F468479
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 605 | 254 | 604 | 277 |
Family's Representative Sequence
| Representative Sequence | 3300025921|Ga0207652_10240559|Ga0207652_102405592 |
| Length | 326 |
| Sequence | MSIREDPTFRNMIAWSTRPRRECAANIQLSCSRAHGGMMAESARPKPPGDVMKRIGRVALPLIFAGAAITVALAQRAFRQYPSVEYGESIPLPPDWNQPGEWTFARLMFPPGPLDGYRGRFDGPWQEGLSLWTQDYPRADRALANAVRRLTRIQARSVEQPVSLDDGDEIYNWPWLYAVQVGEWGLTEKEAKKLRDYLLRGGFFMADDCHGSEEQAYFEKTMKMVFPDRKLVDIPDSDPIFHTFFDLDHRFQIPGMEHLATGHKKDGYVPHWKGIYDDKGRIMVAFSLNSDIGDSWEFLDDRRYPAKFTVLGTEIGVNYVIYAMTH |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2884215851 | Edaphobacter sp. 12200R-103 | Isolate | Rhizosphere |
| 2 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 3 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 4 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 5 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 8 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 10 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 11 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 13 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 20 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 21 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 29 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 30 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 32 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 33 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 35 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 40 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 42 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 43 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 44 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 45 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 46 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 47 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 48 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 49 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 50 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 51 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 52 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 53 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 55 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 57 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 58 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 59 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 60 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 61 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 62 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 64 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 91 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 92 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 93 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 94 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 95 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 96 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 97 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 98 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 99 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 141 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 144 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 145 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 146 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 147 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 148 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 149 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 150 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 151 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 152 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 153 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 154 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 155 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 156 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 157 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 158 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 159 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 160 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 161 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 162 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 163 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 164 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 165 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 166 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 167 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 168 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 169 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 170 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 171 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 172 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 173 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 174 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 175 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 176 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 177 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 221 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 222 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 223 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 224 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 225 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 226 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 227 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 228 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 229 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 230 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 231 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 232 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 233 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 234 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 235 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 236 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 237 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 238 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 239 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 240 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 241 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 242 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 243 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 244 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 245 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 246 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 247 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 248 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 249 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 250 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 251 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 252 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 253 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 254 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.51 |
| Metatranscriptomes | 1.32 |
| Isolates | 0.17 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.33 |
| Nodule | 0 |
| Rhizoplane | 0.66 |
| Rhizosphere | 92.07 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 6.94 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | rootH2_10156923 | 3300003320 | Bacteria | 2071 |
| 2 | Ga0058863_10127638 | 3300004799 | Bacteria | 2235 |
| 3 | Ga0058862_12661585 | 3300004803 | Bacteria | 2510 |
| 4 | Ga0070658_10009641 | 3300005327 | Bacteria | 7751 |
| 5 | Ga0070658_10019305 | 3300005327 | Bacteria | 5459 |
| 6 | Ga0070658_10097019 | 3300005327 | Unclassified | 2434 |
| 7 | Ga0070683_100525215 | 3300005329 | Unclassified | 1131 |
| 8 | Ga0068869_100060918 | 3300005334 | Bacteria | 2767 |
| 9 | Ga0070666_10000867 | 3300005335 | Bacteria | 18321 |
| 10 | Ga0070680_100017692 | 3300005336 | Bacteria | 5623 |
| 11 | Ga0070680_100126939 | 3300005336 | Bacteria | 2132 |
| 12 | Ga0070680_100465250 | 3300005336 | Bacteria | 1080 |
| 13 | Ga0068868_100003367 | 3300005338 | Bacteria | 11118 |
| 14 | Ga0068868_100093551 | 3300005338 | Bacteria | 2424 |
| 15 | Ga0070660_100007684 | 3300005339 | Bacteria | 7513 |
| 16 | Ga0070660_100012775 | 3300005339 | Bacteria | 6003 |
| 17 | Ga0070660_100015575 | 3300005339 | Bacteria | 5494 |
| 18 | Ga0070692_10053668 | 3300005345 | Bacteria | 2102 |
| 19 | Ga0070668_100012225 | 3300005347 | Bacteria | 6395 |
| 20 | Ga0070668_100035497 | 3300005347 | Bacteria | 3802 |
| 21 | Ga0070671_100061186 | 3300005355 | Bacteria | 3136 |
| 22 | Ga0070674_100334430 | 3300005356 | Bacteria | 1218 |
| 23 | Ga0070673_100054851 | 3300005364 | Bacteria | 3137 |
| 24 | Ga0070659_100016154 | 3300005366 | Bacteria | 5601 |
| 25 | Ga0070659_100023438 | 3300005366 | Bacteria | 4723 |
| 26 | Ga0070667_100018244 | 3300005367 | Bacteria | 5817 |
| 27 | Ga0070667_100281147 | 3300005367 | Bacteria | 1494 |
| 28 | Ga0070703_10076787 | 3300005406 | Bacteria | 1128 |
| 29 | Ga0070709_10056950 | 3300005434 | Bacteria | 2474 |
| 30 | Ga0070714_100000338 | 3300005435 | Bacteria | 35168 |
| 31 | Ga0070714_100000992 | 3300005435 | Bacteria | 20251 |
| 32 | Ga0070714_100149869 | 3300005435 | Bacteria | 2101 |
| 33 | Ga0070714_100422047 | 3300005435 | Unclassified | 1264 |
| 34 | Ga0070714_100444930 | 3300005435 | Unclassified | 1230 |
| 35 | Ga0070713_100170015 | 3300005436 | Unclassified | 1952 |
| 36 | Ga0070710_10104289 | 3300005437 | Bacteria | 1694 |
| 37 | Ga0070710_10114669 | 3300005437 | Bacteria | 1623 |
| 38 | Ga0070710_10280974 | 3300005437 | Unclassified | 1080 |
| 39 | Ga0070701_10000981 | 3300005438 | Bacteria | 10339 |
| 40 | Ga0070663_100291367 | 3300005455 | Bacteria | 1304 |
| 41 | Ga0070678_100118782 | 3300005456 | Bacteria | 2081 |
| 42 | Ga0070678_100174669 | 3300005456 | Bacteria | 1753 |
| 43 | Ga0070662_100072938 | 3300005457 | Bacteria | 2536 |
| 44 | Ga0070681_10012721 | 3300005458 | Bacteria | 8353 |
| 45 | Ga0070681_10040595 | 3300005458 | Unclassified | 4661 |
| 46 | Ga0070681_10105662 | 3300005458 | Bacteria | 2758 |
| 47 | Ga0070681_10259845 | 3300005458 | Bacteria | 1648 |
| 48 | Ga0070681_10692694 | 3300005458 | Bacteria | 935 |
| 49 | Ga0068867_100018673 | 3300005459 | Bacteria | 4929 |
| 50 | Ga0070706_100082040 | 3300005467 | Bacteria | 2987 |
| 51 | Ga0070706_100208419 | 3300005467 | Bacteria | 1825 |
| 52 | Ga0070679_100030586 | 3300005530 | Bacteria | 5315 |
| 53 | Ga0070679_100037253 | 3300005530 | Unclassified | 4830 |
| 54 | Ga0070679_100213691 | 3300005530 | Bacteria | 1891 |
| 55 | Ga0070679_100235461 | 3300005530 | Bacteria | 1790 |
| 56 | Ga0070679_100483413 | 3300005530 | Bacteria | 1182 |
| 57 | Ga0070684_100160391 | 3300005535 | Bacteria | 2040 |
| 58 | Ga0070684_100184391 | 3300005535 | Bacteria | 1898 |
| 59 | Ga0070684_100325646 | 3300005535 | Unclassified | 1412 |
| 60 | Ga0070697_100539159 | 3300005536 | Bacteria | 1022 |
| 61 | Ga0068853_100030405 | 3300005539 | Bacteria | 4562 |
| 62 | Ga0068853_100036291 | 3300005539 | Bacteria | 4191 |
| 63 | Ga0070695_100235529 | 3300005545 | Bacteria | 1325 |
| 64 | Ga0070696_100359340 | 3300005546 | Bacteria | 1130 |
| 65 | Ga0070665_100034223 | 3300005548 | Bacteria | 5109 |
| 66 | Ga0070665_100060487 | 3300005548 | Unclassified | 3796 |
| 67 | Ga0070665_100069541 | 3300005548 | Bacteria | 3529 |
| 68 | Ga0070665_100115814 | 3300005548 | Unclassified | 2683 |
| 69 | Ga0070665_100244742 | 3300005548 | Bacteria | 1794 |
| 70 | Ga0070665_100277908 | 3300005548 | Unclassified | 1676 |
| 71 | Ga0070665_100378122 | 3300005548 | Bacteria | 1423 |
| 72 | Ga0070704_100074410 | 3300005549 | Bacteria | 2477 |
| 73 | Ga0068855_100007892 | 3300005563 | Bacteria | 12855 |
| 74 | Ga0068855_100029557 | 3300005563 | Bacteria | 6550 |
| 75 | Ga0068855_100037522 | 3300005563 | Bacteria | 5761 |
| 76 | Ga0068855_100078424 | 3300005563 | Bacteria | 3832 |
| 77 | Ga0068855_100082093 | 3300005563 | Bacteria | 3736 |
| 78 | Ga0068855_100090590 | 3300005563 | Bacteria | 3529 |
| 79 | Ga0068855_100093481 | 3300005563 | Bacteria | 3468 |
| 80 | Ga0068855_100108734 | 3300005563 | Bacteria | 3184 |
| 81 | Ga0068855_100214113 | 3300005563 | Bacteria | 2164 |
| 82 | Ga0068855_100215309 | 3300005563 | Bacteria | 2157 |
| 83 | Ga0068855_100228378 | 3300005563 | Unclassified | 2085 |
| 84 | Ga0068855_100499146 | 3300005563 | Bacteria | 1322 |
| 85 | Ga0070664_100122596 | 3300005564 | Unclassified | 2277 |
| 86 | Ga0068857_100029235 | 3300005577 | Bacteria | 4863 |
| 87 | Ga0068857_100038628 | 3300005577 | Bacteria | 4227 |
| 88 | Ga0068854_100133014 | 3300005578 | Unclassified | 1901 |
| 89 | Ga0068856_100019095 | 3300005614 | Bacteria | 6653 |
| 90 | Ga0068856_100022940 | 3300005614 | Bacteria | 6068 |
| 91 | Ga0068856_100063719 | 3300005614 | Unclassified | 3641 |
| 92 | Ga0068856_100320192 | 3300005614 | Bacteria | 1568 |
| 93 | Ga0068852_100004648 | 3300005616 | Bacteria | 9731 |
| 94 | Ga0068852_100033624 | 3300005616 | Bacteria | 4259 |
| 95 | Ga0068852_100135130 | 3300005616 | Bacteria | 2276 |
| 96 | Ga0068852_100481491 | 3300005616 | Unclassified | 1233 |
| 97 | Ga0068859_100017005 | 3300005617 | Bacteria | 7301 |
| 98 | Ga0068859_100041054 | 3300005617 | Bacteria | 4648 |
| 99 | Ga0068859_100463612 | 3300005617 | Bacteria | 1363 |
| 100 | Ga0068864_100015618 | 3300005618 | Bacteria | 6316 |
| 101 | Ga0068864_100466696 | 3300005618 | Bacteria | 1210 |
| 102 | Ga0068864_100534170 | 3300005618 | Bacteria | 1132 |
| 103 | Ga0068851_10034231 | 3300005834 | Bacteria | 2535 |
| 104 | Ga0068863_100015286 | 3300005841 | Bacteria | 7376 |
| 105 | Ga0068863_100039728 | 3300005841 | Bacteria | 4475 |
| 106 | Ga0068863_100134865 | 3300005841 | Bacteria | 2359 |
| 107 | Ga0068863_100259769 | 3300005841 | Bacteria | 1679 |
| 108 | Ga0068863_100303582 | 3300005841 | Bacteria | 1549 |
| 109 | Ga0068858_100007380 | 3300005842 | Bacteria | 10636 |
| 110 | Ga0068858_100019068 | 3300005842 | Bacteria | 6417 |
| 111 | Ga0068858_100127039 | 3300005842 | Bacteria | 2388 |
| 112 | Ga0068860_100011760 | 3300005843 | Bacteria | 8625 |
| 113 | Ga0068860_100101383 | 3300005843 | Bacteria | 2747 |
| 114 | Ga0068860_100137361 | 3300005843 | Bacteria | 2348 |
| 115 | Ga0068860_100616289 | 3300005843 | Bacteria | 1092 |
| 116 | Ga0081455_10021250 | 3300005937 | Bacteria | 6090 |
| 117 | Ga0081455_10194456 | 3300005937 | Bacteria | 1524 |
| 118 | Ga0081540_1017053 | 3300005983 | Bacteria | 4514 |
| 119 | Ga0070717_10005887 | 3300006028 | Bacteria | 8978 |
| 120 | Ga0070717_10005941 | 3300006028 | Bacteria | 8937 |
| 121 | Ga0070717_10189470 | 3300006028 | Bacteria | 1797 |
| 122 | Ga0070712_100043245 | 3300006175 | Unclassified | 3100 |
| 123 | Ga0097621_100002398 | 3300006237 | Bacteria | 12843 |
| 124 | Ga0097621_100017321 | 3300006237 | Bacteria | 5470 |
| 125 | Ga0097621_100064753 | 3300006237 | Bacteria | 3007 |
| 126 | Ga0097621_100068163 | 3300006237 | Bacteria | 2934 |
| 127 | Ga0097621_100103043 | 3300006237 | Bacteria | 2403 |
| 128 | Ga0068871_100007571 | 3300006358 | Bacteria | 7769 |
| 129 | Ga0068871_100040114 | 3300006358 | Bacteria | 3749 |
| 130 | Ga0068871_100048999 | 3300006358 | Bacteria | 3412 |
| 131 | Ga0075428_100372349 | 3300006844 | Unclassified | 1531 |
| 132 | Ga0075430_100027318 | 3300006846 | Bacteria | 4850 |
| 133 | Ga0075434_100437062 | 3300006871 | Bacteria | 1330 |
| 134 | Ga0068865_100010826 | 3300006881 | Bacteria | 5690 |
| 135 | Ga0068865_100258110 | 3300006881 | Bacteria | 1378 |
| 136 | Ga0075436_100000108 | 3300006914 | Bacteria | 48881 |
| 137 | Ga0075436_100009556 | 3300006914 | Bacteria | 6638 |
| 138 | Ga0097620_100017005 | 3300006931 | Bacteria | 7301 |
| 139 | Ga0097620_100041054 | 3300006931 | Bacteria | 4648 |
| 140 | Ga0097620_100463629 | 3300006931 | Bacteria | 1363 |
| 141 | Ga0099794_10261954 | 3300007265 | Bacteria | 892 |
| 142 | Ga0105240_10001940 | 3300009093 | Bacteria | 34288 |
| 143 | Ga0105240_10002071 | 3300009093 | Bacteria | 32871 |
| 144 | Ga0105240_10002300 | 3300009093 | Bacteria | 30903 |
| 145 | Ga0105240_10003079 | 3300009093 | Bacteria | 26206 |
| 146 | Ga0105240_10008037 | 3300009093 | Bacteria | 15182 |
| 147 | Ga0105240_10065336 | 3300009093 | Unclassified | 4517 |
| 148 | Ga0105240_10102083 | 3300009093 | Bacteria | 3486 |
| 149 | Ga0105240_10305603 | 3300009093 | Unclassified | 1818 |
| 150 | Ga0105240_10314158 | 3300009093 | Bacteria | 1788 |
| 151 | Ga0105240_10595764 | 3300009093 | Bacteria | 1218 |
| 152 | Ga0111539_10266039 | 3300009094 | Unclassified | 1996 |
| 153 | Ga0105245_10013658 | 3300009098 | Bacteria | 7074 |
| 154 | Ga0105245_10023003 | 3300009098 | Bacteria | 5468 |
| 155 | Ga0105245_10050570 | 3300009098 | Bacteria | 3726 |
| 156 | Ga0105245_10078237 | 3300009098 | Bacteria | 3018 |
| 157 | Ga0105245_10320077 | 3300009098 | Bacteria | 1528 |
| 158 | Ga0105247_10144793 | 3300009101 | Bacteria | 1560 |
| 159 | Ga0105241_10107222 | 3300009174 | Bacteria | 2231 |
| 160 | Ga0105242_10150562 | 3300009176 | Bacteria | 2028 |
| 161 | Ga0105242_10277150 | 3300009176 | Unclassified | 1522 |
| 162 | Ga0105242_10398554 | 3300009176 | Unclassified | 1284 |
| 163 | Ga0105248_10004449 | 3300009177 | Bacteria | 15512 |
| 164 | Ga0105248_10033698 | 3300009177 | Bacteria | 5723 |
| 165 | Ga0105248_10066107 | 3300009177 | Unclassified | 4060 |
| 166 | Ga0105248_10251417 | 3300009177 | Bacteria | 1990 |
| 167 | Ga0105237_10001515 | 3300009545 | Bacteria | 30472 |
| 168 | Ga0105237_10005232 | 3300009545 | Bacteria | 14678 |
| 169 | Ga0105237_10007159 | 3300009545 | Bacteria | 12256 |
| 170 | Ga0105237_10024235 | 3300009545 | Bacteria | 6209 |
| 171 | Ga0105237_10358903 | 3300009545 | Bacteria | 1462 |
| 172 | Ga0105237_10506803 | 3300009545 | Bacteria | 1213 |
| 173 | Ga0105237_10554920 | 3300009545 | Unclassified | 1155 |
| 174 | Ga0105238_10007197 | 3300009551 | Bacteria | 11136 |
| 175 | Ga0105238_10033069 | 3300009551 | Bacteria | 5262 |
| 176 | Ga0105238_10038312 | 3300009551 | Bacteria | 4869 |
| 177 | Ga0105238_10064619 | 3300009551 | Unclassified | 3659 |
| 178 | Ga0105238_10102576 | 3300009551 | Unclassified | 2842 |
| 179 | Ga0105238_10133131 | 3300009551 | Unclassified | 2464 |
| 180 | Ga0105238_10273126 | 3300009551 | Bacteria | 1671 |
| 181 | Ga0105249_10202080 | 3300009553 | Bacteria | 1945 |
| 182 | Ga0105249_10350615 | 3300009553 | Unclassified | 1495 |
| 183 | Ga0105239_10039631 | 3300010375 | Bacteria | 5161 |
| 184 | Ga0105239_10154156 | 3300010375 | Bacteria | 2565 |
| 185 | Ga0105239_10242156 | 3300010375 | Bacteria | 2024 |
| 186 | Ga0105239_10262439 | 3300010375 | Bacteria | 1941 |
| 187 | Ga0105239_10403191 | 3300010375 | Bacteria | 1548 |
| 188 | Ga0105239_10704963 | 3300010375 | Bacteria | 1154 |
| 189 | Ga0105239_10734968 | 3300010375 | Unclassified | 1129 |
| 190 | Ga0105246_10158518 | 3300011119 | Bacteria | 1722 |
| 191 | Ga0105246_10170019 | 3300011119 | Bacteria | 1668 |
| 192 | Ga0157373_10249959 | 3300013100 | Unclassified | 1254 |
| 193 | Ga0157373_10251314 | 3300013100 | Unclassified | 1250 |
| 194 | Ga0157371_10054199 | 3300013102 | Bacteria | 2848 |
| 195 | Ga0157371_10249364 | 3300013102 | Unclassified | 1278 |
| 196 | Ga0157370_10030360 | 3300013104 | Bacteria | 5296 |
| 197 | Ga0157370_10050837 | 3300013104 | Bacteria | 3960 |
| 198 | Ga0157370_10071875 | 3300013104 | Unclassified | 3264 |
| 199 | Ga0157370_10078802 | 3300013104 | Unclassified | 3102 |
| 200 | Ga0157370_10263731 | 3300013104 | Bacteria | 1592 |
| 201 | Ga0157369_10003819 | 3300013105 | Bacteria | 17897 |
| 202 | Ga0157369_10010057 | 3300013105 | Bacteria | 10801 |
| 203 | Ga0157369_10025285 | 3300013105 | Bacteria | 6592 |
| 204 | Ga0157369_10068313 | 3300013105 | Bacteria | 3818 |
| 205 | Ga0157369_10077474 | 3300013105 | Unclassified | 3563 |
| 206 | Ga0157369_10104792 | 3300013105 | Bacteria | 3011 |
| 207 | Ga0157369_10193901 | 3300013105 | Bacteria | 2134 |
| 208 | Ga0157369_10227386 | 3300013105 | Unclassified | 1951 |
| 209 | Ga0157369_10248687 | 3300013105 | Bacteria | 1856 |
| 210 | Ga0157369_10410370 | 3300013105 | Unclassified | 1405 |
| 211 | Ga0157369_10503294 | 3300013105 | Bacteria | 1253 |
| 212 | Ga0157374_10003283 | 3300013296 | Bacteria | 13586 |
| 213 | Ga0157374_10007242 | 3300013296 | Bacteria | 9453 |
| 214 | Ga0157374_10021637 | 3300013296 | Bacteria | 5726 |
| 215 | Ga0157374_10032303 | 3300013296 | Bacteria | 4764 |
| 216 | Ga0157374_10035024 | 3300013296 | Bacteria | 4591 |
| 217 | Ga0157374_10179241 | 3300013296 | Bacteria | 2069 |
| 218 | Ga0157378_10016931 | 3300013297 | Bacteria | 6390 |
| 219 | Ga0157378_10065088 | 3300013297 | Bacteria | 3262 |
| 220 | Ga0157378_10131003 | 3300013297 | Bacteria | 2321 |
| 221 | Ga0157378_10279212 | 3300013297 | Unclassified | 1609 |
| 222 | Ga0157378_10290258 | 3300013297 | Bacteria | 1580 |
| 223 | Ga0163162_10006750 | 3300013306 | Bacteria | 11137 |
| 224 | Ga0163162_10058713 | 3300013306 | Bacteria | 3877 |
| 225 | Ga0163162_10251945 | 3300013306 | Unclassified | 1897 |
| 226 | Ga0157372_10012096 | 3300013307 | Bacteria | 9192 |
| 227 | Ga0157372_10019755 | 3300013307 | Bacteria | 7261 |
| 228 | Ga0157372_10025965 | 3300013307 | Bacteria | 6371 |
| 229 | Ga0157372_10091926 | 3300013307 | Unclassified | 3451 |
| 230 | Ga0157372_10099974 | 3300013307 | Bacteria | 3309 |
| 231 | Ga0157372_10125754 | 3300013307 | Unclassified | 2948 |
| 232 | Ga0157372_10137323 | 3300013307 | Bacteria | 2816 |
| 233 | Ga0157372_10295501 | 3300013307 | Bacteria | 1884 |
| 234 | Ga0157372_10595132 | 3300013307 | Bacteria | 1289 |
| 235 | Ga0157375_10074165 | 3300013308 | Bacteria | 3423 |
| 236 | Ga0163163_10003155 | 3300014325 | Bacteria | 13965 |
| 237 | Ga0163163_10010693 | 3300014325 | Bacteria | 8272 |
| 238 | Ga0163163_10134452 | 3300014325 | Bacteria | 2513 |
| 239 | Ga0157380_10003481 | 3300014326 | Bacteria | 10810 |
| 240 | Ga0157380_10242931 | 3300014326 | Bacteria | 1625 |
| 241 | Ga0157379_10626519 | 3300014968 | Bacteria | 1005 |
| 242 | Ga0157376_10278545 | 3300014969 | Unclassified | 1574 |
| 243 | Ga0157376_10282891 | 3300014969 | Bacteria | 1563 |
| 244 | Ga0157376_10313630 | 3300014969 | Bacteria | 1489 |
| 245 | Ga0157376_10501729 | 3300014969 | Bacteria | 1193 |
| 246 | Ga0163161_10043331 | 3300017792 | Bacteria | 3240 |
| 247 | Ga0197907_11375067 | 3300020069 | Unclassified | 2002 |
| 248 | Ga0206355_1614066 | 3300020076 | Unclassified | 1572 |
| 249 | Ga0206350_11349122 | 3300020080 | Bacteria | 1102 |
| 250 | Ga0213873_10000753 | 3300021358 | Bacteria | 5236 |
| 251 | Ga0213872_10056354 | 3300021361 | Bacteria | 1780 |
| 252 | Ga0213874_10024539 | 3300021377 | Unclassified | 1692 |
| 253 | Ga0213876_10005055 | 3300021384 | Bacteria | 7275 |
| 254 | Ga0213876_10015893 | 3300021384 | Unclassified | 3983 |
| 255 | Ga0213876_10035428 | 3300021384 | Bacteria | 2632 |
| 256 | Ga0213875_10000005 | 3300021388 | Bacteria | 595146 |
| 257 | Ga0213875_10000196 | 3300021388 | Bacteria | 61973 |
| 258 | Ga0213875_10023873 | 3300021388 | Bacteria | 2918 |
| 259 | Ga0213875_10036423 | 3300021388 | Bacteria | 2320 |
| 260 | Ga0213875_10061676 | 3300021388 | Bacteria | 1754 |
| 261 | Ga0213875_10083536 | 3300021388 | Bacteria | 1490 |
| 262 | Ga0224712_10012106 | 3300022467 | Unclassified | 2701 |
| 263 | Ga0224712_10086811 | 3300022467 | Unclassified | 1302 |
| 264 | Ga0207692_10033257 | 3300025898 | Bacteria | 2486 |
| 265 | Ga0207692_10243863 | 3300025898 | Bacteria | 1074 |
| 266 | Ga0207680_10001088 | 3300025903 | Bacteria | 12825 |
| 267 | Ga0207680_10249067 | 3300025903 | Bacteria | 1227 |
| 268 | Ga0207699_10092916 | 3300025906 | Bacteria | 1897 |
| 269 | Ga0207699_10106750 | 3300025906 | Unclassified | 1788 |
| 270 | Ga0207645_10040033 | 3300025907 | Bacteria | 3002 |
| 271 | Ga0207705_10008017 | 3300025909 | Bacteria | 7744 |
| 272 | Ga0207705_10254910 | 3300025909 | Bacteria | 1338 |
| 273 | Ga0207654_10120735 | 3300025911 | Bacteria | 1645 |
| 274 | Ga0207654_10349637 | 3300025911 | Unclassified | 1017 |
| 275 | Ga0207707_10001236 | 3300025912 | Bacteria | 23977 |
| 276 | Ga0207707_10058879 | 3300025912 | Bacteria | 3343 |
| 277 | Ga0207707_10111642 | 3300025912 | Bacteria | 2390 |
| 278 | Ga0207707_10164735 | 3300025912 | Bacteria | 1937 |
| 279 | Ga0207707_10167910 | 3300025912 | Bacteria | 1917 |
| 280 | Ga0207707_10196410 | 3300025912 | Bacteria | 1760 |
| 281 | Ga0207707_10201515 | 3300025912 | Bacteria | 1735 |
| 282 | Ga0207695_10000804 | 3300025913 | Bacteria | 58597 |
| 283 | Ga0207695_10002232 | 3300025913 | Bacteria | 29076 |
| 284 | Ga0207695_10022482 | 3300025913 | Bacteria | 7156 |
| 285 | Ga0207695_10067847 | 3300025913 | Bacteria | 3657 |
| 286 | Ga0207695_10086722 | 3300025913 | Bacteria | 3156 |
| 287 | Ga0207695_10106648 | 3300025913 | Bacteria | 2788 |
| 288 | Ga0207695_10426428 | 3300025913 | Bacteria | 1210 |
| 289 | Ga0207695_10540405 | 3300025913 | Bacteria | 1047 |
| 290 | Ga0207671_10016353 | 3300025914 | Bacteria | 5768 |
| 291 | Ga0207671_10057473 | 3300025914 | Bacteria | 2883 |
| 292 | Ga0207671_10169263 | 3300025914 | Bacteria | 1696 |
| 293 | Ga0207671_10172143 | 3300025914 | Bacteria | 1682 |
| 294 | Ga0207671_10227370 | 3300025914 | Bacteria | 1463 |
| 295 | Ga0207693_10065260 | 3300025915 | Bacteria | 2851 |
| 296 | Ga0207660_10070983 | 3300025917 | Bacteria | 2533 |
| 297 | Ga0207660_10151341 | 3300025917 | Bacteria | 1783 |
| 298 | Ga0207660_10153124 | 3300025917 | Unclassified | 1773 |
| 299 | Ga0207657_10001968 | 3300025919 | Bacteria | 22178 |
| 300 | Ga0207657_10005349 | 3300025919 | Bacteria | 13448 |
| 301 | Ga0207657_10046559 | 3300025919 | Bacteria | 3798 |
| 302 | Ga0207657_10062686 | 3300025919 | Bacteria | 3182 |
| 303 | Ga0207657_10213571 | 3300025919 | Bacteria | 1548 |
| 304 | Ga0207652_10020050 | 3300025921 | Bacteria | 5506 |
| 305 | Ga0207652_10040614 | 3300025921 | Unclassified | 3951 |
| 306 | Ga0207652_10087987 | 3300025921 | Unclassified | 2724 |
| 307 | Ga0207652_10179868 | 3300025921 | Bacteria | 1900 |
| 308 | Ga0207652_10240559 | 3300025921 | Bacteria | 1632 |
| 309 | Ga0207652_10296030 | 3300025921 | Unclassified | 1460 |
| 310 | Ga0207694_10018555 | 3300025924 | Bacteria | 5257 |
| 311 | Ga0207694_10096664 | 3300025924 | Unclassified | 2336 |
| 312 | Ga0207694_10202954 | 3300025924 | Bacteria | 1613 |
| 313 | Ga0207694_10393553 | 3300025924 | Bacteria | 1152 |
| 314 | Ga0207687_10023862 | 3300025927 | Bacteria | 4081 |
| 315 | Ga0207687_10162493 | 3300025927 | Bacteria | 1715 |
| 316 | Ga0207700_10382896 | 3300025928 | Bacteria | 1230 |
| 317 | Ga0207664_10031957 | 3300025929 | Bacteria | 4031 |
| 318 | Ga0207664_10410534 | 3300025929 | Bacteria | 1205 |
| 319 | Ga0207664_10492828 | 3300025929 | Bacteria | 1097 |
| 320 | Ga0207644_10013990 | 3300025931 | Bacteria | 5363 |
| 321 | Ga0207644_10150571 | 3300025931 | Bacteria | 1800 |
| 322 | Ga0207690_10038790 | 3300025932 | Bacteria | 3103 |
| 323 | Ga0207706_10013900 | 3300025933 | Bacteria | 7301 |
| 324 | Ga0207686_10008101 | 3300025934 | Bacteria | 5667 |
| 325 | Ga0207686_10161485 | 3300025934 | Unclassified | 1571 |
| 326 | Ga0207704_10007360 | 3300025938 | Bacteria | 5195 |
| 327 | Ga0207704_10063485 | 3300025938 | Bacteria | 2302 |
| 328 | Ga0207691_10022122 | 3300025940 | Bacteria | 5999 |
| 329 | Ga0207711_10019653 | 3300025941 | Bacteria | 5623 |
| 330 | Ga0207711_10108729 | 3300025941 | Bacteria | 2463 |
| 331 | Ga0207711_10219133 | 3300025941 | Bacteria | 1740 |
| 332 | Ga0207689_10070543 | 3300025942 | Bacteria | 2870 |
| 333 | Ga0207667_10000538 | 3300025949 | Bacteria | 50064 |
| 334 | Ga0207667_10063419 | 3300025949 | Bacteria | 3861 |
| 335 | Ga0207667_10139705 | 3300025949 | Bacteria | 2494 |
| 336 | Ga0207667_10191759 | 3300025949 | Bacteria | 2097 |
| 337 | Ga0207667_10229611 | 3300025949 | Unclassified | 1901 |
| 338 | Ga0207667_10255582 | 3300025949 | Bacteria | 1792 |
| 339 | Ga0207667_10320680 | 3300025949 | Bacteria | 1582 |
| 340 | Ga0207712_10071685 | 3300025961 | Bacteria | 2492 |
| 341 | Ga0207668_10160938 | 3300025972 | Unclassified | 1749 |
| 342 | Ga0207668_10286702 | 3300025972 | Bacteria | 1353 |
| 343 | Ga0207640_10222110 | 3300025981 | Bacteria | 1447 |
| 344 | Ga0207640_10293528 | 3300025981 | Unclassified | 1283 |
| 345 | Ga0207658_10011414 | 3300025986 | Bacteria | 6047 |
| 346 | Ga0207703_10008427 | 3300026035 | Bacteria | 8149 |
| 347 | Ga0207703_10132207 | 3300026035 | Bacteria | 2156 |
| 348 | Ga0207639_10007682 | 3300026041 | Bacteria | 7361 |
| 349 | Ga0207639_10059066 | 3300026041 | Bacteria | 2953 |
| 350 | Ga0207678_10011788 | 3300026067 | Bacteria | 7676 |
| 351 | Ga0207678_10070265 | 3300026067 | Bacteria | 3002 |
| 352 | Ga0207678_10160247 | 3300026067 | Bacteria | 1922 |
| 353 | Ga0207678_10163267 | 3300026067 | Unclassified | 1902 |
| 354 | Ga0207678_10271609 | 3300026067 | Unclassified | 1454 |
| 355 | Ga0207708_10017410 | 3300026075 | Bacteria | 5409 |
| 356 | Ga0207702_10009509 | 3300026078 | Bacteria | 8163 |
| 357 | Ga0207702_10015971 | 3300026078 | Bacteria | 6216 |
| 358 | Ga0207702_10070862 | 3300026078 | Bacteria | 2999 |
| 359 | Ga0207702_10260818 | 3300026078 | Bacteria | 1632 |
| 360 | Ga0207702_10691157 | 3300026078 | Unclassified | 1005 |
| 361 | Ga0207641_10091642 | 3300026088 | Bacteria | 2660 |
| 362 | Ga0207641_10120951 | 3300026088 | Bacteria | 2336 |
| 363 | Ga0207641_10442840 | 3300026088 | Unclassified | 1254 |
| 364 | Ga0207676_10050087 | 3300026095 | Bacteria | 3254 |
| 365 | Ga0207674_10018058 | 3300026116 | Bacteria | 7683 |
| 366 | Ga0207674_10067730 | 3300026116 | Unclassified | 3593 |
| 367 | Ga0207674_10302869 | 3300026116 | Unclassified | 1547 |
| 368 | Ga0207675_100032063 | 3300026118 | Bacteria | 4894 |
| 369 | Ga0207675_100211392 | 3300026118 | Bacteria | 1866 |
| 370 | Ga0207683_10011081 | 3300026121 | Bacteria | 7683 |
| 371 | Ga0207683_10288002 | 3300026121 | Bacteria | 1502 |
| 372 | Ga0207698_10008297 | 3300026142 | Bacteria | 6560 |
| 373 | Ga0207698_10030565 | 3300026142 | Unclassified | 3875 |
| 374 | Ga0207698_10268189 | 3300026142 | Bacteria | 1572 |
| 375 | Ga0207698_10748353 | 3300026142 | Unclassified | 976 |
| 376 | Ga0207428_10130154 | 3300027907 | Unclassified | 1926 |
| 377 | Ga0268266_10001822 | 3300028379 | Bacteria | 24095 |
| 378 | Ga0268266_10003502 | 3300028379 | Bacteria | 15605 |
| 379 | Ga0268266_10010748 | 3300028379 | Bacteria | 7975 |
| 380 | Ga0268266_10069552 | 3300028379 | Bacteria | 3050 |
| 381 | Ga0268266_10164593 | 3300028379 | Unclassified | 2008 |
| 382 | Ga0268266_10215581 | 3300028379 | Bacteria | 1762 |
| 383 | Ga0268264_10009485 | 3300028381 | Bacteria | 8060 |
| 384 | Ga0268264_10074739 | 3300028381 | Bacteria | 2879 |
| 385 | Ga0268264_10263615 | 3300028381 | Bacteria | 1606 |
| 386 | Ga0265334_10092040 | 3300028573 | Bacteria | 1105 |
| 387 | Ga0265338_10021009 | 3300028800 | Bacteria | 6829 |
| 388 | Ga0265338_10048667 | 3300028800 | Bacteria | 3854 |
| 389 | Ga0265338_10090924 | 3300028800 | Bacteria | 2524 |
| 390 | Ga0265338_10194351 | 3300028800 | Unclassified | 1535 |
| 391 | Ga0265338_10211551 | 3300028800 | Bacteria | 1455 |
| 392 | Ga0265760_10009076 | 3300031090 | Bacteria | 2841 |
| 393 | Ga0265330_10001094 | 3300031235 | Bacteria | 16318 |
| 394 | Ga0265325_10071797 | 3300031241 | Unclassified | 1736 |
| 395 | Ga0265339_10005264 | 3300031249 | Bacteria | 8631 |
| 396 | Ga0265339_10049523 | 3300031249 | Bacteria | 2300 |
| 397 | Ga0265339_10110992 | 3300031249 | Bacteria | 1419 |
| 398 | Ga0265316_10014579 | 3300031344 | Bacteria | 6911 |
| 399 | Ga0265316_10017922 | 3300031344 | Bacteria | 6104 |
| 400 | Ga0265313_10017403 | 3300031595 | Unclassified | 4087 |
| 401 | Ga0265314_10000261 | 3300031711 | Bacteria | 77506 |
| 402 | Ga0265314_10002439 | 3300031711 | Bacteria | 19051 |
| 403 | Ga0265342_10004473 | 3300031712 | Bacteria | 10988 |
| 404 | Ga0307412_10175260 | 3300031911 | Bacteria | 1607 |
| 405 | Ga0307416_100584046 | 3300032002 | Bacteria | 1195 |
| 406 | Ga0307510_10017003 | 3300033180 | Bacteria | 8581 |
| 407 | Ga0307510_10156041 | 3300033180 | Unclassified | 1889 |
| 408 | Ga0373943_0232299 | 3300035170 | Bacteria | 1031 |
| 409 | Ga0373935_0331489 | 3300035692 | Unclassified | 1082 |
| 410 | Ga0373927_0002154 | 3300035695 | Bacteria | 14469 |
| 411 | Ga0373927_0002368 | 3300035695 | Bacteria | 13732 |
| 412 | Ga0373927_0009413 | 3300035695 | Bacteria | 6549 |
| 413 | Ga0373933_0200042 | 3300035724 | Bacteria | 1278 |
| 414 | Ga0373947_0007434 | 3300035725 | Bacteria | 6344 |
| 415 | Ga0373937_0012045 | 3300036401 | Bacteria | 7589 |
| 416 | Ga0373925_0027370 | 3300037068 | Unclassified | 4173 |
| 417 | Ga0373925_0049320 | 3300037068 | Unclassified | 3138 |
| 418 | Ga0395900_0070767 | 3300037418 | Bacteria | 3586 |
| 419 | Ga0395900_0382929 | 3300037418 | Unclassified | 1374 |
| 420 | Ga0395900_0409391 | 3300037418 | Bacteria | 1319 |
| 421 | Ga0395898_0066377 | 3300037466 | Bacteria | 3496 |
| 422 | Ga0436364_0032202 | 3300037853 | Unclassified | 1116 |
| 423 | Ga0436364_0068230 | 3300037853 | Unclassified | 1038 |
| 424 | Ga0436364_0080170 | 3300037853 | Bacteria | 70161 |
| 425 | Ga0436364_0260875 | 3300037853 | Bacteria | 1837 |
| 426 | Ga0436364_0278774 | 3300037853 | Bacteria | 400541 |
| 427 | Ga0436364_0310874 | 3300037853 | Bacteria | 18169 |
| 428 | Ga0436364_0376502 | 3300037853 | Bacteria | 5619 |
| 429 | Ga0436364_0630365 | 3300037853 | Bacteria | 4977 |
| 430 | Ga0436364_0718428 | 3300037853 | Bacteria | 8650 |
| 431 | Ga0436364_0733005 | 3300037853 | Unclassified | 1370 |
| 432 | Ga0436364_0753292 | 3300037853 | Bacteria | 13640 |
| 433 | Ga0436364_1150628 | 3300037853 | Bacteria | 5754 |
| 434 | Ga0436364_1419803 | 3300037853 | Bacteria | 9396 |
| 435 | Ga0436364_1470570 | 3300037853 | Bacteria | 1287 |
| 436 | Ga0436364_1551588 | 3300037853 | Unclassified | 1615 |
| 437 | Ga0436365_0463178 | 3300039437 | Bacteria | 1151 |
| 438 | Ga0436365_0531012 | 3300039437 | Bacteria | 5689 |
| 439 | Ga0436365_0955181 | 3300039437 | Unclassified | 3498 |
| 440 | Ga0436365_1005832 | 3300039437 | Bacteria | 8439 |
| 441 | Ga0436365_1330341 | 3300039437 | Bacteria | 32804 |
| 442 | Ga0436365_1374761 | 3300039437 | Unclassified | 1541 |
| 443 | Ga0436365_1475398 | 3300039437 | Bacteria | 1721 |
| 444 | Ga0436365_1701082 | 3300039437 | Bacteria | 6957 |
| 445 | Ga0436360_0246149 | 3300039438 | Unclassified | 3352 |
| 446 | Ga0436361_0468997 | 3300039447 | Bacteria | 3886 |
| 447 | Ga0436361_0567168 | 3300039447 | Bacteria | 164343 |
| 448 | Ga0436361_0671658 | 3300039447 | Bacteria | 3037 |
| 449 | Ga0436363_1408881 | 3300039450 | Bacteria | 10747 |
| 450 | Ga0436363_1631220 | 3300039450 | Bacteria | 5551 |
| 451 | Ga0436362_0480869 | 3300039453 | Bacteria | 1250 |
| 452 | Ga0436362_0582991 | 3300039453 | Bacteria | 2379 |
| 453 | Ga0436362_0693803 | 3300039453 | Bacteria | 6331 |
| 454 | Ga0436362_1282706 | 3300039453 | Bacteria | 4860 |
| 455 | Ga0466969_0168779 | 3300044656 | Unclassified | 1004 |
| 456 | Ga0466966_0035991 | 3300044684 | Bacteria | 3198 |
| 457 | Ga0466966_0157362 | 3300044684 | Bacteria | 1384 |
| 458 | Ga0466963_0108503 | 3300044694 | Unclassified | 1904 |
| 459 | Ga0466963_0144498 | 3300044694 | Bacteria | 1650 |
| 460 | Ga0466957_0190714 | 3300044842 | Bacteria | 1343 |
| 461 | Ga0466959_0358181 | 3300045049 | Unclassified | 994 |
| 462 | Ga0466958_0156472 | 3300045836 | Bacteria | 1439 |
| 463 | Ga0466958_0285692 | 3300045836 | Bacteria | 1058 |
| 464 | Ga0495580_0052559 | 3300046472 | Unclassified | 2877 |
| 465 | Ga0495580_0120351 | 3300046472 | Unclassified | 1823 |
| 466 | Ga0495582_0005880 | 3300046473 | Bacteria | 6836 |
| 467 | Ga0495582_0092786 | 3300046473 | Bacteria | 1685 |
| 468 | Ga0495662_0013059 | 3300046476 | Bacteria | 4046 |
| 469 | Ga0495664_0013075 | 3300046477 | Bacteria | 4706 |
| 470 | Ga0495594_0000369 | 3300046499 | Bacteria | 22598 |
| 471 | Ga0495594_0004624 | 3300046499 | Bacteria | 7090 |
| 472 | Ga0495594_0180376 | 3300046499 | Bacteria | 1202 |
| 473 | Ga0495583_0021321 | 3300046506 | Bacteria | 3337 |
| 474 | Ga0495583_0049871 | 3300046506 | Unclassified | 1915 |
| 475 | Ga0495606_0026970 | 3300046507 | Bacteria | 4081 |
| 476 | Ga0495628_0203099 | 3300046516 | Bacteria | 1492 |
| 477 | Ga0495630_0152282 | 3300046517 | Bacteria | 1760 |
| 478 | Ga0495631_0173971 | 3300046518 | Unclassified | 923 |
| 479 | Ga0495644_0000023 | 3300046523 | Bacteria | 79095 |
| 480 | Ga0495648_0113351 | 3300046524 | Unclassified | 1470 |
| 481 | Ga0495666_0006772 | 3300046526 | Bacteria | 5758 |
| 482 | Ga0495642_0010152 | 3300046528 | Bacteria | 3607 |
| 483 | Ga0495652_0006361 | 3300046529 | Bacteria | 10998 |
| 484 | Ga0495665_0101134 | 3300046531 | Unclassified | 1513 |
| 485 | Ga0495665_0245559 | 3300046531 | Bacteria | 922 |
| 486 | Ga0495665_0350252 | 3300046531 | Bacteria | 752 |
| 487 | Ga0495640_0052530 | 3300046533 | Bacteria | 2798 |
| 488 | Ga0495586_0032907 | 3300046535 | Bacteria | 2781 |
| 489 | Ga0495609_0005042 | 3300046538 | Bacteria | 7060 |
| 490 | Ga0495667_0007248 | 3300046559 | Bacteria | 7526 |
| 491 | Ga0495668_0167913 | 3300046616 | Unclassified | 1202 |
| 492 | Ga0495634_0046425 | 3300046642 | Unclassified | 2931 |
| 493 | Ga0495625_0000796 | 3300046660 | Bacteria | 43709 |
| 494 | Ga0495625_0123758 | 3300046660 | Bacteria | 1757 |
| 495 | Ga0495635_0015069 | 3300046663 | Bacteria | 5407 |
| 496 | Ga0495659_0022869 | 3300046664 | Bacteria | 2119 |
| 497 | Ga0495657_0116627 | 3300046675 | Bacteria | 1686 |
| 498 | Ga0495646_0188731 | 3300046680 | Bacteria | 1127 |
| 499 | Ga0495669_0006062 | 3300046684 | Bacteria | 5047 |
| 500 | Ga0495613_0023005 | 3300046689 | Bacteria | 4644 |
| 501 | Ga0495613_0040073 | 3300046689 | Bacteria | 3471 |
| 502 | Ga0495624_0156772 | 3300046690 | Bacteria | 1391 |
| 503 | Ga0495649_0019338 | 3300046694 | Bacteria | 3828 |
| 504 | Ga0495649_0100446 | 3300046694 | Bacteria | 1538 |
| 505 | Ga0495649_0134880 | 3300046694 | Unclassified | 1302 |
| 506 | Ga0495600_0018704 | 3300046809 | Bacteria | 4418 |
| 507 | Ga0495581_0003369 | 3300047315 | Bacteria | 9179 |
| 508 | Ga0495581_0269157 | 3300047315 | Bacteria | 996 |
| 509 | Ga0495581_0328623 | 3300047315 | Unclassified | 893 |
| 510 | Ga0495604_0098545 | 3300047317 | Unclassified | 2153 |
| 511 | Ga0495604_0270831 | 3300047317 | Bacteria | 1150 |
| 512 | Ga0495674_0296787 | 3300047319 | Bacteria | 1320 |
| 513 | Ga0495674_0567882 | 3300047319 | Bacteria | 901 |
| 514 | Ga0495672_0001628 | 3300047320 | Bacteria | 21845 |
| 515 | Ga0495672_0169286 | 3300047320 | Unclassified | 1116 |
| 516 | Ga0495676_0035083 | 3300047321 | Bacteria | 4198 |
| 517 | Ga0495675_0003532 | 3300047444 | Bacteria | 9421 |
| 518 | Ga0495677_0003312 | 3300047445 | Bacteria | 6270 |
| 519 | Ga0495673_0090525 | 3300047469 | Bacteria | 1251 |
| 520 | Ga0495684_0266274 | 3300047471 | Unclassified | 1241 |
| 521 | Ga0495686_0000030 | 3300047472 | Bacteria | 365121 |
| 522 | Ga0495614_0005209 | 3300048089 | Bacteria | 5864 |
| 523 | Ga0495614_0089596 | 3300048089 | Unclassified | 1338 |
| 524 | Ga0495614_0103287 | 3300048089 | Bacteria | 1247 |
| 525 | Ga0496104_0000673 | 3300048907 | Bacteria | 29343 |
| 526 | Ga0496112_0037929 | 3300048915 | Bacteria | 4706 |
| 527 | Ga0496115_0013551 | 3300048918 | Bacteria | 6168 |
| 528 | Ga0496115_0237880 | 3300048918 | Bacteria | 1501 |
| 529 | Ga0496126_0000024 | 3300048929 | Bacteria | 462877 |
| 530 | Ga0496126_0000820 | 3300048929 | Bacteria | 55350 |
| 531 | Ga0496126_0078426 | 3300048929 | Unclassified | 2927 |
| 532 | Ga0496126_0424626 | 3300048929 | Bacteria | 1074 |
| 533 | Ga0501032_0007424 | 3300049569 | Bacteria | 8009 |
| 534 | Ga0501032_0011478 | 3300049569 | Bacteria | 6364 |
| 535 | Ga0501032_0177519 | 3300049569 | Bacteria | 1395 |
| 536 | Ga0501033_0000876 | 3300049570 | Bacteria | 27523 |
| 537 | Ga0501033_0144835 | 3300049570 | Unclassified | 1716 |
| 538 | Ga0501034_0005794 | 3300049571 | Bacteria | 13439 |
| 539 | Ga0501034_0247055 | 3300049571 | Bacteria | 1729 |
| 540 | Ga0501036_0003020 | 3300049572 | Bacteria | 13394 |
| 541 | Ga0501036_0011178 | 3300049572 | Bacteria | 7428 |
| 542 | Ga0501036_0121499 | 3300049572 | Bacteria | 2206 |
| 543 | Ga0501036_0237575 | 3300049572 | Bacteria | 1529 |
| 544 | Ga0501037_0183518 | 3300049573 | Bacteria | 1484 |
| 545 | Ga0501038_0003247 | 3300049574 | Bacteria | 15159 |
| 546 | Ga0501038_0068831 | 3300049574 | Unclassified | 3008 |
| 547 | Ga0501038_0310120 | 3300049574 | Unclassified | 1237 |
| 548 | Ga0501039_0001248 | 3300049575 | Bacteria | 18575 |
| 549 | Ga0501039_0237840 | 3300049575 | Bacteria | 1432 |
| 550 | Ga0501040_0258461 | 3300049576 | Bacteria | 1243 |
| 551 | Ga0501042_0107469 | 3300049578 | Unclassified | 2009 |
| 552 | Ga0501043_0010410 | 3300049579 | Bacteria | 7287 |
| 553 | Ga0501043_0015859 | 3300049579 | Bacteria | 5906 |
| 554 | Ga0501043_0051263 | 3300049579 | Bacteria | 3242 |
| 555 | Ga0501046_0000265 | 3300049580 | Bacteria | 53355 |
| 556 | Ga0501046_0001882 | 3300049580 | Bacteria | 19958 |
| 557 | Ga0501046_0018775 | 3300049580 | Bacteria | 5746 |
| 558 | Ga0501047_0003679 | 3300049581 | Bacteria | 14454 |
| 559 | Ga0501047_0006951 | 3300049581 | Bacteria | 10631 |
| 560 | Ga0501047_0014170 | 3300049581 | Bacteria | 7576 |
| 561 | Ga0501047_0073674 | 3300049581 | Unclassified | 3288 |
| 562 | Ga0501048_0022987 | 3300049582 | Unclassified | 4557 |
| 563 | Ga0501048_0208340 | 3300049582 | Bacteria | 1387 |
| 564 | Ga0501068_0028802 | 3300049584 | Bacteria | 3286 |
| 565 | Ga0501070_0033458 | 3300049586 | Unclassified | 4301 |
| 566 | Ga0501070_0039615 | 3300049586 | Unclassified | 3930 |
| 567 | Ga0501070_0055212 | 3300049586 | Bacteria | 3292 |
| 568 | Ga0501072_0040654 | 3300049588 | Bacteria | 3652 |
| 569 | Ga0501072_0099967 | 3300049588 | Unclassified | 2305 |
| 570 | Ga0501073_0005637 | 3300049589 | Bacteria | 9369 |
| 571 | Ga0501073_0067085 | 3300049589 | Bacteria | 2501 |
| 572 | Ga0501073_0264137 | 3300049589 | Unclassified | 1188 |
| 573 | Ga0501074_0100470 | 3300049590 | Unclassified | 2070 |
| 574 | Ga0501075_0042987 | 3300049591 | Bacteria | 3389 |
| 575 | Ga0501075_0144984 | 3300049591 | Bacteria | 1810 |
| 576 | Ga0501076_0225501 | 3300049592 | Bacteria | 1531 |
| 577 | Ga0501077_0027235 | 3300049593 | Unclassified | 3629 |
| 578 | Ga0501079_0000098 | 3300049741 | Bacteria | 43658 |
| 579 | Ga0501079_0551791 | 3300049741 | Unclassified | 906 |
| 580 | Ga0501080_0001904 | 3300049742 | Bacteria | 17982 |
| 581 | Ga0501080_0033703 | 3300049742 | Bacteria | 4781 |
| 582 | Ga0501035_0002898 | 3300049822 | Bacteria | 16521 |
| 583 | Ga0501035_0031116 | 3300049822 | Unclassified | 4860 |
| 584 | Ga0501035_0051920 | 3300049822 | Bacteria | 3669 |
| 585 | Ga0501035_0055431 | 3300049822 | Bacteria | 3539 |
| 586 | Ga0501035_0072637 | 3300049822 | Bacteria | 3045 |
| 587 | Ga0501035_0155099 | 3300049822 | Unclassified | 1985 |
| 588 | Ga0501044_0002699 | 3300049823 | Bacteria | 20171 |
| 589 | Ga0501044_0003102 | 3300049823 | Bacteria | 18821 |
| 590 | Ga0501044_0003333 | 3300049823 | Bacteria | 18107 |
| 591 | Ga0501044_0005795 | 3300049823 | Bacteria | 13681 |
| 592 | Ga0501044_0006355 | 3300049823 | Bacteria | 13062 |
| 593 | Ga0501044_0145800 | 3300049823 | Bacteria | 2353 |
| 594 | Ga0501044_0181597 | 3300049823 | Unclassified | 2070 |
| 595 | Ga0501044_0348297 | 3300049823 | Unclassified | 1401 |
| 596 | nmdc:mga08y16_331743_c1 | 3300050511 | Unclassified | 1565 |
| 597 | nmdc:mga0rr50_408819_c1 | 3300050513 | Bacteria | 1147 |
| 598 | nmdc:mga0rr50_529404_c1 | 3300050513 | Unclassified | 1003 |
| 599 | nmdc:mga08x19_2741_c1 | 3300050514 | Bacteria | 10641 |
| 600 | nmdc:mga08x19_8813_c1 | 3300050514 | Bacteria | 6019 |
| 601 | Ga0500595_000025 | 3300053119 | Bacteria | 142073 |
| 602 | Ga0500595_005243 | 3300053119 | Bacteria | 5681 |
| 603 | Ga0501084_0002112 | 3300054114 | Bacteria | 15883 |
| 604 | Ga0501082_0162237 | 3300060353 | Unclassified | 1942 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046531 | Ga0495665_0245559 | Ga0495665_0245559_204_878 | 217 |
| 2 | 3300046531 | Ga0495665_0350252 | Ga0495665_0350252_37_711 | 217 |
| 3 | 3300047315 | Ga0495581_0328623 | Ga0495581_0328623_47_721 | 217 |
| 4 | 3300049581 | Ga0501047_0073674 | Ga0501047_0073674_1443_2300 | 238 |
| 5 | 3300049586 | Ga0501070_0039615 | Ga0501070_0039615_357_1214 | 238 |
| 6 | 3300049822 | Ga0501035_0155099 | Ga0501035_0155099_668_1525 | 238 |
| 7 | 3300049823 | Ga0501044_0003102 | Ga0501044_0003102_16131_16988 | 238 |
| 8 | 3300049823 | Ga0501044_0003333 | Ga0501044_0003333_4416_5273 | 238 |
| 9 | 3300006871 | Ga0075434_100437062 | Ga0075434_1004370622 | 241 |
| 10 | 3300013105 | Ga0157369_10503294 | Ga0157369_105032942 | 246 |
| 11 | 3300027907 | Ga0207428_10130154 | Ga0207428_101301542 | 248 |
| 12 | 3300021358 | Ga0213873_10000753 | Ga0213873_100007537 | 252 |
| 13 | 3300021384 | Ga0213876_10015893 | Ga0213876_100158933 | 252 |
| 14 | 3300039437 | Ga0436365_1701082 | Ga0436365_1701082_1765_2658 | 252 |
| 15 | 3300039453 | Ga0436362_0693803 | Ga0436362_0693803_4268_5161 | 252 |
| 16 | 3300009093 | Ga0105240_10002300 | Ga0105240_1000230011 | 253 |
| 17 | 3300009545 | Ga0105237_10007159 | Ga0105237_100071595 | 253 |
| 18 | 3300049741 | Ga0501079_0551791 | Ga0501079_0551791_78_866 | 253 |
| 19 | 3300005455 | Ga0070663_100291367 | Ga0070663_1002913672 | 254 |
| 20 | 3300009093 | Ga0105240_10001940 | Ga0105240_100019405 | 254 |
| 21 | 3300009545 | Ga0105237_10005232 | Ga0105237_100052325 | 254 |
| 22 | 3300022467 | Ga0224712_10012106 | Ga0224712_100121062 | 254 |
| 23 | 3300025913 | Ga0207695_10106648 | Ga0207695_101066483 | 254 |
| 24 | 3300025921 | Ga0207652_10296030 | Ga0207652_102960302 | 254 |
| 25 | 3300026067 | Ga0207678_10271609 | Ga0207678_102716092 | 254 |
| 26 | 3300026116 | Ga0207674_10302869 | Ga0207674_103028692 | 254 |
| 27 | 3300037418 | Ga0395900_0070767 | Ga0395900_0070767_1700_2515 | 254 |
| 28 | 3300049571 | Ga0501034_0247055 | Ga0501034_0247055_403_1317 | 254 |
| 29 | 3300049572 | Ga0501036_0121499 | Ga0501036_0121499_794_1708 | 254 |
| 30 | 3300049574 | Ga0501038_0310120 | Ga0501038_0310120_223_1137 | 254 |
| 31 | 3300049579 | Ga0501043_0015859 | Ga0501043_0015859_3124_4038 | 254 |
| 32 | 3300049581 | Ga0501047_0006951 | Ga0501047_0006951_7480_8394 | 254 |
| 33 | 3300049586 | Ga0501070_0055212 | Ga0501070_0055212_1901_2815 | 254 |
| 34 | 3300049589 | Ga0501073_0264137 | Ga0501073_0264137_242_1156 | 254 |
| 35 | 3300049822 | Ga0501035_0051920 | Ga0501035_0051920_623_1537 | 254 |
| 36 | 3300049823 | Ga0501044_0348297 | Ga0501044_0348297_317_1231 | 254 |
| 37 | 3300009545 | Ga0105237_10024235 | Ga0105237_100242352 | 255 |
| 38 | 3300005434 | Ga0070709_10056950 | Ga0070709_100569502 | 256 |
| 39 | 3300005435 | Ga0070714_100000338 | Ga0070714_10000033820 | 256 |
| 40 | 3300005437 | Ga0070710_10280974 | Ga0070710_102809741 | 256 |
| 41 | 3300005937 | Ga0081455_10021250 | Ga0081455_100212504 | 256 |
| 42 | 3300006028 | Ga0070717_10189470 | Ga0070717_101894702 | 256 |
| 43 | 3300025898 | Ga0207692_10243863 | Ga0207692_102438631 | 256 |
| 44 | 3300025906 | Ga0207699_10092916 | Ga0207699_100929162 | 256 |
| 45 | 3300025915 | Ga0207693_10065260 | Ga0207693_100652603 | 256 |
| 46 | 3300025928 | Ga0207700_10382896 | Ga0207700_103828962 | 256 |
| 47 | 3300025929 | Ga0207664_10031957 | Ga0207664_100319573 | 256 |
| 48 | 3300026067 | Ga0207678_10160247 | Ga0207678_101602471 | 256 |
| 49 | 3300035170 | Ga0373943_0232299 | Ga0373943_0232299_112_900 | 256 |
| 50 | 3300035724 | Ga0373933_0200042 | Ga0373933_0200042_419_1207 | 256 |
| 51 | 3300036401 | Ga0373937_0012045 | Ga0373937_0012045_3832_4620 | 256 |
| 52 | 3300037418 | Ga0395900_0409391 | Ga0395900_0409391_286_1206 | 256 |
| 53 | 3300037853 | Ga0436364_1470570 | Ga0436364_1470570_11_874 | 256 |
| 54 | 3300049580 | Ga0501046_0018775 | Ga0501046_0018775_1770_2690 | 256 |
| 55 | 3300049742 | Ga0501080_0033703 | Ga0501080_0033703_535_1455 | 256 |
| 56 | 3300005548 | Ga0070665_100060487 | Ga0070665_1000604872 | 257 |
| 57 | 3300009551 | Ga0105238_10133131 | Ga0105238_101331312 | 257 |
| 58 | 3300010375 | Ga0105239_10242156 | Ga0105239_102421561 | 257 |
| 59 | 3300049569 | Ga0501032_0007424 | Ga0501032_0007424_6020_6832 | 257 |
| 60 | 3300049570 | Ga0501033_0144835 | Ga0501033_0144835_404_1216 | 257 |
| 61 | 3300049571 | Ga0501034_0005794 | Ga0501034_0005794_3131_3943 | 257 |
| 62 | 3300049572 | Ga0501036_0003020 | Ga0501036_0003020_1254_2066 | 257 |
| 63 | 3300049574 | Ga0501038_0068831 | Ga0501038_0068831_404_1216 | 257 |
| 64 | 3300049575 | Ga0501039_0001248 | Ga0501039_0001248_2343_3155 | 257 |
| 65 | 3300049578 | Ga0501042_0107469 | Ga0501042_0107469_581_1393 | 257 |
| 66 | 3300049579 | Ga0501043_0051263 | Ga0501043_0051263_2325_3137 | 257 |
| 67 | 3300049580 | Ga0501046_0001882 | Ga0501046_0001882_7393_8205 | 257 |
| 68 | 3300049582 | Ga0501048_0022987 | Ga0501048_0022987_2135_2947 | 257 |
| 69 | 3300049584 | Ga0501068_0028802 | Ga0501068_0028802_2347_3159 | 257 |
| 70 | 3300049586 | Ga0501070_0033458 | Ga0501070_0033458_2413_3225 | 257 |
| 71 | 3300049588 | Ga0501072_0099967 | Ga0501072_0099967_1090_1902 | 257 |
| 72 | 3300049589 | Ga0501073_0005637 | Ga0501073_0005637_5879_6691 | 257 |
| 73 | 3300049590 | Ga0501074_0100470 | Ga0501074_0100470_855_1667 | 257 |
| 74 | 3300049592 | Ga0501076_0225501 | Ga0501076_0225501_138_950 | 257 |
| 75 | 3300049593 | Ga0501077_0027235 | Ga0501077_0027235_1720_2532 | 257 |
| 76 | 3300049741 | Ga0501079_0000098 | Ga0501079_0000098_12804_13616 | 257 |
| 77 | 3300049742 | Ga0501080_0001904 | Ga0501080_0001904_7876_8688 | 257 |
| 78 | 3300049822 | Ga0501035_0031116 | Ga0501035_0031116_918_1730 | 257 |
| 79 | 3300049823 | Ga0501044_0181597 | Ga0501044_0181597_404_1216 | 257 |
| 80 | 3300054114 | Ga0501084_0002112 | Ga0501084_0002112_8003_8815 | 257 |
| 81 | 3300060353 | Ga0501082_0162237 | Ga0501082_0162237_727_1539 | 257 |
| 82 | 3300006028 | Ga0070717_10005887 | Ga0070717_100058875 | 258 |
| 83 | 3300007265 | Ga0099794_10261954 | Ga0099794_102619541 | 258 |
| 84 | 3300005437 | Ga0070710_10114669 | Ga0070710_101146692 | 259 |
| 85 | 3300035692 | Ga0373935_0331489 | Ga0373935_0331489_44_850 | 259 |
| 86 | 3300035725 | Ga0373947_0007434 | Ga0373947_0007434_1476_2282 | 259 |
| 87 | 3300037068 | Ga0373925_0049320 | Ga0373925_0049320_340_1146 | 259 |
| 88 | 3300049822 | Ga0501035_0072637 | Ga0501035_0072637_88_873 | 259 |
| 89 | 3300005339 | Ga0070660_100015575 | Ga0070660_1000155753 | 260 |
| 90 | 3300005366 | Ga0070659_100023438 | Ga0070659_1000234384 | 260 |
| 91 | 3300005563 | Ga0068855_100078424 | Ga0068855_1000784244 | 260 |
| 92 | 3300005563 | Ga0068855_100215309 | Ga0068855_1002153093 | 260 |
| 93 | 3300005564 | Ga0070664_100122596 | Ga0070664_1001225964 | 260 |
| 94 | 3300005614 | Ga0068856_100019095 | Ga0068856_1000190954 | 260 |
| 95 | 3300005614 | Ga0068856_100320192 | Ga0068856_1003201923 | 260 |
| 96 | 3300010375 | Ga0105239_10704963 | Ga0105239_107049631 | 260 |
| 97 | 3300013100 | Ga0157373_10251314 | Ga0157373_102513142 | 260 |
| 98 | 3300013105 | Ga0157369_10003819 | Ga0157369_100038197 | 260 |
| 99 | 3300013105 | Ga0157369_10025285 | Ga0157369_100252855 | 260 |
| 100 | 3300013296 | Ga0157374_10007242 | Ga0157374_100072425 | 260 |
| 101 | 3300013307 | Ga0157372_10025965 | Ga0157372_100259651 | 260 |
| 102 | 3300013307 | Ga0157372_10137323 | Ga0157372_101373234 | 260 |
| 103 | 3300025919 | Ga0207657_10062686 | Ga0207657_100626862 | 260 |
| 104 | 3300025949 | Ga0207667_10063419 | Ga0207667_100634192 | 260 |
| 105 | 3300025949 | Ga0207667_10191759 | Ga0207667_101917593 | 260 |
| 106 | 3300026067 | Ga0207678_10011788 | Ga0207678_100117882 | 260 |
| 107 | 3300026078 | Ga0207702_10009509 | Ga0207702_100095094 | 260 |
| 108 | 3300026078 | Ga0207702_10260818 | Ga0207702_102608182 | 260 |
| 109 | 3300048918 | Ga0496115_0013551 | Ga0496115_0013551_2009_2863 | 260 |
| 110 | 3300005435 | Ga0070714_100444930 | Ga0070714_1004449302 | 261 |
| 111 | 3300021384 | Ga0213876_10035428 | Ga0213876_100354282 | 261 |
| 112 | 3300021388 | Ga0213875_10061676 | Ga0213875_100616761 | 261 |
| 113 | 3300037853 | Ga0436364_0260875 | Ga0436364_0260875_341_1222 | 261 |
| 114 | 3300037853 | Ga0436364_0733005 | Ga0436364_0733005_183_1061 | 261 |
| 115 | 3300037853 | Ga0436364_0753292 | Ga0436364_0753292_9035_10006 | 261 |
| 116 | 3300039437 | Ga0436365_0531012 | Ga0436365_0531012_3289_4167 | 261 |
| 117 | 3300039450 | Ga0436363_1631220 | Ga0436363_1631220_3948_4826 | 261 |
| 118 | 3300039453 | Ga0436362_0480869 | Ga0436362_0480869_198_1079 | 261 |
| 119 | 3300039453 | Ga0436362_0582991 | Ga0436362_0582991_215_1093 | 261 |
| 120 | 3300044684 | Ga0466966_0035991 | Ga0466966_0035991_196_1062 | 261 |
| 121 | 3300044694 | Ga0466963_0108503 | Ga0466963_0108503_516_1394 | 261 |
| 122 | 3300045836 | Ga0466958_0285692 | Ga0466958_0285692_20_973 | 261 |
| 123 | 3300005334 | Ga0068869_100060918 | Ga0068869_1000609182 | 262 |
| 124 | 3300005336 | Ga0070680_100465250 | Ga0070680_1004652501 | 262 |
| 125 | 3300005345 | Ga0070692_10053668 | Ga0070692_100536682 | 262 |
| 126 | 3300005406 | Ga0070703_10076787 | Ga0070703_100767872 | 262 |
| 127 | 3300005438 | Ga0070701_10000981 | Ga0070701_100009812 | 262 |
| 128 | 3300005546 | Ga0070696_100359340 | Ga0070696_1003593401 | 262 |
| 129 | 3300005549 | Ga0070704_100074410 | Ga0070704_1000744102 | 262 |
| 130 | 3300005617 | Ga0068859_100041054 | Ga0068859_1000410542 | 262 |
| 131 | 3300006931 | Ga0097620_100041054 | Ga0097620_1000410543 | 262 |
| 132 | 3300009553 | Ga0105249_10202080 | Ga0105249_102020802 | 262 |
| 133 | 3300014326 | Ga0157380_10003481 | Ga0157380_100034812 | 262 |
| 134 | 3300025917 | Ga0207660_10151341 | Ga0207660_101513412 | 262 |
| 135 | 3300025942 | Ga0207689_10070543 | Ga0207689_100705432 | 262 |
| 136 | 3300025961 | Ga0207712_10071685 | Ga0207712_100716852 | 262 |
| 137 | 3300026075 | Ga0207708_10017410 | Ga0207708_100174103 | 262 |
| 138 | 3300026118 | Ga0207675_100032063 | Ga0207675_1000320633 | 262 |
| 139 | 3300031911 | Ga0307412_10175260 | Ga0307412_101752601 | 262 |
| 140 | 3300032002 | Ga0307416_100584046 | Ga0307416_1005840462 | 262 |
| 141 | 3300035695 | Ga0373927_0009413 | Ga0373927_0009413_1460_2275 | 262 |
| 142 | 3300037068 | Ga0373925_0027370 | Ga0373925_0027370_1780_2595 | 262 |
| 143 | 3300039437 | Ga0436365_0955181 | Ga0436365_0955181_269_1075 | 262 |
| 144 | 3300049572 | Ga0501036_0237575 | Ga0501036_0237575_473_1315 | 262 |
| 145 | 3300049576 | Ga0501040_0258461 | Ga0501040_0258461_20_865 | 262 |
| 146 | 3300049591 | Ga0501075_0144984 | Ga0501075_0144984_817_1668 | 262 |
| 147 | 3300005467 | Ga0070706_100082040 | Ga0070706_1000820404 | 263 |
| 148 | 3300006844 | Ga0075428_100372349 | Ga0075428_1003723491 | 263 |
| 149 | 3300006846 | Ga0075430_100027318 | Ga0075430_1000273183 | 263 |
| 150 | 3300009093 | Ga0105240_10002071 | Ga0105240_100020716 | 263 |
| 151 | 3300009094 | Ga0111539_10266039 | Ga0111539_102660392 | 263 |
| 152 | 3300009545 | Ga0105237_10001515 | Ga0105237_100015154 | 263 |
| 153 | 3300013104 | Ga0157370_10071875 | Ga0157370_100718754 | 263 |
| 154 | 3300014326 | Ga0157380_10242931 | Ga0157380_102429312 | 263 |
| 155 | 3300025913 | Ga0207695_10022482 | Ga0207695_100224827 | 263 |
| 156 | 3300025914 | Ga0207671_10057473 | Ga0207671_100574733 | 263 |
| 157 | 3300026118 | Ga0207675_100211392 | Ga0207675_1002113922 | 263 |
| 158 | 3300039437 | Ga0436365_1374761 | Ga0436365_1374761_510_1325 | 263 |
| 159 | 3300039437 | Ga0436365_1475398 | Ga0436365_1475398_682_1521 | 263 |
| 160 | 3300047471 | Ga0495684_0266274 | Ga0495684_0266274_176_997 | 263 |
| 161 | 3300049582 | Ga0501048_0208340 | Ga0501048_0208340_355_1191 | 263 |
| 162 | 3300049588 | Ga0501072_0040654 | Ga0501072_0040654_1915_2751 | 263 |
| 163 | 3300049591 | Ga0501075_0042987 | Ga0501075_0042987_1075_1911 | 263 |
| 164 | 3300050511 | nmdc:mga08y16_331743_c1 | nmdc:mga08y16_331743_c1_182_1024 | 263 |
| 165 | 3300005467 | Ga0070706_100208419 | Ga0070706_1002084191 | 264 |
| 166 | 3300005536 | Ga0070697_100539159 | Ga0070697_1005391591 | 264 |
| 167 | 3300006914 | Ga0075436_100000108 | Ga0075436_10000010833 | 264 |
| 168 | 3300025912 | Ga0207707_10111642 | Ga0207707_101116423 | 264 |
| 169 | 3300035695 | Ga0373927_0002368 | Ga0373927_0002368_4590_5417 | 264 |
| 170 | 3300039437 | Ga0436365_0463178 | Ga0436365_0463178_62_889 | 264 |
| 171 | 3300046531 | Ga0495665_0101134 | Ga0495665_0101134_590_1429 | 264 |
| 172 | 3300050513 | nmdc:mga0rr50_408819_c1 | nmdc:mga0rr50_408819_c1_38_865 | 264 |
| 173 | 3300050514 | nmdc:mga08x19_2741_c1 | nmdc:mga08x19_2741_c1_3550_4377 | 264 |
| 174 | 3300039447 | Ga0436361_0468997 | Ga0436361_0468997_1205_2002 | 265 |
| 175 | 3300005355 | Ga0070671_100061186 | Ga0070671_1000611861 | 266 |
| 176 | 3300005367 | Ga0070667_100281147 | Ga0070667_1002811472 | 266 |
| 177 | 3300005456 | Ga0070678_100174669 | Ga0070678_1001746692 | 266 |
| 178 | 3300005548 | Ga0070665_100378122 | Ga0070665_1003781222 | 266 |
| 179 | 3300005618 | Ga0068864_100015618 | Ga0068864_1000156182 | 266 |
| 180 | 3300005841 | Ga0068863_100015286 | Ga0068863_1000152863 | 266 |
| 181 | 3300009101 | Ga0105247_10144793 | Ga0105247_101447931 | 266 |
| 182 | 3300009177 | Ga0105248_10251417 | Ga0105248_102514172 | 266 |
| 183 | 3300010375 | Ga0105239_10403191 | Ga0105239_104031912 | 266 |
| 184 | 3300013296 | Ga0157374_10021637 | Ga0157374_100216374 | 266 |
| 185 | 3300013306 | Ga0163162_10058713 | Ga0163162_100587134 | 266 |
| 186 | 3300014325 | Ga0163163_10134452 | Ga0163163_101344522 | 266 |
| 187 | 3300014968 | Ga0157379_10626519 | Ga0157379_106265191 | 266 |
| 188 | 3300014969 | Ga0157376_10313630 | Ga0157376_103136302 | 266 |
| 189 | 3300025913 | Ga0207695_10002232 | Ga0207695_100022327 | 266 |
| 190 | 3300025914 | Ga0207671_10016353 | Ga0207671_100163532 | 266 |
| 191 | 3300025931 | Ga0207644_10013990 | Ga0207644_100139904 | 266 |
| 192 | 3300026121 | Ga0207683_10288002 | Ga0207683_102880022 | 266 |
| 193 | 3300028379 | Ga0268266_10069552 | Ga0268266_100695523 | 266 |
| 194 | 3300045836 | Ga0466958_0156472 | Ga0466958_0156472_428_1261 | 266 |
| 195 | 3300046507 | Ga0495606_0026970 | Ga0495606_0026970_2534_3340 | 266 |
| 196 | 3300046528 | Ga0495642_0010152 | Ga0495642_0010152_1090_1896 | 266 |
| 197 | 3300046538 | Ga0495609_0005042 | Ga0495609_0005042_1381_2187 | 266 |
| 198 | 3300046664 | Ga0495659_0022869 | Ga0495659_0022869_246_1052 | 266 |
| 199 | 3300048089 | Ga0495614_0005209 | Ga0495614_0005209_1158_1964 | 266 |
| 200 | 3300005535 | Ga0070684_100325646 | Ga0070684_1003256462 | 267 |
| 201 | 3300009176 | Ga0105242_10277150 | Ga0105242_102771502 | 267 |
| 202 | 3300025934 | Ga0207686_10161485 | Ga0207686_101614852 | 267 |
| 203 | 3300037853 | Ga0436364_0376502 | Ga0436364_0376502_3994_4815 | 267 |
| 204 | 3300046690 | Ga0495624_0156772 | Ga0495624_0156772_14_823 | 267 |
| 205 | 3300048089 | Ga0495614_0089596 | Ga0495614_0089596_483_1319 | 267 |
| 206 | 3300005335 | Ga0070666_10000867 | Ga0070666_100008678 | 268 |
| 207 | 3300005338 | Ga0068868_100093551 | Ga0068868_1000935513 | 268 |
| 208 | 3300005356 | Ga0070674_100334430 | Ga0070674_1003344302 | 268 |
| 209 | 3300005367 | Ga0070667_100018244 | Ga0070667_1000182444 | 268 |
| 210 | 3300005458 | Ga0070681_10012721 | Ga0070681_100127211 | 268 |
| 211 | 3300005459 | Ga0068867_100018673 | Ga0068867_1000186733 | 268 |
| 212 | 3300005530 | Ga0070679_100483413 | Ga0070679_1004834132 | 268 |
| 213 | 3300005535 | Ga0070684_100160391 | Ga0070684_1001603911 | 268 |
| 214 | 3300005548 | Ga0070665_100069541 | Ga0070665_1000695412 | 268 |
| 215 | 3300005563 | Ga0068855_100082093 | Ga0068855_1000820932 | 268 |
| 216 | 3300005577 | Ga0068857_100038628 | Ga0068857_1000386282 | 268 |
| 217 | 3300005617 | Ga0068859_100017005 | Ga0068859_1000170054 | 268 |
| 218 | 3300005618 | Ga0068864_100466696 | Ga0068864_1004666961 | 268 |
| 219 | 3300005841 | Ga0068863_100259769 | Ga0068863_1002597692 | 268 |
| 220 | 3300005841 | Ga0068863_100303582 | Ga0068863_1003035821 | 268 |
| 221 | 3300005842 | Ga0068858_100007380 | Ga0068858_1000073802 | 268 |
| 222 | 3300005843 | Ga0068860_100011760 | Ga0068860_1000117607 | 268 |
| 223 | 3300005843 | Ga0068860_100616289 | Ga0068860_1006162891 | 268 |
| 224 | 3300006237 | Ga0097621_100002398 | Ga0097621_1000023987 | 268 |
| 225 | 3300006237 | Ga0097621_100017321 | Ga0097621_1000173214 | 268 |
| 226 | 3300006358 | Ga0068871_100040114 | Ga0068871_1000401144 | 268 |
| 227 | 3300006358 | Ga0068871_100048999 | Ga0068871_1000489993 | 268 |
| 228 | 3300006881 | Ga0068865_100010826 | Ga0068865_1000108264 | 268 |
| 229 | 3300006931 | Ga0097620_100017005 | Ga0097620_1000170054 | 268 |
| 230 | 3300009093 | Ga0105240_10008037 | Ga0105240_100080373 | 268 |
| 231 | 3300009093 | Ga0105240_10305603 | Ga0105240_103056032 | 268 |
| 232 | 3300009098 | Ga0105245_10013658 | Ga0105245_100136583 | 268 |
| 233 | 3300009098 | Ga0105245_10050570 | Ga0105245_100505702 | 268 |
| 234 | 3300009098 | Ga0105245_10320077 | Ga0105245_103200772 | 268 |
| 235 | 3300009176 | Ga0105242_10150562 | Ga0105242_101505622 | 268 |
| 236 | 3300009177 | Ga0105248_10004449 | Ga0105248_1000444910 | 268 |
| 237 | 3300009551 | Ga0105238_10033069 | Ga0105238_100330694 | 268 |
| 238 | 3300010375 | Ga0105239_10039631 | Ga0105239_100396313 | 268 |
| 239 | 3300013104 | Ga0157370_10030360 | Ga0157370_100303602 | 268 |
| 240 | 3300013296 | Ga0157374_10035024 | Ga0157374_100350244 | 268 |
| 241 | 3300013297 | Ga0157378_10016931 | Ga0157378_100169313 | 268 |
| 242 | 3300013306 | Ga0163162_10251945 | Ga0163162_102519452 | 268 |
| 243 | 3300014325 | Ga0163163_10010693 | Ga0163163_1001069311 | 268 |
| 244 | 3300025903 | Ga0207680_10001088 | Ga0207680_100010886 | 268 |
| 245 | 3300025912 | Ga0207707_10001236 | Ga0207707_100012366 | 268 |
| 246 | 3300025913 | Ga0207695_10067847 | Ga0207695_100678472 | 268 |
| 247 | 3300025914 | Ga0207671_10172143 | Ga0207671_101721432 | 268 |
| 248 | 3300025921 | Ga0207652_10179868 | Ga0207652_101798682 | 268 |
| 249 | 3300025927 | Ga0207687_10162493 | Ga0207687_101624932 | 268 |
| 250 | 3300025934 | Ga0207686_10008101 | Ga0207686_100081013 | 268 |
| 251 | 3300025938 | Ga0207704_10007360 | Ga0207704_100073604 | 268 |
| 252 | 3300025941 | Ga0207711_10019653 | Ga0207711_100196532 | 268 |
| 253 | 3300025949 | Ga0207667_10255582 | Ga0207667_102555822 | 268 |
| 254 | 3300025986 | Ga0207658_10011414 | Ga0207658_100114147 | 268 |
| 255 | 3300026088 | Ga0207641_10442840 | Ga0207641_104428402 | 268 |
| 256 | 3300028381 | Ga0268264_10009485 | Ga0268264_100094853 | 268 |
| 257 | 3300028800 | Ga0265338_10211551 | Ga0265338_102115512 | 268 |
| 258 | 3300037853 | Ga0436364_0310874 | Ga0436364_0310874_12539_13363 | 268 |
| 259 | 3300005338 | Ga0068868_100003367 | Ga0068868_1000033672 | 269 |
| 260 | 3300005458 | Ga0070681_10259845 | Ga0070681_102598452 | 269 |
| 261 | 3300005539 | Ga0068853_100036291 | Ga0068853_1000362911 | 269 |
| 262 | 3300005548 | Ga0070665_100034223 | Ga0070665_1000342234 | 269 |
| 263 | 3300005563 | Ga0068855_100499146 | Ga0068855_1004991461 | 269 |
| 264 | 3300005577 | Ga0068857_100029235 | Ga0068857_1000292354 | 269 |
| 265 | 3300005617 | Ga0068859_100463612 | Ga0068859_1004636122 | 269 |
| 266 | 3300005618 | Ga0068864_100534170 | Ga0068864_1005341702 | 269 |
| 267 | 3300005841 | Ga0068863_100039728 | Ga0068863_1000397282 | 269 |
| 268 | 3300005842 | Ga0068858_100019068 | Ga0068858_1000190683 | 269 |
| 269 | 3300005843 | Ga0068860_100137361 | Ga0068860_1001373612 | 269 |
| 270 | 3300006237 | Ga0097621_100064753 | Ga0097621_1000647532 | 269 |
| 271 | 3300006237 | Ga0097621_100068163 | Ga0097621_1000681632 | 269 |
| 272 | 3300006358 | Ga0068871_100007571 | Ga0068871_1000075712 | 269 |
| 273 | 3300006931 | Ga0097620_100463629 | Ga0097620_1004636292 | 269 |
| 274 | 3300009093 | Ga0105240_10314158 | Ga0105240_103141582 | 269 |
| 275 | 3300009093 | Ga0105240_10595764 | Ga0105240_105957642 | 269 |
| 276 | 3300009098 | Ga0105245_10023003 | Ga0105245_100230035 | 269 |
| 277 | 3300009098 | Ga0105245_10078237 | Ga0105245_100782372 | 269 |
| 278 | 3300009176 | Ga0105242_10398554 | Ga0105242_103985542 | 269 |
| 279 | 3300009177 | Ga0105248_10033698 | Ga0105248_100336982 | 269 |
| 280 | 3300009545 | Ga0105237_10358903 | Ga0105237_103589032 | 269 |
| 281 | 3300009551 | Ga0105238_10007197 | Ga0105238_100071972 | 269 |
| 282 | 3300009551 | Ga0105238_10273126 | Ga0105238_102731262 | 269 |
| 283 | 3300010375 | Ga0105239_10154156 | Ga0105239_101541562 | 269 |
| 284 | 3300011119 | Ga0105246_10158518 | Ga0105246_101585182 | 269 |
| 285 | 3300013104 | Ga0157370_10263731 | Ga0157370_102637312 | 269 |
| 286 | 3300013105 | Ga0157369_10068313 | Ga0157369_100683132 | 269 |
| 287 | 3300013105 | Ga0157369_10248687 | Ga0157369_102486872 | 269 |
| 288 | 3300013297 | Ga0157378_10065088 | Ga0157378_100650882 | 269 |
| 289 | 3300013297 | Ga0157378_10131003 | Ga0157378_101310032 | 269 |
| 290 | 3300013306 | Ga0163162_10006750 | Ga0163162_100067503 | 269 |
| 291 | 3300013308 | Ga0157375_10074165 | Ga0157375_100741652 | 269 |
| 292 | 3300014325 | Ga0163163_10003155 | Ga0163163_1000315517 | 269 |
| 293 | 3300025911 | Ga0207654_10349637 | Ga0207654_103496372 | 269 |
| 294 | 3300025912 | Ga0207707_10164735 | Ga0207707_101647352 | 269 |
| 295 | 3300025912 | Ga0207707_10167910 | Ga0207707_101679102 | 269 |
| 296 | 3300025913 | Ga0207695_10426428 | Ga0207695_104264282 | 269 |
| 297 | 3300025914 | Ga0207671_10227370 | Ga0207671_102273702 | 269 |
| 298 | 3300025919 | Ga0207657_10001968 | Ga0207657_100019683 | 269 |
| 299 | 3300025924 | Ga0207694_10202954 | Ga0207694_102029542 | 269 |
| 300 | 3300025927 | Ga0207687_10023862 | Ga0207687_100238623 | 269 |
| 301 | 3300025931 | Ga0207644_10150571 | Ga0207644_101505712 | 269 |
| 302 | 3300025941 | Ga0207711_10219133 | Ga0207711_102191332 | 269 |
| 303 | 3300025949 | Ga0207667_10139705 | Ga0207667_101397052 | 269 |
| 304 | 3300026035 | Ga0207703_10008427 | Ga0207703_100084274 | 269 |
| 305 | 3300026078 | Ga0207702_10691157 | Ga0207702_106911572 | 269 |
| 306 | 3300026088 | Ga0207641_10120951 | Ga0207641_101209512 | 269 |
| 307 | 3300026095 | Ga0207676_10050087 | Ga0207676_100500873 | 269 |
| 308 | 3300026116 | Ga0207674_10018058 | Ga0207674_100180582 | 269 |
| 309 | 3300026142 | Ga0207698_10748353 | Ga0207698_107483531 | 269 |
| 310 | 3300028379 | Ga0268266_10010748 | Ga0268266_100107485 | 269 |
| 311 | 3300028381 | Ga0268264_10074739 | Ga0268264_100747393 | 269 |
| 312 | 3300031249 | Ga0265339_10110992 | Ga0265339_101109922 | 269 |
| 313 | 3300031711 | Ga0265314_10002439 | Ga0265314_1000243911 | 269 |
| 314 | 3300046472 | Ga0495580_0120351 | Ga0495580_0120351_440_1279 | 269 |
| 315 | 3300046499 | Ga0495594_0180376 | Ga0495594_0180376_308_1147 | 269 |
| 316 | 3300046694 | Ga0495649_0100446 | Ga0495649_0100446_161_973 | 269 |
| 317 | 3300047317 | Ga0495604_0098545 | Ga0495604_0098545_150_992 | 269 |
| 318 | 3300053119 | Ga0500595_000025 | Ga0500595_000025_139368_140177 | 269 |
| 319 | 3300005548 | Ga0070665_100244742 | Ga0070665_1002447421 | 270 |
| 320 | 3300005563 | Ga0068855_100029557 | Ga0068855_1000295573 | 270 |
| 321 | 3300005937 | Ga0081455_10194456 | Ga0081455_101944562 | 270 |
| 322 | 3300009177 | Ga0105248_10066107 | Ga0105248_100661072 | 270 |
| 323 | 3300013104 | Ga0157370_10050837 | Ga0157370_100508373 | 270 |
| 324 | 3300025903 | Ga0207680_10249067 | Ga0207680_102490672 | 270 |
| 325 | 3300025913 | Ga0207695_10086722 | Ga0207695_100867222 | 270 |
| 326 | 3300028379 | Ga0268266_10215581 | Ga0268266_102155813 | 270 |
| 327 | 3300046694 | Ga0495649_0019338 | Ga0495649_0019338_519_1352 | 270 |
| 328 | 3300049573 | Ga0501037_0183518 | Ga0501037_0183518_457_1299 | 270 |
| 329 | 3300049581 | Ga0501047_0014170 | Ga0501047_0014170_3210_4046 | 270 |
| 330 | 3300049822 | Ga0501035_0055431 | Ga0501035_0055431_2459_3301 | 270 |
| 331 | 3300049823 | Ga0501044_0002699 | Ga0501044_0002699_3579_4415 | 270 |
| 332 | 3300049823 | Ga0501044_0005795 | Ga0501044_0005795_12435_13277 | 270 |
| 333 | iso_pu_bacteria | 2884215851 | 2884216312 | 270 |
| 334 | 3300005327 | Ga0070658_10097019 | Ga0070658_100970193 | 272 |
| 335 | 3300005435 | Ga0070714_100149869 | Ga0070714_1001498692 | 272 |
| 336 | 3300005458 | Ga0070681_10105662 | Ga0070681_101056624 | 272 |
| 337 | 3300005545 | Ga0070695_100235529 | Ga0070695_1002355291 | 272 |
| 338 | 3300006914 | Ga0075436_100009556 | Ga0075436_1000095562 | 272 |
| 339 | 3300009551 | Ga0105238_10102576 | Ga0105238_101025763 | 272 |
| 340 | 3300025912 | Ga0207707_10058879 | Ga0207707_100588792 | 272 |
| 341 | 3300025921 | Ga0207652_10020050 | Ga0207652_100200505 | 272 |
| 342 | 3300025929 | Ga0207664_10492828 | Ga0207664_104928281 | 272 |
| 343 | 3300028800 | Ga0265338_10194351 | Ga0265338_101943512 | 272 |
| 344 | 3300031344 | Ga0265316_10014579 | Ga0265316_100145792 | 272 |
| 345 | 3300035695 | Ga0373927_0002154 | Ga0373927_0002154_128_952 | 272 |
| 346 | 3300044694 | Ga0466963_0144498 | Ga0466963_0144498_765_1607 | 272 |
| 347 | 3300047320 | Ga0495672_0169286 | Ga0495672_0169286_223_1053 | 272 |
| 348 | 3300047472 | Ga0495686_0000030 | Ga0495686_0000030_152270_153094 | 272 |
| 349 | 3300048907 | Ga0496104_0000673 | Ga0496104_0000673_14066_14890 | 272 |
| 350 | 3300050513 | nmdc:mga0rr50_529404_c1 | nmdc:mga0rr50_529404_c1_74_898 | 272 |
| 351 | 3300050514 | nmdc:mga08x19_8813_c1 | nmdc:mga08x19_8813_c1_116_940 | 272 |
| 352 | 3300013100 | Ga0157373_10249959 | Ga0157373_102499592 | 273 |
| 353 | 3300037853 | Ga0436364_1419803 | Ga0436364_1419803_4933_5772 | 273 |
| 354 | 3300037853 | Ga0436364_1551588 | Ga0436364_1551588_232_1107 | 273 |
| 355 | 3300039438 | Ga0436360_0246149 | Ga0436360_0246149_1619_2458 | 273 |
| 356 | 3300039447 | Ga0436361_0567168 | Ga0436361_0567168_132455_133294 | 273 |
| 357 | 3300039447 | Ga0436361_0671658 | Ga0436361_0671658_1599_2438 | 273 |
| 358 | 3300044656 | Ga0466969_0168779 | Ga0466969_0168779_136_975 | 273 |
| 359 | 3300045049 | Ga0466959_0358181 | Ga0466959_0358181_35_874 | 273 |
| 360 | 3300048929 | Ga0496126_0000820 | Ga0496126_0000820_26358_27185 | 273 |
| 361 | 3300005329 | Ga0070683_100525215 | Ga0070683_1005252152 | 274 |
| 362 | 3300005366 | Ga0070659_100016154 | Ga0070659_1000161546 | 274 |
| 363 | 3300005530 | Ga0070679_100030586 | Ga0070679_1000305862 | 274 |
| 364 | 3300005548 | Ga0070665_100115814 | Ga0070665_1001158143 | 274 |
| 365 | 3300005563 | Ga0068855_100108734 | Ga0068855_1001087342 | 274 |
| 366 | 3300005614 | Ga0068856_100022940 | Ga0068856_1000229405 | 274 |
| 367 | 3300005616 | Ga0068852_100481491 | Ga0068852_1004814911 | 274 |
| 368 | 3300009093 | Ga0105240_10102083 | Ga0105240_101020833 | 274 |
| 369 | 3300010375 | Ga0105239_10262439 | Ga0105239_102624392 | 274 |
| 370 | 3300013102 | Ga0157371_10054199 | Ga0157371_100541992 | 274 |
| 371 | 3300013105 | Ga0157369_10410370 | Ga0157369_104103702 | 274 |
| 372 | 3300013296 | Ga0157374_10003283 | Ga0157374_1000328310 | 274 |
| 373 | 3300013296 | Ga0157374_10179241 | Ga0157374_101792413 | 274 |
| 374 | 3300014969 | Ga0157376_10501729 | Ga0157376_105017292 | 274 |
| 375 | 3300020069 | Ga0197907_11375067 | Ga0197907_113750673 | 274 |
| 376 | 3300020076 | Ga0206355_1614066 | Ga0206355_16140663 | 274 |
| 377 | 3300021377 | Ga0213874_10024539 | Ga0213874_100245392 | 274 |
| 378 | 3300021384 | Ga0213876_10005055 | Ga0213876_100050557 | 274 |
| 379 | 3300021388 | Ga0213875_10000005 | Ga0213875_1000000555 | 274 |
| 380 | 3300021388 | Ga0213875_10000196 | Ga0213875_100001968 | 274 |
| 381 | 3300021388 | Ga0213875_10036423 | Ga0213875_100364232 | 274 |
| 382 | 3300021388 | Ga0213875_10083536 | Ga0213875_100835362 | 274 |
| 383 | 3300022467 | Ga0224712_10086811 | Ga0224712_100868112 | 274 |
| 384 | 3300025912 | Ga0207707_10201515 | Ga0207707_102015152 | 274 |
| 385 | 3300025919 | Ga0207657_10213571 | Ga0207657_102135712 | 274 |
| 386 | 3300025921 | Ga0207652_10087987 | Ga0207652_100879873 | 274 |
| 387 | 3300025932 | Ga0207690_10038790 | Ga0207690_100387902 | 274 |
| 388 | 3300026067 | Ga0207678_10163267 | Ga0207678_101632672 | 274 |
| 389 | 3300026078 | Ga0207702_10015971 | Ga0207702_100159715 | 274 |
| 390 | 3300028379 | Ga0268266_10164593 | Ga0268266_101645933 | 274 |
| 391 | 3300037853 | Ga0436364_0032202 | Ga0436364_0032202_178_1053 | 274 |
| 392 | 3300037853 | Ga0436364_0068230 | Ga0436364_0068230_45_941 | 274 |
| 393 | 3300037853 | Ga0436364_0080170 | Ga0436364_0080170_57424_58266 | 274 |
| 394 | 3300037853 | Ga0436364_0278774 | Ga0436364_0278774_251082_251930 | 274 |
| 395 | 3300037853 | Ga0436364_0630365 | Ga0436364_0630365_252_1094 | 274 |
| 396 | 3300037853 | Ga0436364_0718428 | Ga0436364_0718428_4101_4943 | 274 |
| 397 | 3300037853 | Ga0436364_1150628 | Ga0436364_1150628_4293_5135 | 274 |
| 398 | 3300039437 | Ga0436365_1005832 | Ga0436365_1005832_39_887 | 274 |
| 399 | 3300039437 | Ga0436365_1330341 | Ga0436365_1330341_25336_26178 | 274 |
| 400 | 3300039450 | Ga0436363_1408881 | Ga0436363_1408881_39_887 | 274 |
| 401 | 3300039453 | Ga0436362_1282706 | Ga0436362_1282706_1015_1863 | 274 |
| 402 | 3300044684 | Ga0466966_0157362 | Ga0466966_0157362_459_1283 | 274 |
| 403 | 3300044842 | Ga0466957_0190714 | Ga0466957_0190714_384_1226 | 274 |
| 404 | 3300048915 | Ga0496112_0037929 | Ga0496112_0037929_3607_4449 | 274 |
| 405 | 3300048918 | Ga0496115_0237880 | Ga0496115_0237880_245_1072 | 274 |
| 406 | 3300049569 | Ga0501032_0011478 | Ga0501032_0011478_3779_4603 | 274 |
| 407 | 3300049569 | Ga0501032_0177519 | Ga0501032_0177519_545_1369 | 274 |
| 408 | 3300049570 | Ga0501033_0000876 | Ga0501033_0000876_20421_21245 | 274 |
| 409 | 3300049572 | Ga0501036_0011178 | Ga0501036_0011178_6557_7381 | 274 |
| 410 | 3300049574 | Ga0501038_0003247 | Ga0501038_0003247_13599_14423 | 274 |
| 411 | 3300049575 | Ga0501039_0237840 | Ga0501039_0237840_182_1006 | 274 |
| 412 | 3300049579 | Ga0501043_0010410 | Ga0501043_0010410_3826_4650 | 274 |
| 413 | 3300049580 | Ga0501046_0000265 | Ga0501046_0000265_32402_33226 | 274 |
| 414 | 3300049581 | Ga0501047_0003679 | Ga0501047_0003679_5552_6376 | 274 |
| 415 | 3300049589 | Ga0501073_0067085 | Ga0501073_0067085_147_971 | 274 |
| 416 | 3300049822 | Ga0501035_0002898 | Ga0501035_0002898_5134_5958 | 274 |
| 417 | 3300049823 | Ga0501044_0006355 | Ga0501044_0006355_6542_7366 | 274 |
| 418 | 3300049823 | Ga0501044_0145800 | Ga0501044_0145800_1003_1845 | 274 |
| 419 | 3300003320 | rootH2_10156923 | rootH2_101569231 | 275 |
| 420 | 3300004799 | Ga0058863_10127638 | Ga0058863_101276382 | 275 |
| 421 | 3300004803 | Ga0058862_12661585 | Ga0058862_126615851 | 275 |
| 422 | 3300005327 | Ga0070658_10009641 | Ga0070658_100096416 | 275 |
| 423 | 3300005327 | Ga0070658_10019305 | Ga0070658_100193055 | 275 |
| 424 | 3300005336 | Ga0070680_100017692 | Ga0070680_1000176923 | 275 |
| 425 | 3300005336 | Ga0070680_100126939 | Ga0070680_1001269392 | 275 |
| 426 | 3300005339 | Ga0070660_100007684 | Ga0070660_1000076846 | 275 |
| 427 | 3300005339 | Ga0070660_100012775 | Ga0070660_1000127754 | 275 |
| 428 | 3300005347 | Ga0070668_100012225 | Ga0070668_1000122253 | 275 |
| 429 | 3300005347 | Ga0070668_100035497 | Ga0070668_1000354972 | 275 |
| 430 | 3300005364 | Ga0070673_100054851 | Ga0070673_1000548513 | 275 |
| 431 | 3300005435 | Ga0070714_100000992 | Ga0070714_10000099212 | 275 |
| 432 | 3300005435 | Ga0070714_100422047 | Ga0070714_1004220472 | 275 |
| 433 | 3300005436 | Ga0070713_100170015 | Ga0070713_1001700152 | 275 |
| 434 | 3300005437 | Ga0070710_10104289 | Ga0070710_101042892 | 275 |
| 435 | 3300005456 | Ga0070678_100118782 | Ga0070678_1001187823 | 275 |
| 436 | 3300005457 | Ga0070662_100072938 | Ga0070662_1000729382 | 275 |
| 437 | 3300005458 | Ga0070681_10040595 | Ga0070681_100405955 | 275 |
| 438 | 3300005458 | Ga0070681_10692694 | Ga0070681_106926941 | 275 |
| 439 | 3300005530 | Ga0070679_100037253 | Ga0070679_1000372535 | 275 |
| 440 | 3300005530 | Ga0070679_100213691 | Ga0070679_1002136912 | 275 |
| 441 | 3300005530 | Ga0070679_100235461 | Ga0070679_1002354611 | 275 |
| 442 | 3300005535 | Ga0070684_100184391 | Ga0070684_1001843912 | 275 |
| 443 | 3300005539 | Ga0068853_100030405 | Ga0068853_1000304051 | 275 |
| 444 | 3300005548 | Ga0070665_100277908 | Ga0070665_1002779082 | 275 |
| 445 | 3300005563 | Ga0068855_100007892 | Ga0068855_1000078922 | 275 |
| 446 | 3300005563 | Ga0068855_100037522 | Ga0068855_1000375223 | 275 |
| 447 | 3300005563 | Ga0068855_100090590 | Ga0068855_1000905902 | 275 |
| 448 | 3300005563 | Ga0068855_100093481 | Ga0068855_1000934813 | 275 |
| 449 | 3300005563 | Ga0068855_100214113 | Ga0068855_1002141132 | 275 |
| 450 | 3300005563 | Ga0068855_100228378 | Ga0068855_1002283781 | 275 |
| 451 | 3300005578 | Ga0068854_100133014 | Ga0068854_1001330141 | 275 |
| 452 | 3300005614 | Ga0068856_100063719 | Ga0068856_1000637192 | 275 |
| 453 | 3300005616 | Ga0068852_100004648 | Ga0068852_1000046485 | 275 |
| 454 | 3300005616 | Ga0068852_100033624 | Ga0068852_1000336242 | 275 |
| 455 | 3300005616 | Ga0068852_100135130 | Ga0068852_1001351303 | 275 |
| 456 | 3300005834 | Ga0068851_10034231 | Ga0068851_100342313 | 275 |
| 457 | 3300005841 | Ga0068863_100134865 | Ga0068863_1001348652 | 275 |
| 458 | 3300005842 | Ga0068858_100127039 | Ga0068858_1001270392 | 275 |
| 459 | 3300005843 | Ga0068860_100101383 | Ga0068860_1001013831 | 275 |
| 460 | 3300005983 | Ga0081540_1017053 | Ga0081540_10170532 | 275 |
| 461 | 3300006028 | Ga0070717_10005941 | Ga0070717_100059415 | 275 |
| 462 | 3300006175 | Ga0070712_100043245 | Ga0070712_1000432452 | 275 |
| 463 | 3300006237 | Ga0097621_100103043 | Ga0097621_1001030432 | 275 |
| 464 | 3300006881 | Ga0068865_100258110 | Ga0068865_1002581101 | 275 |
| 465 | 3300009093 | Ga0105240_10003079 | Ga0105240_1000307917 | 275 |
| 466 | 3300009093 | Ga0105240_10065336 | Ga0105240_100653364 | 275 |
| 467 | 3300009174 | Ga0105241_10107222 | Ga0105241_101072222 | 275 |
| 468 | 3300009545 | Ga0105237_10506803 | Ga0105237_105068031 | 275 |
| 469 | 3300009545 | Ga0105237_10554920 | Ga0105237_105549201 | 275 |
| 470 | 3300009551 | Ga0105238_10038312 | Ga0105238_100383124 | 275 |
| 471 | 3300009551 | Ga0105238_10064619 | Ga0105238_100646193 | 275 |
| 472 | 3300009553 | Ga0105249_10350615 | Ga0105249_103506152 | 275 |
| 473 | 3300010375 | Ga0105239_10734968 | Ga0105239_107349681 | 275 |
| 474 | 3300011119 | Ga0105246_10170019 | Ga0105246_101700191 | 275 |
| 475 | 3300013102 | Ga0157371_10249364 | Ga0157371_102493641 | 275 |
| 476 | 3300013104 | Ga0157370_10078802 | Ga0157370_100788022 | 275 |
| 477 | 3300013105 | Ga0157369_10010057 | Ga0157369_100100577 | 275 |
| 478 | 3300013105 | Ga0157369_10077474 | Ga0157369_100774742 | 275 |
| 479 | 3300013105 | Ga0157369_10104792 | Ga0157369_101047922 | 275 |
| 480 | 3300013105 | Ga0157369_10193901 | Ga0157369_101939012 | 275 |
| 481 | 3300013105 | Ga0157369_10227386 | Ga0157369_102273862 | 275 |
| 482 | 3300013296 | Ga0157374_10032303 | Ga0157374_100323036 | 275 |
| 483 | 3300013297 | Ga0157378_10279212 | Ga0157378_102792122 | 275 |
| 484 | 3300013297 | Ga0157378_10290258 | Ga0157378_102902582 | 275 |
| 485 | 3300013307 | Ga0157372_10012096 | Ga0157372_100120966 | 275 |
| 486 | 3300013307 | Ga0157372_10019755 | Ga0157372_100197554 | 275 |
| 487 | 3300013307 | Ga0157372_10091926 | Ga0157372_100919265 | 275 |
| 488 | 3300013307 | Ga0157372_10099974 | Ga0157372_100999744 | 275 |
| 489 | 3300013307 | Ga0157372_10125754 | Ga0157372_101257541 | 275 |
| 490 | 3300013307 | Ga0157372_10295501 | Ga0157372_102955012 | 275 |
| 491 | 3300013307 | Ga0157372_10595132 | Ga0157372_105951322 | 275 |
| 492 | 3300014969 | Ga0157376_10278545 | Ga0157376_102785452 | 275 |
| 493 | 3300014969 | Ga0157376_10282891 | Ga0157376_102828912 | 275 |
| 494 | 3300017792 | Ga0163161_10043331 | Ga0163161_100433312 | 275 |
| 495 | 3300020080 | Ga0206350_11349122 | Ga0206350_113491222 | 275 |
| 496 | 3300021361 | Ga0213872_10056354 | Ga0213872_100563542 | 275 |
| 497 | 3300021388 | Ga0213875_10023873 | Ga0213875_100238732 | 275 |
| 498 | 3300025898 | Ga0207692_10033257 | Ga0207692_100332572 | 275 |
| 499 | 3300025906 | Ga0207699_10106750 | Ga0207699_101067502 | 275 |
| 500 | 3300025907 | Ga0207645_10040033 | Ga0207645_100400332 | 275 |
| 501 | 3300025909 | Ga0207705_10008017 | Ga0207705_100080173 | 275 |
| 502 | 3300025909 | Ga0207705_10254910 | Ga0207705_102549102 | 275 |
| 503 | 3300025911 | Ga0207654_10120735 | Ga0207654_101207352 | 275 |
| 504 | 3300025912 | Ga0207707_10196410 | Ga0207707_101964102 | 275 |
| 505 | 3300025913 | Ga0207695_10000804 | Ga0207695_1000080420 | 275 |
| 506 | 3300025913 | Ga0207695_10540405 | Ga0207695_105404052 | 275 |
| 507 | 3300025914 | Ga0207671_10169263 | Ga0207671_101692633 | 275 |
| 508 | 3300025917 | Ga0207660_10070983 | Ga0207660_100709832 | 275 |
| 509 | 3300025917 | Ga0207660_10153124 | Ga0207660_101531241 | 275 |
| 510 | 3300025919 | Ga0207657_10005349 | Ga0207657_1000534910 | 275 |
| 511 | 3300025919 | Ga0207657_10046559 | Ga0207657_100465592 | 275 |
| 512 | 3300025921 | Ga0207652_10040614 | Ga0207652_100406144 | 275 |
| 513 | 3300025921 | Ga0207652_10240559 | Ga0207652_102405592 | 275 |
| 514 | 3300025924 | Ga0207694_10018555 | Ga0207694_100185554 | 275 |
| 515 | 3300025924 | Ga0207694_10096664 | Ga0207694_100966643 | 275 |
| 516 | 3300025924 | Ga0207694_10393553 | Ga0207694_103935532 | 275 |
| 517 | 3300025929 | Ga0207664_10410534 | Ga0207664_104105342 | 275 |
| 518 | 3300025933 | Ga0207706_10013900 | Ga0207706_100139004 | 275 |
| 519 | 3300025938 | Ga0207704_10063485 | Ga0207704_100634851 | 275 |
| 520 | 3300025940 | Ga0207691_10022122 | Ga0207691_100221223 | 275 |
| 521 | 3300025941 | Ga0207711_10108729 | Ga0207711_101087292 | 275 |
| 522 | 3300025949 | Ga0207667_10000538 | Ga0207667_1000053813 | 275 |
| 523 | 3300025949 | Ga0207667_10229611 | Ga0207667_102296113 | 275 |
| 524 | 3300025949 | Ga0207667_10320680 | Ga0207667_103206802 | 275 |
| 525 | 3300025972 | Ga0207668_10160938 | Ga0207668_101609382 | 275 |
| 526 | 3300025972 | Ga0207668_10286702 | Ga0207668_102867021 | 275 |
| 527 | 3300025981 | Ga0207640_10222110 | Ga0207640_102221102 | 275 |
| 528 | 3300025981 | Ga0207640_10293528 | Ga0207640_102935281 | 275 |
| 529 | 3300026035 | Ga0207703_10132207 | Ga0207703_101322072 | 275 |
| 530 | 3300026041 | Ga0207639_10007682 | Ga0207639_100076826 | 275 |
| 531 | 3300026041 | Ga0207639_10059066 | Ga0207639_100590662 | 275 |
| 532 | 3300026067 | Ga0207678_10070265 | Ga0207678_100702652 | 275 |
| 533 | 3300026078 | Ga0207702_10070862 | Ga0207702_100708622 | 275 |
| 534 | 3300026088 | Ga0207641_10091642 | Ga0207641_100916422 | 275 |
| 535 | 3300026116 | Ga0207674_10067730 | Ga0207674_100677304 | 275 |
| 536 | 3300026121 | Ga0207683_10011081 | Ga0207683_100110816 | 275 |
| 537 | 3300026142 | Ga0207698_10008297 | Ga0207698_100082975 | 275 |
| 538 | 3300026142 | Ga0207698_10030565 | Ga0207698_100305653 | 275 |
| 539 | 3300026142 | Ga0207698_10268189 | Ga0207698_102681892 | 275 |
| 540 | 3300028379 | Ga0268266_10001822 | Ga0268266_100018222 | 275 |
| 541 | 3300028379 | Ga0268266_10003502 | Ga0268266_100035022 | 275 |
| 542 | 3300028381 | Ga0268264_10263615 | Ga0268264_102636152 | 275 |
| 543 | 3300028573 | Ga0265334_10092040 | Ga0265334_100920401 | 275 |
| 544 | 3300028800 | Ga0265338_10021009 | Ga0265338_100210095 | 275 |
| 545 | 3300028800 | Ga0265338_10048667 | Ga0265338_100486673 | 275 |
| 546 | 3300028800 | Ga0265338_10090924 | Ga0265338_100909242 | 275 |
| 547 | 3300031090 | Ga0265760_10009076 | Ga0265760_100090762 | 275 |
| 548 | 3300031235 | Ga0265330_10001094 | Ga0265330_100010944 | 275 |
| 549 | 3300031241 | Ga0265325_10071797 | Ga0265325_100717972 | 275 |
| 550 | 3300031249 | Ga0265339_10005264 | Ga0265339_100052643 | 275 |
| 551 | 3300031249 | Ga0265339_10049523 | Ga0265339_100495232 | 275 |
| 552 | 3300031344 | Ga0265316_10017922 | Ga0265316_100179225 | 275 |
| 553 | 3300031595 | Ga0265313_10017403 | Ga0265313_100174032 | 275 |
| 554 | 3300031711 | Ga0265314_10000261 | Ga0265314_1000026152 | 275 |
| 555 | 3300031712 | Ga0265342_10004473 | Ga0265342_100044736 | 275 |
| 556 | 3300033180 | Ga0307510_10017003 | Ga0307510_100170032 | 275 |
| 557 | 3300033180 | Ga0307510_10156041 | Ga0307510_101560412 | 275 |
| 558 | 3300037418 | Ga0395900_0382929 | Ga0395900_0382929_329_1204 | 275 |
| 559 | 3300037466 | Ga0395898_0066377 | Ga0395898_0066377_852_1727 | 275 |
| 560 | 3300046472 | Ga0495580_0052559 | Ga0495580_0052559_730_1563 | 275 |
| 561 | 3300046473 | Ga0495582_0005880 | Ga0495582_0005880_4809_5642 | 275 |
| 562 | 3300046473 | Ga0495582_0092786 | Ga0495582_0092786_507_1337 | 275 |
| 563 | 3300046476 | Ga0495662_0013059 | Ga0495662_0013059_882_1715 | 275 |
| 564 | 3300046477 | Ga0495664_0013075 | Ga0495664_0013075_3466_4299 | 275 |
| 565 | 3300046499 | Ga0495594_0000369 | Ga0495594_0000369_6646_7473 | 275 |
| 566 | 3300046499 | Ga0495594_0004624 | Ga0495594_0004624_4970_5803 | 275 |
| 567 | 3300046506 | Ga0495583_0021321 | Ga0495583_0021321_584_1423 | 275 |
| 568 | 3300046506 | Ga0495583_0049871 | Ga0495583_0049871_191_1018 | 275 |
| 569 | 3300046516 | Ga0495628_0203099 | Ga0495628_0203099_63_896 | 275 |
| 570 | 3300046517 | Ga0495630_0152282 | Ga0495630_0152282_873_1706 | 275 |
| 571 | 3300046518 | Ga0495631_0173971 | Ga0495631_0173971_50_877 | 275 |
| 572 | 3300046523 | Ga0495644_0000023 | Ga0495644_0000023_70825_71652 | 275 |
| 573 | 3300046524 | Ga0495648_0113351 | Ga0495648_0113351_469_1296 | 275 |
| 574 | 3300046526 | Ga0495666_0006772 | Ga0495666_0006772_2634_3467 | 275 |
| 575 | 3300046529 | Ga0495652_0006361 | Ga0495652_0006361_2234_3067 | 275 |
| 576 | 3300046533 | Ga0495640_0052530 | Ga0495640_0052530_617_1450 | 275 |
| 577 | 3300046535 | Ga0495586_0032907 | Ga0495586_0032907_1852_2685 | 275 |
| 578 | 3300046559 | Ga0495667_0007248 | Ga0495667_0007248_222_1055 | 275 |
| 579 | 3300046616 | Ga0495668_0167913 | Ga0495668_0167913_136_975 | 275 |
| 580 | 3300046642 | Ga0495634_0046425 | Ga0495634_0046425_19_852 | 275 |
| 581 | 3300046660 | Ga0495625_0000796 | Ga0495625_0000796_23482_24309 | 275 |
| 582 | 3300046660 | Ga0495625_0123758 | Ga0495625_0123758_439_1278 | 275 |
| 583 | 3300046663 | Ga0495635_0015069 | Ga0495635_0015069_1318_2151 | 275 |
| 584 | 3300046675 | Ga0495657_0116627 | Ga0495657_0116627_28_861 | 275 |
| 585 | 3300046680 | Ga0495646_0188731 | Ga0495646_0188731_14_847 | 275 |
| 586 | 3300046684 | Ga0495669_0006062 | Ga0495669_0006062_450_1277 | 275 |
| 587 | 3300046689 | Ga0495613_0023005 | Ga0495613_0023005_1126_1959 | 275 |
| 588 | 3300046689 | Ga0495613_0040073 | Ga0495613_0040073_1345_2178 | 275 |
| 589 | 3300046694 | Ga0495649_0134880 | Ga0495649_0134880_85_924 | 275 |
| 590 | 3300046809 | Ga0495600_0018704 | Ga0495600_0018704_1352_2185 | 275 |
| 591 | 3300047315 | Ga0495581_0003369 | Ga0495581_0003369_597_1430 | 275 |
| 592 | 3300047315 | Ga0495581_0269157 | Ga0495581_0269157_100_933 | 275 |
| 593 | 3300047317 | Ga0495604_0270831 | Ga0495604_0270831_207_1040 | 275 |
| 594 | 3300047319 | Ga0495674_0296787 | Ga0495674_0296787_80_913 | 275 |
| 595 | 3300047319 | Ga0495674_0567882 | Ga0495674_0567882_29_862 | 275 |
| 596 | 3300047320 | Ga0495672_0001628 | Ga0495672_0001628_7137_7964 | 275 |
| 597 | 3300047321 | Ga0495676_0035083 | Ga0495676_0035083_85_918 | 275 |
| 598 | 3300047444 | Ga0495675_0003532 | Ga0495675_0003532_1373_2206 | 275 |
| 599 | 3300047445 | Ga0495677_0003312 | Ga0495677_0003312_2466_3293 | 275 |
| 600 | 3300047469 | Ga0495673_0090525 | Ga0495673_0090525_130_969 | 275 |
| 601 | 3300048089 | Ga0495614_0103287 | Ga0495614_0103287_134_967 | 275 |
| 602 | 3300048929 | Ga0496126_0000024 | Ga0496126_0000024_139051_139881 | 275 |
| 603 | 3300048929 | Ga0496126_0078426 | Ga0496126_0078426_638_1465 | 275 |
| 604 | 3300048929 | Ga0496126_0424626 | Ga0496126_0424626_109_942 | 275 |
| 605 | 3300053119 | Ga0500595_005243 | Ga0500595_005243_3148_3987 | 275 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4i66-assembly1.cif.gz_A-2 | crystal structure of hoch_4089 protein from haliangium ochraceum | 0.813 | 51 | 273 |
| 4i66-assembly1.cif.gz_A-2 | crystal structure of hoch_4089 protein from haliangium ochraceum | 0.8016 | 51 | 273 |
| 3mhe-assembly1.cif.gz_B | crystal structure of ketosteroid isomerase p39a from pseudomonas testosteroni (tksi) | 0.745 | 218 | 239 |
| 6dbs-assembly1.cif.gz_A | fusion surface structure, function, and dynamics of gamete fusogen hap2 | 0.7444 | 218 | 240 |
| 6dbs-assembly1.cif.gz_B | fusion surface structure, function, and dynamics of gamete fusogen hap2 | 0.744 | 218 | 240 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q6TMK2_24_122_3.10.450.50 | Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; | 0.7958 | 217 | 239 | 3.10.450.50 |
| 4i66A00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Domain of unknown function DUF4159 | 0.7926 | 51 | 273 | 3.40.50.12140 |
| 4i66A00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Domain of unknown function DUF4159 | 0.7813 | 51 | 273 | 3.40.50.12140 |
| 5hgrA02 | Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; | 0.766 | 216 | 238 | 3.10.450.50 |
| 6fejB00 | Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; | 0.7545 | 218 | 236 | 3.10.450.50 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1H4SNU6-F1-model_v4 | DUF4159 domain-containing protein | 0.9957 | 26 | 275 |
|
| AF-A0A2Z5FU96-F1-model_v4 | DUF4159 domain-containing protein | 0.99 | 34 | 275 |
|
| AF-A0A2Z5FU96-F1-model_v4 | DUF4159 domain-containing protein | 0.9819 | 34 | 275 |
|
| AF-A0A7Y8LJX4-F1-model_v4 | DUF4159 domain-containing protein | 0.9748 | 97 | 275 |
|
| AF-A0A7C2JWL8-F1-model_v4 | DUF4159 domain-containing protein | 0.9731 | 70 | 275 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar