472 Bacteria 1079
441 Ga0495582_0009997 3300046473 Bacteria 5222
442 Ga0495582_0022599 3300046473 Bacteria 3442
443 Ga0495582_0061834 3300046473 Bacteria 2068
444 Ga0495605_0051542 3300046474 Bacteria 2004
445 Ga0495605_0053103 3300046474 Bacteria 1967
446 Ga0495639_0020639 3300046475 Bacteria 2879
447 Ga0495662_0079017 3300046476 Bacteria 1599
448 Ga0495585_0145449 3300046492 Bacteria 1239
449 Ga0495594_0004071 3300046499 Bacteria 7515
450 Ga0495616_0130686 3300046513 Bacteria 1151
451 Ga0495637_0028646 3300046520 Bacteria 2486
452 Ga0495644_0008466 3300046523 Bacteria 3962
453 Ga0495663_0033157 3300046525 Bacteria 1541
454 Ga0495598_0004009 3300046537 Bacteria 3163
455 Ga0495667_0051691 3300046559 Bacteria 2710
456 Ga0495656_0004292 3300046615 Bacteria 4871
457 Ga0495635_0091172 3300046663 Bacteria 2085
458 Ga0495659_0014029 3300046664 Bacteria 2617
459 Ga0495659_0027997 3300046664 Bacteria 1948
460 Ga0495661_0105665 3300046665 Bacteria 1577
461 Ga0495647_0018449 3300046681 Bacteria 2484
462 Ga0495647_0018673 3300046681 Bacteria 2472
463 Ga0495658_0008547 3300046683 Bacteria 5078
464 Ga0495658_0036006 3300046683 Bacteria 2728
465 Ga0495658_0042792 3300046683 Bacteria 2530
466 Ga0495613_0023263 3300046689 Bacteria 4616
467 Ga0495613_0127639 3300046689 Bacteria 1823
468 Ga0495670_0161051 3300046691 Bacteria 1179
469 Ga0495671_0036865 3300046692 Bacteria 2476
470 Ga0495581_0005360 3300047315 Bacteria 7419
471 Ga0495581_0008046 3300047315 Bacteria 6103
472 Ga0495581_0017198 3300047315 Bacteria 4203
473 Ga0495636_0039539 3300047318 Bacteria 1954
474 Ga0495636_0040583 3300047318 Bacteria 1930
475 Ga0495676_0046069 3300047321 Bacteria 3544
476 Ga0495680_0016363 3300047322 Bacteria 6376
477 Ga0495677_0037618 3300047445 Bacteria 1768
478 Ga0495593_0005907 3300047673 Bacteria 7210
479 Ga0495614_0026782 3300048089 Bacteria 2485
480 Ga0496100_0014653 3300048903 Bacteria 4557
481 Ga0496100_0015937 3300048903 Bacteria 4401
482 Ga0496100_0025189 3300048903 Bacteria 3636
483 Ga0496100_0130498 3300048903 Bacteria 1769
484 Ga0496101_0007580 3300048904 Bacteria 7044
485 Ga0496101_0007689 3300048904 Bacteria 7002
486 Ga0496101_0073634 3300048904 Bacteria 2509
487 Ga0496101_0076314 3300048904 Bacteria 2468
488 Ga0496102_0005971 3300048905 Bacteria 10371
489 Ga0496102_0013176 3300048905 Bacteria 7154
490 Ga0496102_0013322 3300048905 Bacteria 7122
491 Ga0496102_0032372 3300048905 Bacteria 4696
492 Ga0496102_0245530 3300048905 Bacteria 1688
493 Ga0496103_0000959 3300048906 Bacteria 20463
494 Ga0496103_0001098 3300048906 Bacteria 18838
495 Ga0496103_0003949 3300048906 Bacteria 9011
496 Ga0496103_0008320 3300048906 Bacteria 6164
497 Ga0496103_0036968 3300048906 Bacteria 2991
498 Ga0496103_0100236 3300048906 Bacteria 1833
499 Ga0496104_0008532 3300048907 Bacteria 9107
500 Ga0496104_0014701 3300048907 Bacteria 7072
501 Ga0496104_0028388 3300048907 Bacteria 5186
502 Ga0496104_0116041 3300048907 Bacteria 2569
503 Ga0496104_0174272 3300048907 Bacteria 2061
504 Ga0496104_0261607 3300048907 Bacteria 1643
505 Ga0496105_0011949 3300048908 Bacteria 6875
506 Ga0496105_0022682 3300048908 Bacteria 5086
507 Ga0496105_0051522 3300048908 Bacteria 3400
508 Ga0496105_0140930 3300048908 Bacteria 1984
509 Ga0496106_0001801 3300048909 Bacteria 16011
510 Ga0496106_0008645 3300048909 Bacteria 7536
511 Ga0496106_0014782 3300048909 Bacteria 5771
512 Ga0496107_0012134 3300048910 Bacteria 6010
513 Ga0496107_0020565 3300048910 Bacteria 4663
514 Ga0496107_0022086 3300048910 Bacteria 4495
515 Ga0496107_0159835 3300048910 Bacteria 1669
516 Ga0496107_0205186 3300048910 Bacteria 1465
517 Ga0496108_0006621 3300048911 Bacteria 9390
518 Ga0496108_0013281 3300048911 Bacteria 6713
519 Ga0496108_0022558 3300048911 Bacteria 5176
520 Ga0496108_0033044 3300048911 Bacteria 4299
521 Ga0496108_0235081 3300048911 Bacteria 1594
522 Ga0496108_0366825 3300048911 Bacteria 1257
523 Ga0496109_0000575 3300048912 Bacteria 30741
524 Ga0496109_0008219 3300048912 Bacteria 8856
525 Ga0496109_0008788 3300048912 Bacteria 8603
526 Ga0496109_0008961 3300048912 Bacteria 8521
527 Ga0496109_0010798 3300048912 Bacteria 7819
528 Ga0496109_0013319 3300048912 Bacteria 7126
529 Ga0496109_0015848 3300048912 Bacteria 6580
530 Ga0496109_0020464 3300048912 Bacteria 5844
531 Ga0496109_0067299 3300048912 Bacteria 3281
532 Ga0496110_0011859 3300048913 Bacteria 7157
533 Ga0496110_0033746 3300048913 Bacteria 4429
534 Ga0496110_0134571 3300048913 Bacteria 2233
535 Ga0496110_0247597 3300048913 Bacteria 1622
536 Ga0496110_0255844 3300048913 Bacteria 1594
537 Ga0496111_0002998 3300048914 Bacteria 10336
538 Ga0496111_0021033 3300048914 Bacteria 4550
539 Ga0496111_0031145 3300048914 Bacteria 3798
540 Ga0496111_0137423 3300048914 Bacteria 1811
541 Ga0496111_0307869 3300048914 Bacteria 1174
542 Ga0496112_0001207 3300048915 Bacteria 19399
543 Ga0496112_0001598 3300048915 Bacteria 17516
544 Ga0496112_0019989 3300048915 Bacteria 6339
545 Ga0496112_0045243 3300048915 Bacteria 4315
546 Ga0496112_0053498 3300048915 Bacteria 3965
547 Ga0496112_0076779 3300048915 Bacteria 3304
548 Ga0496112_0092349 3300048915 Bacteria 2996
549 Ga0496112_0138463 3300048915 Bacteria 2404
550 Ga0496112_0142496 3300048915 Bacteria 2366
551 Ga0496112_0188595 3300048915 Bacteria 2024
552 Ga0496113_0016623 3300048916 Bacteria 5086
553 Ga0496113_0023132 3300048916 Bacteria 4404
554 Ga0496113_0042241 3300048916 Bacteria 3368
555 Ga0496113_0042805 3300048916 Bacteria 3347
556 Ga0496113_0126814 3300048916 Bacteria 1999
557 Ga0496113_0365763 3300048916 Unclassified 1157
558 Ga0496114_0001599 3300048917 Bacteria 17174
559 Ga0496114_0004424 3300048917 Bacteria 10906
560 Ga0496114_0014385 3300048917 Bacteria 6350
561 Ga0496114_0164052 3300048917 Bacteria 1934
562 Ga0496114_0207578 3300048917 Bacteria 1717
563 Ga0496114_0362032 3300048917 Bacteria 1283
564 Ga0496115_0007947 3300048918 Bacteria 7828
565 Ga0496115_0009498 3300048918 Bacteria 7223
566 Ga0496115_0014202 3300048918 Bacteria 6025
567 Ga0501067_0011161 3300049583 Bacteria 4969
568 Ga0501067_0020485 3300049583 Bacteria 3660
569 Ga0501068_0015159 3300049584 Bacteria 4422
570 Ga0501069_0093723 3300049585 Bacteria 1699
571 Ga0501071_0234941 3300049587 Bacteria 1382
572 Ga0501072_0003295 3300049588 Bacteria 12146
573 Ga0501073_0048465 3300049589 Bacteria 2982
574 Ga0501079_0063257 3300049741 Bacteria 2855
575 Ga0501080_0117392 3300049742 Bacteria 2466
576 Ga0501083_0005263 3300049744 Bacteria 9153
577 nmdc:mga0yw44_19425_c1 3300050492 Bacteria 3748
578 nmdc:mga05p37_2767_c1 3300050507 Bacteria 20388
579 nmdc:mga05p37_281_c1 3300050507 Bacteria 50198
580 nmdc:mga05p37_433371_c1 3300050507 Bacteria 1527
581 nmdc:mga05p37_5072_c1 3300050507 Bacteria 15436
582 nmdc:mga05p37_938_c1 3300050507 Bacteria 32835
583 nmdc:mga06r32_2024_c1 3300050510 Bacteria 18126
584 nmdc:mga06r32_206215_c1 3300050510 Bacteria 1954
585 nmdc:mga08y16_912_c1 3300050511 Bacteria 28635
586 nmdc:mga0n895_121014_c1 3300050512 Bacteria 2639
587 nmdc:mga0n895_151006_c1 3300050512 Bacteria 2353
588 nmdc:mga0n895_17769_c1 3300050512 Bacteria 6565
589 nmdc:mga0n895_372343_c1 3300050512 Bacteria 1446
590 nmdc:mga0n895_4467_c1 3300050512 Bacteria 11495
591 nmdc:mga0n895_806446_c1 3300050512 Bacteria 929
592 nmdc:mga0rr50_1630_c1 3300050513 Bacteria 12338
593 nmdc:mga0rr50_3485_c1 3300050513 Bacteria 9064
594 nmdc:mga0rr50_6418_c1 3300050513 Bacteria 7154
595 nmdc:mga0rr50_73341_c1 3300050513 Bacteria 2617
596 nmdc:mga08x19_4456_c1 3300050514 Bacteria 8296
597 nmdc:mga0a205_1771_c1 3300050515 Bacteria 18694
598 nmdc:mga0a205_2393_c1 3300050515 Bacteria 7699
599 nmdc:mga0a205_2745_c1 3300050515 Bacteria 15553
600 nmdc:mga0a205_571_c1 3300050515 Bacteria 29236
601 Ga0495601_0173008 3300053077 Bacteria 1412
602 Ga0495619_0000234 3300053085 Bacteria 40516
603 Ga0495619_0012321 3300053085 Bacteria 5382
604 Ga0501084_0123656 3300054114 Bacteria 2176
605 Ga0501082_0037598 3300060353 Bacteria 4174
606 Ga0530510_0007443 3300061734 Bacteria 7622

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300001990 JGI24737J22298_10040617 JGI24737J22298_100406172 270
2 3300048909 Ga0496106_0001801 Ga0496106_0001801_15071_15889 272
3 3300048915 Ga0496112_0076779 Ga0496112_0076779_2364_3182 272
4 3300050512 nmdc:mga0n895_17769_c1 nmdc:mga0n895_17769_c1_71_889 272
5 3300049587 Ga0501071_0234941 Ga0501071_0234941_323_1201 286
6 3300050512 nmdc:mga0n895_806446_c1 nmdc:mga0n895_806446_c1_10_897 290
7 3300048913 Ga0496110_0033746 Ga0496110_0033746_83_961 292
8 3300005339 Ga0070660_100005269 Ga0070660_1000052695 296
9 3300005530 Ga0070679_100076305 Ga0070679_1000763052 296
10 3300006852 Ga0075433_10002835 Ga0075433_100028356 296
11 3300006871 Ga0075434_100004190 Ga0075434_1000041907 296
12 3300006914 Ga0075436_100000785 Ga0075436_1000007852 296
13 3300007076 Ga0075435_100001483 Ga0075435_1000014836 296
14 3300025919 Ga0207657_10002085 Ga0207657_1000208514 296
15 3300025921 Ga0207652_10056662 Ga0207652_100566622 296
16 3300037471 Ga0395905_0229688 Ga0395905_0229688_808_1713 296
17 3300050507 nmdc:mga05p37_2767_c1 nmdc:mga05p37_2767_c1_5714_6691 296
18 3300050507 nmdc:mga05p37_433371_c1 nmdc:mga05p37_433371_c1_36_935 296
19 3300050512 nmdc:mga0n895_4467_c1 nmdc:mga0n895_4467_c1_2606_3583 296
20 3300050513 nmdc:mga0rr50_3485_c1 nmdc:mga0rr50_3485_c1_2502_3479 296
21 3300050514 nmdc:mga08x19_4456_c1 nmdc:mga08x19_4456_c1_5261_6238 296
22 3300050515 nmdc:mga0a205_1771_c1 nmdc:mga0a205_1771_c1_12916_13893 296
23 3300005471 Ga0070698_100225867 Ga0070698_1002258672 297
24 3300005937 Ga0081455_10232370 Ga0081455_102323702 298
25 3300005338 Ga0068868_100075068 Ga0068868_1000750682 299
26 3300005719 Ga0068861_100168168 Ga0068861_1001681682 299
27 3300006358 Ga0068871_100435660 Ga0068871_1004356601 299
28 3300014969 Ga0157376_10060228 Ga0157376_100602282 299
29 3300025972 Ga0207668_10101399 Ga0207668_101013992 299
30 3300026075 Ga0207708_10004388 Ga0207708_100043888 299
31 3300046474 Ga0495605_0051542 Ga0495605_0051542_887_1888 299
32 3300046513 Ga0495616_0130686 Ga0495616_0130686_80_1081 299
33 3300046520 Ga0495637_0028646 Ga0495637_0028646_147_1148 299
34 3300046523 Ga0495644_0008466 Ga0495644_0008466_2363_3364 299
35 3300046525 Ga0495663_0033157 Ga0495663_0033157_355_1356 299
36 3300046537 Ga0495598_0004009 Ga0495598_0004009_1697_2698 299
37 3300046615 Ga0495656_0004292 Ga0495656_0004292_2597_3598 299
38 3300046665 Ga0495661_0105665 Ga0495661_0105665_243_1244 299
39 3300047318 Ga0495636_0039539 Ga0495636_0039539_252_1253 299
40 3300050512 nmdc:mga0n895_121014_c1 nmdc:mga0n895_121014_c1_225_1226 299
41 3300007076 Ga0075435_100016976 Ga0075435_1000169765 301
42 3300044765 Ga0466970_0197020 Ga0466970_0197020_138_1106 305
43 3300005615 Ga0070702_100196790 Ga0070702_1001967902 307
44 3300006028 Ga0070717_10571144 Ga0070717_105711441 307
45 3300006881 Ga0068865_100246705 Ga0068865_1002467052 307
46 3300013297 Ga0157378_10469481 Ga0157378_104694811 307
47 3300014745 Ga0157377_10281712 Ga0157377_102817121 307
48 3300025907 Ga0207645_10030804 Ga0207645_100308043 307
49 3300025940 Ga0207691_10097690 Ga0207691_100976902 307
50 3300025945 Ga0207679_10243865 Ga0207679_102438652 307
51 3300049583 Ga0501067_0020485 Ga0501067_0020485_169_1113 307
52 3300048917 Ga0496114_0164052 Ga0496114_0164052_666_1661 308
53 3300006028 Ga0070717_10016472 Ga0070717_100164722 309
54 3300025929 Ga0207664_10011969 Ga0207664_100119692 309
55 3300048912 Ga0496109_0067299 Ga0496109_0067299_858_1865 309
56 3300048913 Ga0496110_0255844 Ga0496110_0255844_161_1168 309
57 3300048915 Ga0496112_0019989 Ga0496112_0019989_2325_3332 309
58 3300006175 Ga0070712_100031765 Ga0070712_1000317654 310
59 3300006881 Ga0068865_100466068 Ga0068865_1004660681 310
60 3300048904 Ga0496101_0007580 Ga0496101_0007580_5281_6246 310
61 3300048907 Ga0496104_0014701 Ga0496104_0014701_4895_5860 310
62 3300048913 Ga0496110_0011859 Ga0496110_0011859_4871_5836 310
63 3300048915 Ga0496112_0001207 Ga0496112_0001207_9148_10113 310
64 3300048916 Ga0496113_0365763 Ga0496113_0365763_153_1118 310
65 3300048917 Ga0496114_0004424 Ga0496114_0004424_1216_2181 310
66 3300049585 Ga0501069_0093723 Ga0501069_0093723_91_1053 310
67 3300005435 Ga0070714_100122279 Ga0070714_1001222792 311
68 3300045976 Ga0466967_0165456 Ga0466967_0165456_148_1110 311
69 3300046492 Ga0495585_0145449 Ga0495585_0145449_17_976 311
70 3300005436 Ga0070713_100004726 Ga0070713_1000047262 312
71 3300006175 Ga0070712_100180225 Ga0070712_1001802252 312
72 3300025915 Ga0207693_10084222 Ga0207693_100842223 312
73 3300025928 Ga0207700_10000001 Ga0207700_10000001618 312
74 3300028800 Ga0265338_10063888 Ga0265338_100638882 312
75 3300031235 Ga0265330_10068968 Ga0265330_100689682 312
76 3300031249 Ga0265339_10025207 Ga0265339_100252072 312
77 3300031250 Ga0265331_10020915 Ga0265331_100209153 312
78 3300031344 Ga0265316_10204790 Ga0265316_102047902 312
79 3300031595 Ga0265313_10049645 Ga0265313_100496452 312
80 3300031595 Ga0265313_10111922 Ga0265313_101119222 312
81 3300031711 Ga0265314_10009250 Ga0265314_100092503 312
82 3300009147 Ga0114129_10005599 Ga0114129_100055996 313
83 3300025916 Ga0207663_10055590 Ga0207663_100555902 313
84 3300037466 Ga0395898_0011385 Ga0395898_0011385_1710_2687 313
85 3300037471 Ga0395905_0042787 Ga0395905_0042787_2875_3852 313
86 3300038443 Ga0395901_0002084 Ga0395901_0002084_10011_10988 313
87 3300046664 Ga0495659_0014029 Ga0495659_0014029_692_1669 313
88 3300048910 Ga0496107_0205186 Ga0496107_0205186_87_1064 313
89 3300048911 Ga0496108_0366825 Ga0496108_0366825_216_1193 313
90 3300048912 Ga0496109_0015848 Ga0496109_0015848_3316_4293 313
91 3300048914 Ga0496111_0307869 Ga0496111_0307869_33_1010 313
92 3300048915 Ga0496112_0045243 Ga0496112_0045243_1346_2323 313
93 3300005718 Ga0068866_10060060 Ga0068866_100600602 314
94 3300048915 Ga0496112_0001598 Ga0496112_0001598_14864_15832 314
95 3300005535 Ga0070684_100010109 Ga0070684_1000101095 316
96 3300025944 Ga0207661_10007085 Ga0207661_100070852 316
97 3300046459 Ga0495629_0136839 Ga0495629_0136839_497_1513 316
98 3300046559 Ga0495667_0051691 Ga0495667_0051691_217_1233 316
99 3300046689 Ga0495613_0127639 Ga0495613_0127639_302_1318 316
100 3300048911 Ga0496108_0235081 Ga0496108_0235081_507_1493 316
101 3300048912 Ga0496109_0008788 Ga0496109_0008788_3549_4535 316
102 3300053085 Ga0495619_0012321 Ga0495619_0012321_2913_3929 316
103 3300005329 Ga0070683_100004388 Ga0070683_1000043886 317
104 3300005329 Ga0070683_100172134 Ga0070683_1001721342 317
105 3300005347 Ga0070668_100130769 Ga0070668_1001307692 317
106 3300005365 Ga0070688_100071942 Ga0070688_1000719423 317
107 3300005456 Ga0070678_100159517 Ga0070678_1001595172 317
108 3300005466 Ga0070685_10111282 Ga0070685_101112822 317
109 3300005535 Ga0070684_100000278 Ga0070684_10000027817 317
110 3300005535 Ga0070684_100006983 Ga0070684_1000069832 317
111 3300005549 Ga0070704_100172513 Ga0070704_1001725132 317
112 3300005563 Ga0068855_100015776 Ga0068855_1000157763 317
113 3300005564 Ga0070664_100036570 Ga0070664_1000365704 317
114 3300005577 Ga0068857_100000596 Ga0068857_1000005966 317
115 3300005615 Ga0070702_100122162 Ga0070702_1001221622 317
116 3300005983 Ga0081540_1001344 Ga0081540_100134411 317
117 3300006844 Ga0075428_100001400 Ga0075428_10000140027 317
118 3300006847 Ga0075431_100188006 Ga0075431_1001880062 317
119 3300009147 Ga0114129_10131109 Ga0114129_101311092 317
120 3300010375 Ga0105239_10045367 Ga0105239_100453672 317
121 3300013104 Ga0157370_10254199 Ga0157370_102541992 317
122 3300013308 Ga0157375_10136062 Ga0157375_101360622 317
123 3300025944 Ga0207661_10010717 Ga0207661_100107172 317
124 3300025945 Ga0207679_10039273 Ga0207679_100392731 317
125 3300026116 Ga0207674_10000863 Ga0207674_1000086319 317
126 3300026118 Ga0207675_100105597 Ga0207675_1001055972 317
127 3300026121 Ga0207683_10586539 Ga0207683_105865391 317
128 3300037312 Ga0395899_0064458 Ga0395899_0064458_343_1326 317
129 3300037418 Ga0395900_0017381 Ga0395900_0017381_4740_5723 317
130 3300037418 Ga0395900_0279652 Ga0395900_0279652_234_1220 317
131 3300037466 Ga0395898_0016748 Ga0395898_0016748_2272_3255 317
132 3300037466 Ga0395898_0039649 Ga0395898_0039649_1715_2698 317
133 3300037466 Ga0395898_0382448 Ga0395898_0382448_15_1001 317
134 3300037471 Ga0395905_0003646 Ga0395905_0003646_7819_8802 317
135 3300038443 Ga0395901_0005585 Ga0395901_0005585_5043_6026 317
136 3300038443 Ga0395901_0051497 Ga0395901_0051497_66_1049 317
137 3300038443 Ga0395901_0059366 Ga0395901_0059366_2001_2984 317
138 3300046457 Ga0495590_0024629 Ga0495590_0024629_371_1354 317
139 3300046474 Ga0495605_0053103 Ga0495605_0053103_311_1294 317
140 3300046683 Ga0495658_0042792 Ga0495658_0042792_461_1444 317
141 3300046692 Ga0495671_0036865 Ga0495671_0036865_288_1271 317
142 3300047315 Ga0495581_0008046 Ga0495581_0008046_743_1726 317
143 3300047318 Ga0495636_0040583 Ga0495636_0040583_588_1571 317
144 3300048905 Ga0496102_0245530 Ga0496102_0245530_355_1338 317
145 3300048913 Ga0496110_0247597 Ga0496110_0247597_433_1410 317
146 3300048914 Ga0496111_0021033 Ga0496111_0021033_2373_3356 317
147 3300050507 nmdc:mga05p37_5072_c1 nmdc:mga05p37_5072_c1_12112_13107 317
148 3300050510 nmdc:mga06r32_206215_c1 nmdc:mga06r32_206215_c1_67_1050 317
149 3300053077 Ga0495601_0173008 Ga0495601_0173008_24_1007 317
150 3300006038 Ga0075365_10075304 Ga0075365_100753042 318
151 3300014497 Ga0182008_10027678 Ga0182008_100276783 318
152 3300044706 Ga0466964_0042742 Ga0466964_0042742_577_1551 318
153 3300045976 Ga0466967_0001857 Ga0466967_0001857_7280_8254 318
154 3300045976 Ga0466967_0204450 Ga0466967_0204450_22_996 318
155 3300050492 nmdc:mga0yw44_19425_c1 nmdc:mga0yw44_19425_c1_986_1993 318
156 3300001978 JGI24747J21853_1000115 JGI24747J21853_10001152 319
157 3300002077 JGI24744J21845_10000862 JGI24744J21845_100008624 319
158 3300002244 JGI24742J22300_10005553 JGI24742J22300_100055532 319
159 3300005329 Ga0070683_100005135 Ga0070683_1000051356 319
160 3300005330 Ga0070690_100027735 Ga0070690_1000277352 319
161 3300005337 Ga0070682_100005430 Ga0070682_1000054303 319
162 3300005338 Ga0068868_100117079 Ga0068868_1001170792 319
163 3300005340 Ga0070689_100004949 Ga0070689_1000049495 319
164 3300005345 Ga0070692_10006536 Ga0070692_100065364 319
165 3300005347 Ga0070668_100030539 Ga0070668_1000305393 319
166 3300005355 Ga0070671_100043679 Ga0070671_1000436792 319
167 3300005356 Ga0070674_100009442 Ga0070674_1000094422 319
168 3300005364 Ga0070673_100096799 Ga0070673_1000967992 319
169 3300005365 Ga0070688_100018307 Ga0070688_1000183072 319
170 3300005366 Ga0070659_100008419 Ga0070659_1000084192 319
171 3300005437 Ga0070710_10001523 Ga0070710_100015236 319
172 3300005438 Ga0070701_10003880 Ga0070701_100038804 319
173 3300005441 Ga0070700_100004636 Ga0070700_1000046362 319
174 3300005444 Ga0070694_100004742 Ga0070694_1000047422 319
175 3300005455 Ga0070663_100042870 Ga0070663_1000428702 319
176 3300005456 Ga0070678_100007296 Ga0070678_1000072964 319
177 3300005459 Ga0068867_100005224 Ga0068867_1000052244 319
178 3300005466 Ga0070685_10014939 Ga0070685_100149392 319
179 3300005530 Ga0070679_100079855 Ga0070679_1000798552 319
180 3300005535 Ga0070684_100005865 Ga0070684_1000058654 319
181 3300005539 Ga0068853_100020179 Ga0068853_1000201793 319
182 3300005544 Ga0070686_100004116 Ga0070686_1000041164 319
183 3300005546 Ga0070696_100094705 Ga0070696_1000947051 319
184 3300005547 Ga0070693_100077900 Ga0070693_1000779002 319
185 3300005548 Ga0070665_100102764 Ga0070665_1001027642 319
186 3300005549 Ga0070704_100023010 Ga0070704_1000230101 319
187 3300005563 Ga0068855_100026022 Ga0068855_1000260226 319
188 3300005615 Ga0070702_100001320 Ga0070702_1000013203 319
189 3300005616 Ga0068852_100016395 Ga0068852_1000163954 319
190 3300005617 Ga0068859_100183929 Ga0068859_1001839292 319
191 3300005618 Ga0068864_100372373 Ga0068864_1003723732 319
192 3300005718 Ga0068866_10002156 Ga0068866_100021563 319
193 3300005841 Ga0068863_100054410 Ga0068863_1000544103 319
194 3300005843 Ga0068860_100069743 Ga0068860_1000697432 319
195 3300006163 Ga0070715_10041429 Ga0070715_100414292 319
196 3300006175 Ga0070712_100021015 Ga0070712_1000210154 319
197 3300006358 Ga0068871_100104557 Ga0068871_1001045572 319
198 3300006881 Ga0068865_100001838 Ga0068865_1000018383 319
199 3300006931 Ga0097620_100183938 Ga0097620_1001839382 319
200 3300009098 Ga0105245_10013551 Ga0105245_100135512 319
201 3300009148 Ga0105243_10205065 Ga0105243_102050652 319
202 3300009176 Ga0105242_10039377 Ga0105242_100393773 319
203 3300009177 Ga0105248_10021456 Ga0105248_100214563 319
204 3300009177 Ga0105248_10263335 Ga0105248_102633352 319
205 3300009545 Ga0105237_10041507 Ga0105237_100415074 319
206 3300009551 Ga0105238_10045650 Ga0105238_100456503 319
207 3300009553 Ga0105249_10001802 Ga0105249_100018022 319
208 3300010375 Ga0105239_10004973 Ga0105239_100049736 319
209 3300013105 Ga0157369_10122789 Ga0157369_101227893 319
210 3300013296 Ga0157374_10006362 Ga0157374_100063623 319
211 3300013297 Ga0157378_10030426 Ga0157378_100304265 319
212 3300013306 Ga0163162_10014349 Ga0163162_100143496 319
213 3300013308 Ga0157375_10420337 Ga0157375_104203372 319
214 3300014326 Ga0157380_10024103 Ga0157380_100241033 319
215 3300014969 Ga0157376_10110532 Ga0157376_101105322 319
216 3300025898 Ga0207692_10016066 Ga0207692_100160663 319
217 3300025899 Ga0207642_10004154 Ga0207642_100041543 319
218 3300025904 Ga0207647_10020705 Ga0207647_100207053 319
219 3300025906 Ga0207699_10016465 Ga0207699_100164653 319
220 3300025911 Ga0207654_10055610 Ga0207654_100556102 319
221 3300025914 Ga0207671_10165585 Ga0207671_101655852 319
222 3300025915 Ga0207693_10003111 Ga0207693_100031115 319
223 3300025916 Ga0207663_10071431 Ga0207663_100714312 319
224 3300025919 Ga0207657_10041809 Ga0207657_100418092 319
225 3300025921 Ga0207652_10045624 Ga0207652_100456243 319
226 3300025921 Ga0207652_10185463 Ga0207652_101854632 319
227 3300025924 Ga0207694_10065048 Ga0207694_100650482 319
228 3300025931 Ga0207644_10073756 Ga0207644_100737562 319
229 3300025932 Ga0207690_10010832 Ga0207690_100108324 319
230 3300025934 Ga0207686_10015044 Ga0207686_100150444 319
231 3300025935 Ga0207709_10041155 Ga0207709_100411553 319
232 3300025936 Ga0207670_10101397 Ga0207670_101013971 319
233 3300025937 Ga0207669_10050346 Ga0207669_100503462 319
234 3300025938 Ga0207704_10096173 Ga0207704_100961732 319
235 3300025941 Ga0207711_10064405 Ga0207711_100644052 319
236 3300025944 Ga0207661_10007905 Ga0207661_100079052 319
237 3300025961 Ga0207712_10007633 Ga0207712_100076336 319
238 3300025986 Ga0207658_10118034 Ga0207658_101180342 319
239 3300026041 Ga0207639_10006305 Ga0207639_100063053 319
240 3300026067 Ga0207678_10032323 Ga0207678_100323234 319
241 3300026075 Ga0207708_10000810 Ga0207708_1000081016 319
242 3300026078 Ga0207702_10015689 Ga0207702_100156894 319
243 3300026088 Ga0207641_10093042 Ga0207641_100930422 319
244 3300026089 Ga0207648_10009659 Ga0207648_100096593 319
245 3300026116 Ga0207674_10045208 Ga0207674_100452083 319
246 3300026121 Ga0207683_10000252 Ga0207683_1000025220 319
247 3300026142 Ga0207698_10005113 Ga0207698_100051135 319
248 3300028379 Ga0268266_10085152 Ga0268266_100851522 319
249 3300028380 Ga0268265_10497791 Ga0268265_104977911 319
250 3300031251 Ga0265327_10017052 Ga0265327_100170522 319
251 3300037418 Ga0395900_0011462 Ga0395900_0011462_7970_8959 319
252 3300037466 Ga0395898_0004053 Ga0395898_0004053_7927_8916 319
253 3300038443 Ga0395901_0002362 Ga0395901_0002362_13262_14251 319
254 3300045976 Ga0466967_0040162 Ga0466967_0040162_1083_2099 319
255 3300046472 Ga0495580_0129620 Ga0495580_0129620_715_1731 319
256 3300046473 Ga0495582_0022599 Ga0495582_0022599_1456_2472 319
257 3300046473 Ga0495582_0061834 Ga0495582_0061834_593_1609 319
258 3300046475 Ga0495639_0020639 Ga0495639_0020639_313_1329 319
259 3300046476 Ga0495662_0079017 Ga0495662_0079017_248_1264 319
260 3300046664 Ga0495659_0027997 Ga0495659_0027997_211_1227 319
261 3300046681 Ga0495647_0018449 Ga0495647_0018449_894_1910 319
262 3300046683 Ga0495658_0036006 Ga0495658_0036006_279_1295 319
263 3300046691 Ga0495670_0161051 Ga0495670_0161051_51_1067 319
264 3300047315 Ga0495581_0005360 Ga0495581_0005360_2575_3591 319
265 3300047321 Ga0495676_0046069 Ga0495676_0046069_903_1919 319
266 3300047445 Ga0495677_0037618 Ga0495677_0037618_597_1616 319
267 3300048903 Ga0496100_0025189 Ga0496100_0025189_1062_2078 319
268 3300048904 Ga0496101_0076314 Ga0496101_0076314_556_1572 319
269 3300048905 Ga0496102_0013176 Ga0496102_0013176_2243_3259 319
270 3300048906 Ga0496103_0001098 Ga0496103_0001098_4331_5347 319
271 3300048907 Ga0496104_0174272 Ga0496104_0174272_680_1696 319
272 3300048907 Ga0496104_0261607 Ga0496104_0261607_505_1521 319
273 3300048908 Ga0496105_0011949 Ga0496105_0011949_4840_5856 319
274 3300048912 Ga0496109_0010798 Ga0496109_0010798_6125_7141 319
275 3300048912 Ga0496109_0020464 Ga0496109_0020464_3072_4088 319
276 3300048913 Ga0496110_0134571 Ga0496110_0134571_367_1383 319
277 3300048915 Ga0496112_0053498 Ga0496112_0053498_1034_2050 319
278 3300048915 Ga0496112_0142496 Ga0496112_0142496_289_1305 319
279 3300048916 Ga0496113_0042241 Ga0496113_0042241_1652_2668 319
280 3300048917 Ga0496114_0001599 Ga0496114_0001599_677_1693 319
281 3300048918 Ga0496115_0014202 Ga0496115_0014202_1082_2098 319
282 3300005356 Ga0070674_100083116 Ga0070674_1000831162 320
283 3300005364 Ga0070673_100204864 Ga0070673_1002048642 320
284 3300005366 Ga0070659_100271738 Ga0070659_1002717381 320
285 3300005435 Ga0070714_100006112 Ga0070714_1000061129 320
286 3300005548 Ga0070665_100222123 Ga0070665_1002221232 320
287 3300005618 Ga0068864_100485129 Ga0068864_1004851291 320
288 3300014325 Ga0163163_10307800 Ga0163163_103078002 320
289 3300025908 Ga0207643_10024559 Ga0207643_100245594 320
290 3300026095 Ga0207676_10080583 Ga0207676_100805833 320
291 3300026118 Ga0207675_100332477 Ga0207675_1003324772 320
292 3300026121 Ga0207683_10132264 Ga0207683_101322642 320
293 3300026142 Ga0207698_10389939 Ga0207698_103899392 320
294 3300037418 Ga0395900_0085144 Ga0395900_0085144_149_1138 320
295 3300037466 Ga0395898_0090718 Ga0395898_0090718_1884_2891 320
296 3300037471 Ga0395905_0036137 Ga0395905_0036137_2201_3208 320
297 3300038443 Ga0395901_0383372 Ga0395901_0383372_105_1094 320
298 3300044656 Ga0466969_0028617 Ga0466969_0028617_329_1345 320
299 3300045049 Ga0466959_0068084 Ga0466959_0068084_897_1913 320
300 3300045836 Ga0466958_0026768 Ga0466958_0026768_1373_2389 320
301 3300046472 Ga0495580_0307560 Ga0495580_0307560_45_1064 320
302 3300046663 Ga0495635_0091172 Ga0495635_0091172_330_1340 320
303 3300048917 Ga0496114_0362032 Ga0496114_0362032_25_1044 320
304 3300049583 Ga0501067_0011161 Ga0501067_0011161_554_1555 320
305 3300049584 Ga0501068_0015159 Ga0501068_0015159_2349_3350 320
306 3300049588 Ga0501072_0003295 Ga0501072_0003295_3033_4028 320
307 3300049589 Ga0501073_0048465 Ga0501073_0048465_731_1726 320
308 3300049741 Ga0501079_0063257 Ga0501079_0063257_1279_2274 320
309 3300049742 Ga0501080_0117392 Ga0501080_0117392_1076_2071 320
310 3300049744 Ga0501083_0005263 Ga0501083_0005263_4929_5924 320
311 3300050512 nmdc:mga0n895_151006_c1 nmdc:mga0n895_151006_c1_301_1308 320
312 3300054114 Ga0501084_0123656 Ga0501084_0123656_958_1953 320
313 3300060353 Ga0501082_0037598 Ga0501082_0037598_2178_3173 320
314 3300061734 Ga0530510_0007443 Ga0530510_0007443_2763_3764 320
315 3300005985 Ga0081539_10080617 Ga0081539_100806172 321
316 3300025922 Ga0207646_10182242 Ga0207646_101822422 321
317 3300037471 Ga0395905_0430476 Ga0395905_0430476_168_1175 321
318 3300042876 Ga0451577_0233390 Ga0451577_0233390_389_1408 321
319 3300048906 Ga0496103_0100236 Ga0496103_0100236_674_1693 321
320 3300048909 Ga0496106_0008645 Ga0496106_0008645_6197_7216 321
321 3300048910 Ga0496107_0159835 Ga0496107_0159835_289_1308 321
322 3300048915 Ga0496112_0138463 Ga0496112_0138463_460_1461 321
323 3300001977 JGI24746J21847_1000628 JGI24746J21847_10006282 327
324 3300001978 JGI24747J21853_1000673 JGI24747J21853_10006732 327
325 3300002070 JGI24750J21931_1001624 JGI24750J21931_10016243 327
326 3300002073 JGI24745J21846_1000282 JGI24745J21846_10002822 327
327 3300002075 JGI24738J21930_10000115 JGI24738J21930_100001155 327
328 3300002076 JGI24749J21850_1002054 JGI24749J21850_10020541 327
329 3300002239 JGI24034J26672_10009253 JGI24034J26672_100092532 327
330 3300005328 Ga0070676_10007560 Ga0070676_100075601 327
331 3300005329 Ga0070683_100014617 Ga0070683_1000146177 327
332 3300005331 Ga0070670_100004139 Ga0070670_1000041398 327
333 3300005334 Ga0068869_100003359 Ga0068869_1000033594 327
334 3300005334 Ga0068869_100335283 Ga0068869_1003352832 327
335 3300005337 Ga0070682_100007259 Ga0070682_1000072595 327
336 3300005338 Ga0068868_100001391 Ga0068868_1000013916 327
337 3300005338 Ga0068868_100127166 Ga0068868_1001271662 327
338 3300005339 Ga0070660_100010779 Ga0070660_1000107791 327
339 3300005340 Ga0070689_100223482 Ga0070689_1002234822 327
340 3300005343 Ga0070687_100000229 Ga0070687_10000022921 327
341 3300005344 Ga0070661_100000590 Ga0070661_10000059013 327
342 3300005345 Ga0070692_10003402 Ga0070692_100034023 327
343 3300005347 Ga0070668_100021641 Ga0070668_1000216414 327
344 3300005355 Ga0070671_100007239 Ga0070671_1000072395 327
345 3300005364 Ga0070673_100000944 Ga0070673_1000009442 327
346 3300005365 Ga0070688_100000244 Ga0070688_10000024415 327
347 3300005365 Ga0070688_100117118 Ga0070688_1001171182 327
348 3300005406 Ga0070703_10002303 Ga0070703_100023032 327
349 3300005435 Ga0070714_100037937 Ga0070714_1000379373 327
350 3300005436 Ga0070713_100003728 Ga0070713_1000037283 327
351 3300005437 Ga0070710_10001039 Ga0070710_100010399 327
352 3300005438 Ga0070701_10000326 Ga0070701_1000032610 327
353 3300005440 Ga0070705_100009155 Ga0070705_1000091552 327
354 3300005441 Ga0070700_100066424 Ga0070700_1000664243 327
355 3300005444 Ga0070694_100001729 Ga0070694_10000172910 327
356 3300005455 Ga0070663_100009511 Ga0070663_1000095115 327
357 3300005459 Ga0068867_100008148 Ga0068867_1000081485 327
358 3300005466 Ga0070685_10125790 Ga0070685_101257902 327
359 3300005539 Ga0068853_100011556 Ga0068853_1000115565 327
360 3300005543 Ga0070672_100092698 Ga0070672_1000926982 327
361 3300005544 Ga0070686_100010757 Ga0070686_1000107572 327
362 3300005544 Ga0070686_100042116 Ga0070686_1000421163 327
363 3300005545 Ga0070695_100003280 Ga0070695_1000032805 327
364 3300005545 Ga0070695_100086344 Ga0070695_1000863442 327
365 3300005547 Ga0070693_100006632 Ga0070693_1000066325 327
366 3300005548 Ga0070665_100110056 Ga0070665_1001100562 327
367 3300005549 Ga0070704_100000158 Ga0070704_10000015821 327
368 3300005563 Ga0068855_100021021 Ga0068855_1000210216 327
369 3300005564 Ga0070664_100024670 Ga0070664_1000246702 327
370 3300005614 Ga0068856_100026039 Ga0068856_1000260395 327
371 3300005615 Ga0070702_100000280 Ga0070702_1000002805 327
372 3300005615 Ga0070702_100085068 Ga0070702_1000850681 327
373 3300005617 Ga0068859_100002498 Ga0068859_1000024983 327
374 3300005618 Ga0068864_100000140 Ga0068864_10000014011 327
375 3300005618 Ga0068864_100152508 Ga0068864_1001525082 327
376 3300005719 Ga0068861_100001125 Ga0068861_1000011252 327
377 3300005840 Ga0068870_10000135 Ga0068870_1000013511 327
378 3300005841 Ga0068863_100018428 Ga0068863_1000184285 327
379 3300005843 Ga0068860_100003390 Ga0068860_1000033905 327
380 3300005843 Ga0068860_100209682 Ga0068860_1002096822 327
381 3300005844 Ga0068862_100004234 Ga0068862_1000042345 327
382 3300005937 Ga0081455_10000091 Ga0081455_10000091104 327
383 3300005937 Ga0081455_10003576 Ga0081455_100035763 327
384 3300005983 Ga0081540_1031742 Ga0081540_10317423 327
385 3300006028 Ga0070717_10022083 Ga0070717_100220833 327
386 3300006058 Ga0075432_10011193 Ga0075432_100111933 327
387 3300006173 Ga0070716_100232448 Ga0070716_1002324481 327
388 3300006175 Ga0070712_100376533 Ga0070712_1003765331 327
389 3300006237 Ga0097621_100004183 Ga0097621_10000418310 327
390 3300006358 Ga0068871_100001664 Ga0068871_1000016649 327
391 3300006846 Ga0075430_100001022 Ga0075430_1000010227 327
392 3300006852 Ga0075433_10002104 Ga0075433_1000210412 327
393 3300006852 Ga0075433_10003427 Ga0075433_100034276 327
394 3300006852 Ga0075433_10058778 Ga0075433_100587782 327
395 3300006871 Ga0075434_100001215 Ga0075434_10000121512 327
396 3300006871 Ga0075434_100085660 Ga0075434_1000856603 327
397 3300006880 Ga0075429_100000941 Ga0075429_10000094116 327
398 3300006881 Ga0068865_100009549 Ga0068865_1000095492 327
399 3300006931 Ga0097620_100002498 Ga0097620_10000249823 327
400 3300007076 Ga0075435_100016572 Ga0075435_1000165723 327
401 3300007076 Ga0075435_100057327 Ga0075435_1000573273 327
402 3300007076 Ga0075435_100086912 Ga0075435_1000869122 327
403 3300009011 Ga0105251_10012354 Ga0105251_100123541 327
404 3300009092 Ga0105250_10009975 Ga0105250_100099752 327
405 3300009093 Ga0105240_10064357 Ga0105240_100643573 327
406 3300009094 Ga0111539_10001115 Ga0111539_100011156 327
407 3300009098 Ga0105245_10001824 Ga0105245_100018246 327
408 3300009101 Ga0105247_10028201 Ga0105247_100282012 327
409 3300009101 Ga0105247_10073089 Ga0105247_100730892 327
410 3300009147 Ga0114129_10001230 Ga0114129_100012309 327
411 3300009147 Ga0114129_10005318 Ga0114129_100053186 327
412 3300009148 Ga0105243_10001397 Ga0105243_1000139716 327
413 3300009174 Ga0105241_10000586 Ga0105241_1000058610 327
414 3300009176 Ga0105242_10001675 Ga0105242_1000167511 327
415 3300009177 Ga0105248_10048114 Ga0105248_100481142 327
416 3300009551 Ga0105238_10096336 Ga0105238_100963362 327
417 3300009551 Ga0105238_10411241 Ga0105238_104112412 327
418 3300009553 Ga0105249_10001526 Ga0105249_1000152616 327
419 3300009553 Ga0105249_10180693 Ga0105249_101806932 327
420 3300010375 Ga0105239_10040455 Ga0105239_100404554 327
421 3300011119 Ga0105246_10003116 Ga0105246_100031165 327
422 3300013100 Ga0157373_10001384 Ga0157373_100013846 327
423 3300013102 Ga0157371_10016190 Ga0157371_100161905 327
424 3300013296 Ga0157374_10003666 Ga0157374_100036667 327
425 3300013296 Ga0157374_10093346 Ga0157374_100933462 327
426 3300013297 Ga0157378_10002087 Ga0157378_1000208713 327
427 3300013297 Ga0157378_10072592 Ga0157378_100725922 327
428 3300013306 Ga0163162_10003585 Ga0163162_1000358513 327
429 3300013306 Ga0163162_10376955 Ga0163162_103769552 327
430 3300013306 Ga0163162_10402907 Ga0163162_104029072 327
431 3300013307 Ga0157372_10003728 Ga0157372_100037287 327
432 3300013308 Ga0157375_10004460 Ga0157375_100044607 327
433 3300014325 Ga0163163_10006523 Ga0163163_1000652310 327
434 3300014326 Ga0157380_10005060 Ga0157380_100050605 327
435 3300014745 Ga0157377_10000449 Ga0157377_1000044915 327
436 3300014968 Ga0157379_10002609 Ga0157379_100026093 327
437 3300014968 Ga0157379_10144179 Ga0157379_101441792 327
438 3300014968 Ga0157379_10160943 Ga0157379_101609432 327
439 3300025271 Ga0207666_1000053 Ga0207666_100005310 327
440 3300025290 Ga0207673_1000140 Ga0207673_10001406 327
441 3300025315 Ga0207697_10000314 Ga0207697_1000031412 327
442 3300025885 Ga0207653_10002698 Ga0207653_100026982 327
443 3300025893 Ga0207682_10000104 Ga0207682_1000010413 327
444 3300025898 Ga0207692_10001611 Ga0207692_100016113 327
445 3300025899 Ga0207642_10182659 Ga0207642_101826592 327
446 3300025900 Ga0207710_10001384 Ga0207710_100013842 327
447 3300025900 Ga0207710_10011813 Ga0207710_100118133 327
448 3300025901 Ga0207688_10000236 Ga0207688_1000023613 327
449 3300025904 Ga0207647_10002772 Ga0207647_100027723 327
450 3300025906 Ga0207699_10005502 Ga0207699_100055022 327
451 3300025907 Ga0207645_10001219 Ga0207645_1000121916 327
452 3300025908 Ga0207643_10000035 Ga0207643_1000003515 327
453 3300025912 Ga0207707_10005181 Ga0207707_100051811 327
454 3300025913 Ga0207695_10122946 Ga0207695_101229462 327
455 3300025915 Ga0207693_10213278 Ga0207693_102132782 327
456 3300025917 Ga0207660_10001787 Ga0207660_1000178713 327
457 3300025918 Ga0207662_10000401 Ga0207662_100004015 327
458 3300025919 Ga0207657_10001276 Ga0207657_1000127615 327
459 3300025920 Ga0207649_10000309 Ga0207649_1000030910 327
460 3300025921 Ga0207652_10003742 Ga0207652_100037425 327
461 3300025923 Ga0207681_10002035 Ga0207681_100020352 327
462 3300025925 Ga0207650_10045783 Ga0207650_100457832 327
463 3300025926 Ga0207659_10000633 Ga0207659_1000063316 327
464 3300025927 Ga0207687_10000959 Ga0207687_1000095911 327
465 3300025927 Ga0207687_10105437 Ga0207687_101054371 327
466 3300025927 Ga0207687_10220570 Ga0207687_102205702 327
467 3300025928 Ga0207700_10011701 Ga0207700_100117015 327
468 3300025931 Ga0207644_10002922 Ga0207644_100029227 327
469 3300025931 Ga0207644_10006179 Ga0207644_100061793 327
470 3300025931 Ga0207644_10033856 Ga0207644_100338562 327
471 3300025932 Ga0207690_10170454 Ga0207690_101704541 327
472 3300025933 Ga0207706_10004534 Ga0207706_100045347 327
473 3300025934 Ga0207686_10001230 Ga0207686_100012307 327
474 3300025934 Ga0207686_10028894 Ga0207686_100288942 327
475 3300025935 Ga0207709_10035428 Ga0207709_100354282 327
476 3300025936 Ga0207670_10002361 Ga0207670_100023617 327
477 3300025936 Ga0207670_10380160 Ga0207670_103801601 327
478 3300025937 Ga0207669_10000340 Ga0207669_1000034011 327
479 3300025938 Ga0207704_10004184 Ga0207704_100041842 327
480 3300025939 Ga0207665_10001875 Ga0207665_1000187510 327
481 3300025940 Ga0207691_10001336 Ga0207691_1000133612 327
482 3300025941 Ga0207711_10004667 Ga0207711_100046678 327
483 3300025941 Ga0207711_10086673 Ga0207711_100866732 327
484 3300025942 Ga0207689_10000168 Ga0207689_1000016827 327
485 3300025942 Ga0207689_10083231 Ga0207689_100832313 327
486 3300025944 Ga0207661_10001339 Ga0207661_100013392 327
487 3300025945 Ga0207679_10000035 Ga0207679_10000035121 327
488 3300025945 Ga0207679_10164432 Ga0207679_101644322 327
489 3300025949 Ga0207667_10006315 Ga0207667_100063155 327
490 3300025960 Ga0207651_10000233 Ga0207651_100002332 327
491 3300025960 Ga0207651_10210410 Ga0207651_102104102 327
492 3300025972 Ga0207668_10001502 Ga0207668_1000150213 327
493 3300025981 Ga0207640_10000693 Ga0207640_100006937 327
494 3300025986 Ga0207658_10001140 Ga0207658_100011406 327
495 3300026023 Ga0207677_10002446 Ga0207677_100024464 327
496 3300026023 Ga0207677_10015236 Ga0207677_100152363 327
497 3300026035 Ga0207703_10006941 Ga0207703_100069417 327
498 3300026035 Ga0207703_10032135 Ga0207703_100321352 327
499 3300026067 Ga0207678_10003989 Ga0207678_100039898 327
500 3300026067 Ga0207678_10038465 Ga0207678_100384652 327
501 3300026067 Ga0207678_10496748 Ga0207678_104967481 327
502 3300026075 Ga0207708_10000906 Ga0207708_1000090616 327
503 3300026078 Ga0207702_10009427 Ga0207702_100094273 327
504 3300026088 Ga0207641_10005232 Ga0207641_100052324 327
505 3300026088 Ga0207641_10234748 Ga0207641_102347482 327
506 3300026089 Ga0207648_10002655 Ga0207648_100026558 327
507 3300026095 Ga0207676_10000849 Ga0207676_1000084910 327
508 3300026116 Ga0207674_10000535 Ga0207674_1000053516 327
509 3300026118 Ga0207675_100000365 Ga0207675_10000036516 327
510 3300026121 Ga0207683_10000667 Ga0207683_100006678 327
511 3300026142 Ga0207698_10009827 Ga0207698_100098275 327
512 3300027252 Ga0209973_1000555 Ga0209973_10005552 327
513 3300027552 Ga0209982_1011965 Ga0209982_10119652 327
514 3300027617 Ga0210002_1000993 Ga0210002_10009933 327
515 3300027717 Ga0209998_10000681 Ga0209998_100006816 327
516 3300027907 Ga0207428_10000415 Ga0207428_1000041527 327
517 3300027907 Ga0207428_10000636 Ga0207428_100006367 327
518 3300028379 Ga0268266_10013796 Ga0268266_100137963 327
519 3300028379 Ga0268266_10044143 Ga0268266_100441432 327
520 3300028380 Ga0268265_10015552 Ga0268265_100155525 327
521 3300028380 Ga0268265_10395432 Ga0268265_103954322 327
522 3300028381 Ga0268264_10002536 Ga0268264_1000253612 327
523 3300034816 Ga0373930_0003780 Ga0373930_0003780_188_1171 327
524 3300034820 Ga0373959_0026438 Ga0373959_0026438_101_1084 327
525 3300035084 Ga0373928_0002818 Ga0373928_0002818_919_1902 327
526 3300035084 Ga0373928_0007888 Ga0373928_0007888_380_1363 327
527 3300035088 Ga0373940_0007701 Ga0373940_0007701_1102_2085 327
528 3300035090 Ga0373949_0001131 Ga0373949_0001131_3455_4438 327
529 3300035112 Ga0373932_0001355 Ga0373932_0001355_3885_4868 327
530 3300035112 Ga0373932_0009796 Ga0373932_0009796_1307_2290 327
531 3300035114 Ga0373939_0001134 Ga0373939_0001134_1788_2771 327
532 3300035115 Ga0373941_0001699 Ga0373941_0001699_2674_3657 327
533 3300035121 Ga0373960_0003108 Ga0373960_0003108_1601_2584 327
534 3300035121 Ga0373960_0013833 Ga0373960_0013833_283_1266 327
535 3300035170 Ga0373943_0010005 Ga0373943_0010005_2670_3653 327
536 3300035171 Ga0373946_0006407 Ga0373946_0006407_928_1911 327
537 3300035691 Ga0373931_0003872 Ga0373931_0003872_1245_2228 327
538 3300035695 Ga0373927_0015576 Ga0373927_0015576_2562_3545 327
539 3300035725 Ga0373947_0008622 Ga0373947_0008622_2121_3104 327
540 3300037068 Ga0373925_0063842 Ga0373925_0063842_840_1823 327
541 3300046455 Ga0495603_0005620 Ga0495603_0005620_6036_7019 327
542 3300046459 Ga0495629_0001287 Ga0495629_0001287_8482_9465 327
543 3300046473 Ga0495582_0009997 Ga0495582_0009997_2785_3768 327
544 3300046499 Ga0495594_0004071 Ga0495594_0004071_2180_3163 327
545 3300046681 Ga0495647_0018673 Ga0495647_0018673_1057_2040 327
546 3300046683 Ga0495658_0008547 Ga0495658_0008547_1926_2909 327
547 3300046689 Ga0495613_0023263 Ga0495613_0023263_1188_2171 327
548 3300047315 Ga0495581_0017198 Ga0495581_0017198_2915_3898 327
549 3300047322 Ga0495680_0016363 Ga0495680_0016363_4578_5561 327
550 3300047673 Ga0495593_0005907 Ga0495593_0005907_4831_5814 327
551 3300048089 Ga0495614_0026782 Ga0495614_0026782_338_1321 327
552 3300048903 Ga0496100_0014653 Ga0496100_0014653_533_1516 327
553 3300048903 Ga0496100_0015937 Ga0496100_0015937_314_1297 327
554 3300048903 Ga0496100_0130498 Ga0496100_0130498_254_1237 327
555 3300048904 Ga0496101_0007689 Ga0496101_0007689_1881_2864 327
556 3300048904 Ga0496101_0073634 Ga0496101_0073634_1063_2046 327
557 3300048905 Ga0496102_0005971 Ga0496102_0005971_1673_2656 327
558 3300048905 Ga0496102_0013322 Ga0496102_0013322_226_1209 327
559 3300048905 Ga0496102_0032372 Ga0496102_0032372_597_1580 327
560 3300048906 Ga0496103_0000959 Ga0496103_0000959_4417_5400 327
561 3300048906 Ga0496103_0003949 Ga0496103_0003949_4032_5015 327
562 3300048906 Ga0496103_0008320 Ga0496103_0008320_1042_2025 327
563 3300048906 Ga0496103_0036968 Ga0496103_0036968_1114_2097 327
564 3300048907 Ga0496104_0008532 Ga0496104_0008532_6736_7719 327
565 3300048907 Ga0496104_0028388 Ga0496104_0028388_837_1820 327
566 3300048907 Ga0496104_0116041 Ga0496104_0116041_1063_2046 327
567 3300048908 Ga0496105_0022682 Ga0496105_0022682_923_1906 327
568 3300048908 Ga0496105_0051522 Ga0496105_0051522_1495_2478 327
569 3300048908 Ga0496105_0140930 Ga0496105_0140930_523_1506 327
570 3300048909 Ga0496106_0014782 Ga0496106_0014782_1685_2668 327
571 3300048910 Ga0496107_0012134 Ga0496107_0012134_1847_2830 327
572 3300048910 Ga0496107_0020565 Ga0496107_0020565_3182_4165 327
573 3300048910 Ga0496107_0022086 Ga0496107_0022086_3452_4435 327
574 3300048911 Ga0496108_0006621 Ga0496108_0006621_1063_2046 327
575 3300048911 Ga0496108_0013281 Ga0496108_0013281_533_1516 327
576 3300048911 Ga0496108_0022558 Ga0496108_0022558_2329_3312 327
577 3300048911 Ga0496108_0033044 Ga0496108_0033044_859_1842 327
578 3300048912 Ga0496109_0000575 Ga0496109_0000575_11243_12226 327
579 3300048912 Ga0496109_0008219 Ga0496109_0008219_3226_4209 327
580 3300048912 Ga0496109_0008961 Ga0496109_0008961_7330_8313 327
581 3300048912 Ga0496109_0013319 Ga0496109_0013319_1500_2483 327
582 3300048914 Ga0496111_0002998 Ga0496111_0002998_1575_2558 327
583 3300048914 Ga0496111_0031145 Ga0496111_0031145_923_1906 327
584 3300048914 Ga0496111_0137423 Ga0496111_0137423_382_1365 327
585 3300048915 Ga0496112_0092349 Ga0496112_0092349_923_1906 327
586 3300048915 Ga0496112_0188595 Ga0496112_0188595_524_1507 327
587 3300048916 Ga0496113_0016623 Ga0496113_0016623_923_1906 327
588 3300048916 Ga0496113_0023132 Ga0496113_0023132_3182_4165 327
589 3300048916 Ga0496113_0042805 Ga0496113_0042805_2061_3044 327
590 3300048916 Ga0496113_0126814 Ga0496113_0126814_923_1906 327
591 3300048917 Ga0496114_0014385 Ga0496114_0014385_2953_3936 327
592 3300048917 Ga0496114_0207578 Ga0496114_0207578_393_1376 327
593 3300048918 Ga0496115_0007947 Ga0496115_0007947_1837_2820 327
594 3300048918 Ga0496115_0009498 Ga0496115_0009498_5178_6161 327
595 3300050507 nmdc:mga05p37_281_c1 nmdc:mga05p37_281_c1_39631_40614 327
596 3300050507 nmdc:mga05p37_938_c1 nmdc:mga05p37_938_c1_14138_15121 327
597 3300050510 nmdc:mga06r32_2024_c1 nmdc:mga06r32_2024_c1_11792_12775 327
598 3300050511 nmdc:mga08y16_912_c1 nmdc:mga08y16_912_c1_22991_23974 327
599 3300050512 nmdc:mga0n895_372343_c1 nmdc:mga0n895_372343_c1_119_1102 327
600 3300050513 nmdc:mga0rr50_1630_c1 nmdc:mga0rr50_1630_c1_6190_7173 327
601 3300050513 nmdc:mga0rr50_6418_c1 nmdc:mga0rr50_6418_c1_3086_4069 327
602 3300050513 nmdc:mga0rr50_73341_c1 nmdc:mga0rr50_73341_c1_772_1755 327
603 3300050515 nmdc:mga0a205_2393_c1 nmdc:mga0a205_2393_c1_3917_4900 327
604 3300050515 nmdc:mga0a205_2745_c1 nmdc:mga0a205_2745_c1_7050_8033 327
605 3300050515 nmdc:mga0a205_571_c1 nmdc:mga0a205_571_c1_10014_10997 327
606 3300053085 Ga0495619_0000234 Ga0495619_0000234_23978_24961 327

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

30

185

0.96

PF08352

oligo_HPY

Oligopeptide/dipeptide transporter, C-terminal region

236

302

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
3tuj-assembly1.cif.gz_C inward facing conformations of the metni methionine abc transporter: dm crystal form 0.8943 4 258
2awo-assembly2.cif.gz_D crystal structure of the adp-mg-bound e. coli malk (crystallized with adp-mg) 0.892 5 255
4yer-assembly1.cif.gz_A crystal structure of an abc transporter atp-binding protein (tm_1403) from thermotoga maritima msb8 at 2.35 a resolution 0.8884 1 244
4yer-assembly1.cif.gz_B crystal structure of an abc transporter atp-binding protein (tm_1403) from thermotoga maritima msb8 at 2.35 a resolution 0.8861 1 244
6cvl-assembly1.cif.gz_C crystal structure of the escherichia coli atpgs-bound metni methionine abc transporter in complex with its metq binding protein 0.8852 4 258
ID Description Score Start End Superfamily
af_P33916_3_268_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9185 2 260 3.40.50.300
af_P75796_10_305_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9046 2 264 3.40.50.300
af_Q2G1F8_275_530_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.895 4 259 3.40.50.300
af_P33916_3_268_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8922 2 260 3.40.50.300
af_Q2FVF0_1_268_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8914 2 267 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A3S1TSN0-F1-model_v4 deleted 0.911 2 251
AF-A0A2S9BS46-F1-model_v4 Dipeptide/oligopeptide/nickel ABC transporter ATP-binding protein 0.9103 16 258 GO:0005524
GO:0005886
GO:0016887
AF-A0A7V9M7E5-F1-model_v4 ABC transporter ATP-binding protein 0.9098 1 256 GO:0005524
GO:0016887
AF-A0A6G2QKZ1-F1-model_v4 ATP-binding cassette domain-containing protein 0.9095 2 258 GO:0005524
GO:0016887
AF-A0A380NHC1-F1-model_v4 Methionine import ATP-binding protein MetN 2 (EC 3.6.3.-) 0.9083 5 256 GO:0005524
GO:0016887
GO:0033232

Feature Viewer

pLDDT pTM Quality
76.29 0.78 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map