F468479

General Info

Members Datasets Scaffolds Average Seq Length
605 254 604 277

Family's Representative Sequence

Representative Sequence 3300025921|Ga0207652_10240559|Ga0207652_102405592
Length 326
Sequence MSIREDPTFRNMIAWSTRPRRECAANIQLSCSRAHGGMMAESARPKPPGDVMKRIGRVALPLIFAGAAITVALAQRAFRQYPSVEYGESIPLPPDWNQPGEWTFARLMFPPGPLDGYRGRFDGPWQEGLSLWTQDYPRADRALANAVRRLTRIQARSVEQPVSLDDGDEIYNWPWLYAVQVGEWGLTEKEAKKLRDYLLRGGFFMADDCHGSEEQAYFEKTMKMVFPDRKLVDIPDSDPIFHTFFDLDHRFQIPGMEHLATGHKKDGYVPHWKGIYDDKGRIMVAFSLNSDIGDSWEFLDDRRYPAKFTVLGTEIGVNYVIYAMTH

Samples

Sample ID Description Type Environment
1 2884215851 Edaphobacter sp. 12200R-103 Isolate Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
20 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
24 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
36 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
47 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
48 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
49 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
50 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
51 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
52 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
53 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
54 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
55 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
57 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
58 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
59 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
60 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
61 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
62 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
64 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
65 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
67 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
68 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
69 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
70 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
71 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
72 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
73 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
74 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
75 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
76 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
77 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
78 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
79 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
80 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
81 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
82 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
83 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
84 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
85 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
86 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
87 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
88 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
89 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
90 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
91 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
92 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
93 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
94 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
95 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
96 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
97 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
98 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
99 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
141 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
144 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
145 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
146 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
147 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
148 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
149 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
150 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
151 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
152 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
153 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
154 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
155 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
156 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
157 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
158 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
159 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
160 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
161 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
162 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
163 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
164 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
165 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
166 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
167 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
168 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
169 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
170 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
171 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
172 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
173 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
174 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
175 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
176 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
177 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
178 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
179 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
180 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
181 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
182 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
183 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
184 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
185 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
186 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
187 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
188 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
189 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
190 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
191 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
192 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
193 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
194 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
195 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
196 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
197 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
198 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
199 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
200 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
201 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
202 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
203 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
204 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
205 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
206 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
207 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
208 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
209 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
210 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
211 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
212 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
213 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
214 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
215 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
216 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
217 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
218 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
219 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
220 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
221 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
222 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
223 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
224 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
225 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
226 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
227 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
228 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
229 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
230 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
231 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
232 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
233 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
234 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
235 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
236 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
237 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
238 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
239 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
240 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
241 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
242 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
243 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
244 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
245 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
246 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
247 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
248 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
249 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
250 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
251 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
252 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
253 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
254 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.51
Metatranscriptomes 1.32
Isolates 0.17

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.33
Nodule 0
Rhizoplane 0.66
Rhizosphere 92.07
Stem 0
Stem Tuber 0
Unclassified 6.94

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10156923 3300003320 Bacteria 2071
2 Ga0058863_10127638 3300004799 Bacteria 2235
3 Ga0058862_12661585 3300004803 Bacteria 2510
4 Ga0070658_10009641 3300005327 Bacteria 7751
5 Ga0070658_10019305 3300005327 Bacteria 5459
6 Ga0070658_10097019 3300005327 Unclassified 2434
7 Ga0070683_100525215 3300005329 Unclassified 1131
8 Ga0068869_100060918 3300005334 Bacteria 2767
9 Ga0070666_10000867 3300005335 Bacteria 18321
10 Ga0070680_100017692 3300005336 Bacteria 5623
11 Ga0070680_100126939 3300005336 Bacteria 2132
12 Ga0070680_100465250 3300005336 Bacteria 1080
13 Ga0068868_100003367 3300005338 Bacteria 11118
14 Ga0068868_100093551 3300005338 Bacteria 2424
15 Ga0070660_100007684 3300005339 Bacteria 7513
16 Ga0070660_100012775 3300005339 Bacteria 6003
17 Ga0070660_100015575 3300005339 Bacteria 5494
18 Ga0070692_10053668 3300005345 Bacteria 2102
19 Ga0070668_100012225 3300005347 Bacteria 6395
20 Ga0070668_100035497 3300005347 Bacteria 3802
21 Ga0070671_100061186 3300005355 Bacteria 3136
22 Ga0070674_100334430 3300005356 Bacteria 1218
23 Ga0070673_100054851 3300005364 Bacteria 3137
24 Ga0070659_100016154 3300005366 Bacteria 5601
25 Ga0070659_100023438 3300005366 Bacteria 4723
26 Ga0070667_100018244 3300005367 Bacteria 5817
27 Ga0070667_100281147 3300005367 Bacteria 1494
28 Ga0070703_10076787 3300005406 Bacteria 1128
29 Ga0070709_10056950 3300005434 Bacteria 2474
30 Ga0070714_100000338 3300005435 Bacteria 35168
31 Ga0070714_100000992 3300005435 Bacteria 20251
32 Ga0070714_100149869 3300005435 Bacteria 2101
33 Ga0070714_100422047 3300005435 Unclassified 1264
34 Ga0070714_100444930 3300005435 Unclassified 1230
35 Ga0070713_100170015 3300005436 Unclassified 1952
36 Ga0070710_10104289 3300005437 Bacteria 1694
37 Ga0070710_10114669 3300005437 Bacteria 1623
38 Ga0070710_10280974 3300005437 Unclassified 1080
39 Ga0070701_10000981 3300005438 Bacteria 10339
40 Ga0070663_100291367 3300005455 Bacteria 1304
41 Ga0070678_100118782 3300005456 Bacteria 2081
42 Ga0070678_100174669 3300005456 Bacteria 1753
43 Ga0070662_100072938 3300005457 Bacteria 2536
44 Ga0070681_10012721 3300005458 Bacteria 8353
45 Ga0070681_10040595 3300005458 Unclassified 4661
46 Ga0070681_10105662 3300005458 Bacteria 2758
47 Ga0070681_10259845 3300005458 Bacteria 1648
48 Ga0070681_10692694 3300005458 Bacteria 935
49 Ga0068867_100018673 3300005459 Bacteria 4929
50 Ga0070706_100082040 3300005467 Bacteria 2987
51 Ga0070706_100208419 3300005467 Bacteria 1825
52 Ga0070679_100030586 3300005530 Bacteria 5315
53 Ga0070679_100037253 3300005530 Unclassified 4830
54 Ga0070679_100213691 3300005530 Bacteria 1891
55 Ga0070679_100235461 3300005530 Bacteria 1790
56 Ga0070679_100483413 3300005530 Bacteria 1182
57 Ga0070684_100160391 3300005535 Bacteria 2040
58 Ga0070684_100184391 3300005535 Bacteria 1898
59 Ga0070684_100325646 3300005535 Unclassified 1412
60 Ga0070697_100539159 3300005536 Bacteria 1022
61 Ga0068853_100030405 3300005539 Bacteria 4562
62 Ga0068853_100036291 3300005539 Bacteria 4191
63 Ga0070695_100235529 3300005545 Bacteria 1325
64 Ga0070696_100359340 3300005546 Bacteria 1130
65 Ga0070665_100034223 3300005548 Bacteria 5109
66 Ga0070665_100060487 3300005548 Unclassified 3796
67 Ga0070665_100069541 3300005548 Bacteria 3529
68 Ga0070665_100115814 3300005548 Unclassified 2683
69 Ga0070665_100244742 3300005548 Bacteria 1794
70 Ga0070665_100277908 3300005548 Unclassified 1676
71 Ga0070665_100378122 3300005548 Bacteria 1423
72 Ga0070704_100074410 3300005549 Bacteria 2477
73 Ga0068855_100007892 3300005563 Bacteria 12855
74 Ga0068855_100029557 3300005563 Bacteria 6550
75 Ga0068855_100037522 3300005563 Bacteria 5761
76 Ga0068855_100078424 3300005563 Bacteria 3832
77 Ga0068855_100082093 3300005563 Bacteria 3736
78 Ga0068855_100090590 3300005563 Bacteria 3529
79 Ga0068855_100093481 3300005563 Bacteria 3468
80 Ga0068855_100108734 3300005563 Bacteria 3184
81 Ga0068855_100214113 3300005563 Bacteria 2164
82 Ga0068855_100215309 3300005563 Bacteria 2157
83 Ga0068855_100228378 3300005563 Unclassified 2085
84 Ga0068855_100499146 3300005563 Bacteria 1322
85 Ga0070664_100122596 3300005564 Unclassified 2277
86 Ga0068857_100029235 3300005577 Bacteria 4863
87 Ga0068857_100038628 3300005577 Bacteria 4227
88 Ga0068854_100133014 3300005578 Unclassified 1901
89 Ga0068856_100019095 3300005614 Bacteria 6653
90 Ga0068856_100022940 3300005614 Bacteria 6068
91 Ga0068856_100063719 3300005614 Unclassified 3641
92 Ga0068856_100320192 3300005614 Bacteria 1568
93 Ga0068852_100004648 3300005616 Bacteria 9731
94 Ga0068852_100033624 3300005616 Bacteria 4259
95 Ga0068852_100135130 3300005616 Bacteria 2276
96 Ga0068852_100481491 3300005616 Unclassified 1233
97 Ga0068859_100017005 3300005617 Bacteria 7301
98 Ga0068859_100041054 3300005617 Bacteria 4648
99 Ga0068859_100463612 3300005617 Bacteria 1363
100 Ga0068864_100015618 3300005618 Bacteria 6316
101 Ga0068864_100466696 3300005618 Bacteria 1210
102 Ga0068864_100534170 3300005618 Bacteria 1132
103 Ga0068851_10034231 3300005834 Bacteria 2535
104 Ga0068863_100015286 3300005841 Bacteria 7376
105 Ga0068863_100039728 3300005841 Bacteria 4475
106 Ga0068863_100134865 3300005841 Bacteria 2359
107 Ga0068863_100259769 3300005841 Bacteria 1679
108 Ga0068863_100303582 3300005841 Bacteria 1549
109 Ga0068858_100007380 3300005842 Bacteria 10636
110 Ga0068858_100019068 3300005842 Bacteria 6417
111 Ga0068858_100127039 3300005842 Bacteria 2388
112 Ga0068860_100011760 3300005843 Bacteria 8625
113 Ga0068860_100101383 3300005843 Bacteria 2747
114 Ga0068860_100137361 3300005843 Bacteria 2348
115 Ga0068860_100616289 3300005843 Bacteria 1092
116 Ga0081455_10021250 3300005937 Bacteria 6090
117 Ga0081455_10194456 3300005937 Bacteria 1524
118 Ga0081540_1017053 3300005983 Bacteria 4514
119 Ga0070717_10005887 3300006028 Bacteria 8978
120 Ga0070717_10005941 3300006028 Bacteria 8937
121 Ga0070717_10189470 3300006028 Bacteria 1797
122 Ga0070712_100043245 3300006175 Unclassified 3100
123 Ga0097621_100002398 3300006237 Bacteria 12843
124 Ga0097621_100017321 3300006237 Bacteria 5470
125 Ga0097621_100064753 3300006237 Bacteria 3007
126 Ga0097621_100068163 3300006237 Bacteria 2934
127 Ga0097621_100103043 3300006237 Bacteria 2403
128 Ga0068871_100007571 3300006358 Bacteria 7769
129 Ga0068871_100040114 3300006358 Bacteria 3749
130 Ga0068871_100048999 3300006358 Bacteria 3412
131 Ga0075428_100372349 3300006844 Unclassified 1531
132 Ga0075430_100027318 3300006846 Bacteria 4850
133 Ga0075434_100437062 3300006871 Bacteria 1330
134 Ga0068865_100010826 3300006881 Bacteria 5690
135 Ga0068865_100258110 3300006881 Bacteria 1378
136 Ga0075436_100000108 3300006914 Bacteria 48881
137 Ga0075436_100009556 3300006914 Bacteria 6638
138 Ga0097620_100017005 3300006931 Bacteria 7301
139 Ga0097620_100041054 3300006931 Bacteria 4648
140 Ga0097620_100463629 3300006931 Bacteria 1363
141 Ga0099794_10261954 3300007265 Bacteria 892
142 Ga0105240_10001940 3300009093 Bacteria 34288
143 Ga0105240_10002071 3300009093 Bacteria 32871
144 Ga0105240_10002300 3300009093 Bacteria 30903
145 Ga0105240_10003079 3300009093 Bacteria 26206
146 Ga0105240_10008037 3300009093 Bacteria 15182
147 Ga0105240_10065336 3300009093 Unclassified 4517
148 Ga0105240_10102083 3300009093 Bacteria 3486
149 Ga0105240_10305603 3300009093 Unclassified 1818
150 Ga0105240_10314158 3300009093 Bacteria 1788
151 Ga0105240_10595764 3300009093 Bacteria 1218
152 Ga0111539_10266039 3300009094 Unclassified 1996
153 Ga0105245_10013658 3300009098 Bacteria 7074
154 Ga0105245_10023003 3300009098 Bacteria 5468
155 Ga0105245_10050570 3300009098 Bacteria 3726
156 Ga0105245_10078237 3300009098 Bacteria 3018
157 Ga0105245_10320077 3300009098 Bacteria 1528
158 Ga0105247_10144793 3300009101 Bacteria 1560
159 Ga0105241_10107222 3300009174 Bacteria 2231
160 Ga0105242_10150562 3300009176 Bacteria 2028
161 Ga0105242_10277150 3300009176 Unclassified 1522
162 Ga0105242_10398554 3300009176 Unclassified 1284
163 Ga0105248_10004449 3300009177 Bacteria 15512
164 Ga0105248_10033698 3300009177 Bacteria 5723
165 Ga0105248_10066107 3300009177 Unclassified 4060
166 Ga0105248_10251417 3300009177 Bacteria 1990
167 Ga0105237_10001515 3300009545 Bacteria 30472
168 Ga0105237_10005232 3300009545 Bacteria 14678
169 Ga0105237_10007159 3300009545 Bacteria 12256
170 Ga0105237_10024235 3300009545 Bacteria 6209
171 Ga0105237_10358903 3300009545 Bacteria 1462
172 Ga0105237_10506803 3300009545 Bacteria 1213
173 Ga0105237_10554920 3300009545 Unclassified 1155
174 Ga0105238_10007197 3300009551 Bacteria 11136
175 Ga0105238_10033069 3300009551 Bacteria 5262
176 Ga0105238_10038312 3300009551 Bacteria 4869
177 Ga0105238_10064619 3300009551 Unclassified 3659
178 Ga0105238_10102576 3300009551 Unclassified 2842
179 Ga0105238_10133131 3300009551 Unclassified 2464
180 Ga0105238_10273126 3300009551 Bacteria 1671
181 Ga0105249_10202080 3300009553 Bacteria 1945
182 Ga0105249_10350615 3300009553 Unclassified 1495
183 Ga0105239_10039631 3300010375 Bacteria 5161
184 Ga0105239_10154156 3300010375 Bacteria 2565
185 Ga0105239_10242156 3300010375 Bacteria 2024
186 Ga0105239_10262439 3300010375 Bacteria 1941
187 Ga0105239_10403191 3300010375 Bacteria 1548
188 Ga0105239_10704963 3300010375 Bacteria 1154
189 Ga0105239_10734968 3300010375 Unclassified 1129
190 Ga0105246_10158518 3300011119 Bacteria 1722
191 Ga0105246_10170019 3300011119 Bacteria 1668
192 Ga0157373_10249959 3300013100 Unclassified 1254
193 Ga0157373_10251314 3300013100 Unclassified 1250
194 Ga0157371_10054199 3300013102 Bacteria 2848
195 Ga0157371_10249364 3300013102 Unclassified 1278
196 Ga0157370_10030360 3300013104 Bacteria 5296
197 Ga0157370_10050837 3300013104 Bacteria 3960
198 Ga0157370_10071875 3300013104 Unclassified 3264
199 Ga0157370_10078802 3300013104 Unclassified 3102
200 Ga0157370_10263731 3300013104 Bacteria 1592
201 Ga0157369_10003819 3300013105 Bacteria 17897
202 Ga0157369_10010057 3300013105 Bacteria 10801
203 Ga0157369_10025285 3300013105 Bacteria 6592
204 Ga0157369_10068313 3300013105 Bacteria 3818
205 Ga0157369_10077474 3300013105 Unclassified 3563
206 Ga0157369_10104792 3300013105 Bacteria 3011
207 Ga0157369_10193901 3300013105 Bacteria 2134
208 Ga0157369_10227386 3300013105 Unclassified 1951
209 Ga0157369_10248687 3300013105 Bacteria 1856
210 Ga0157369_10410370 3300013105 Unclassified 1405
211 Ga0157369_10503294 3300013105 Bacteria 1253
212 Ga0157374_10003283 3300013296 Bacteria 13586
213 Ga0157374_10007242 3300013296 Bacteria 9453
214 Ga0157374_10021637 3300013296 Bacteria 5726
215 Ga0157374_10032303 3300013296 Bacteria 4764
216 Ga0157374_10035024 3300013296 Bacteria 4591
217 Ga0157374_10179241 3300013296 Bacteria 2069
218 Ga0157378_10016931 3300013297 Bacteria 6390
219 Ga0157378_10065088 3300013297 Bacteria 3262
220 Ga0157378_10131003 3300013297 Bacteria 2321
221 Ga0157378_10279212 3300013297 Unclassified 1609
222 Ga0157378_10290258 3300013297 Bacteria 1580
223 Ga0163162_10006750 3300013306 Bacteria 11137
224 Ga0163162_10058713 3300013306 Bacteria 3877
225 Ga0163162_10251945 3300013306 Unclassified 1897
226 Ga0157372_10012096 3300013307 Bacteria 9192
227 Ga0157372_10019755 3300013307 Bacteria 7261
228 Ga0157372_10025965 3300013307 Bacteria 6371
229 Ga0157372_10091926 3300013307 Unclassified 3451
230 Ga0157372_10099974 3300013307 Bacteria 3309
231 Ga0157372_10125754 3300013307 Unclassified 2948
232 Ga0157372_10137323 3300013307 Bacteria 2816
233 Ga0157372_10295501 3300013307 Bacteria 1884
234 Ga0157372_10595132 3300013307 Bacteria 1289
235 Ga0157375_10074165 3300013308 Bacteria 3423
236 Ga0163163_10003155 3300014325 Bacteria 13965
237 Ga0163163_10010693 3300014325 Bacteria 8272
238 Ga0163163_10134452 3300014325 Bacteria 2513
239 Ga0157380_10003481 3300014326 Bacteria 10810
240 Ga0157380_10242931 3300014326 Bacteria 1625
241 Ga0157379_10626519 3300014968 Bacteria 1005
242 Ga0157376_10278545 3300014969 Unclassified 1574
243 Ga0157376_10282891 3300014969 Bacteria 1563
244 Ga0157376_10313630 3300014969 Bacteria 1489
245 Ga0157376_10501729 3300014969 Bacteria 1193
246 Ga0163161_10043331 3300017792 Bacteria 3240
247 Ga0197907_11375067 3300020069 Unclassified 2002
248 Ga0206355_1614066 3300020076 Unclassified 1572
249 Ga0206350_11349122 3300020080 Bacteria 1102
250 Ga0213873_10000753 3300021358 Bacteria 5236
251 Ga0213872_10056354 3300021361 Bacteria 1780
252 Ga0213874_10024539 3300021377 Unclassified 1692
253 Ga0213876_10005055 3300021384 Bacteria 7275
254 Ga0213876_10015893 3300021384 Unclassified 3983
255 Ga0213876_10035428 3300021384 Bacteria 2632
256 Ga0213875_10000005 3300021388 Bacteria 595146
257 Ga0213875_10000196 3300021388 Bacteria 61973
258 Ga0213875_10023873 3300021388 Bacteria 2918
259 Ga0213875_10036423 3300021388 Bacteria 2320
260 Ga0213875_10061676 3300021388 Bacteria 1754
261 Ga0213875_10083536 3300021388 Bacteria 1490
262 Ga0224712_10012106 3300022467 Unclassified 2701
263 Ga0224712_10086811 3300022467 Unclassified 1302
264 Ga0207692_10033257 3300025898 Bacteria 2486
265 Ga0207692_10243863 3300025898 Bacteria 1074
266 Ga0207680_10001088 3300025903 Bacteria 12825
267 Ga0207680_10249067 3300025903 Bacteria 1227
268 Ga0207699_10092916 3300025906 Bacteria 1897
269 Ga0207699_10106750 3300025906 Unclassified 1788
270 Ga0207645_10040033 3300025907 Bacteria 3002
271 Ga0207705_10008017 3300025909 Bacteria 7744
272 Ga0207705_10254910 3300025909 Bacteria 1338
273 Ga0207654_10120735 3300025911 Bacteria 1645
274 Ga0207654_10349637 3300025911 Unclassified 1017
275 Ga0207707_10001236 3300025912 Bacteria 23977
276 Ga0207707_10058879 3300025912 Bacteria 3343
277 Ga0207707_10111642 3300025912 Bacteria 2390
278 Ga0207707_10164735 3300025912 Bacteria 1937
279 Ga0207707_10167910 3300025912 Bacteria 1917
280 Ga0207707_10196410 3300025912 Bacteria 1760
281 Ga0207707_10201515 3300025912 Bacteria 1735
282 Ga0207695_10000804 3300025913 Bacteria 58597
283 Ga0207695_10002232 3300025913 Bacteria 29076
284 Ga0207695_10022482 3300025913 Bacteria 7156
285 Ga0207695_10067847 3300025913 Bacteria 3657
286 Ga0207695_10086722 3300025913 Bacteria 3156
287 Ga0207695_10106648 3300025913 Bacteria 2788
288 Ga0207695_10426428 3300025913 Bacteria 1210
289 Ga0207695_10540405 3300025913 Bacteria 1047
290 Ga0207671_10016353 3300025914 Bacteria 5768
291 Ga0207671_10057473 3300025914 Bacteria 2883
292 Ga0207671_10169263 3300025914 Bacteria 1696
293 Ga0207671_10172143 3300025914 Bacteria 1682
294 Ga0207671_10227370 3300025914 Bacteria 1463
295 Ga0207693_10065260 3300025915 Bacteria 2851
296 Ga0207660_10070983 3300025917 Bacteria 2533
297 Ga0207660_10151341 3300025917 Bacteria 1783
298 Ga0207660_10153124 3300025917 Unclassified 1773
299 Ga0207657_10001968 3300025919 Bacteria 22178
300 Ga0207657_10005349 3300025919 Bacteria 13448
301 Ga0207657_10046559 3300025919 Bacteria 3798
302 Ga0207657_10062686 3300025919 Bacteria 3182
303 Ga0207657_10213571 3300025919 Bacteria 1548
304 Ga0207652_10020050 3300025921 Bacteria 5506
305 Ga0207652_10040614 3300025921 Unclassified 3951
306 Ga0207652_10087987 3300025921 Unclassified 2724
307 Ga0207652_10179868 3300025921 Bacteria 1900
308 Ga0207652_10240559 3300025921 Bacteria 1632
309 Ga0207652_10296030 3300025921 Unclassified 1460
310 Ga0207694_10018555 3300025924 Bacteria 5257
311 Ga0207694_10096664 3300025924 Unclassified 2336
312 Ga0207694_10202954 3300025924 Bacteria 1613
313 Ga0207694_10393553 3300025924 Bacteria 1152
314 Ga0207687_10023862 3300025927 Bacteria 4081
315 Ga0207687_10162493 3300025927 Bacteria 1715
316 Ga0207700_10382896 3300025928 Bacteria 1230
317 Ga0207664_10031957 3300025929 Bacteria 4031
318 Ga0207664_10410534 3300025929 Bacteria 1205
319 Ga0207664_10492828 3300025929 Bacteria 1097
320 Ga0207644_10013990 3300025931 Bacteria 5363
321 Ga0207644_10150571 3300025931 Bacteria 1800
322 Ga0207690_10038790 3300025932 Bacteria 3103
323 Ga0207706_10013900 3300025933 Bacteria 7301
324 Ga0207686_10008101 3300025934 Bacteria 5667
325 Ga0207686_10161485 3300025934 Unclassified 1571
326 Ga0207704_10007360 3300025938 Bacteria 5195
327 Ga0207704_10063485 3300025938 Bacteria 2302
328 Ga0207691_10022122 3300025940 Bacteria 5999
329 Ga0207711_10019653 3300025941 Bacteria 5623
330 Ga0207711_10108729 3300025941 Bacteria 2463
331 Ga0207711_10219133 3300025941 Bacteria 1740
332 Ga0207689_10070543 3300025942 Bacteria 2870
333 Ga0207667_10000538 3300025949 Bacteria 50064
334 Ga0207667_10063419 3300025949 Bacteria 3861
335 Ga0207667_10139705 3300025949 Bacteria 2494
336 Ga0207667_10191759 3300025949 Bacteria 2097
337 Ga0207667_10229611 3300025949 Unclassified 1901
338 Ga0207667_10255582 3300025949 Bacteria 1792
339 Ga0207667_10320680 3300025949 Bacteria 1582
340 Ga0207712_10071685 3300025961 Bacteria 2492
341 Ga0207668_10160938 3300025972 Unclassified 1749
342 Ga0207668_10286702 3300025972 Bacteria 1353
343 Ga0207640_10222110 3300025981 Bacteria 1447
344 Ga0207640_10293528 3300025981 Unclassified 1283
345 Ga0207658_10011414 3300025986 Bacteria 6047
346 Ga0207703_10008427 3300026035 Bacteria 8149
347 Ga0207703_10132207 3300026035 Bacteria 2156
348 Ga0207639_10007682 3300026041 Bacteria 7361
349 Ga0207639_10059066 3300026041 Bacteria 2953
350 Ga0207678_10011788 3300026067 Bacteria 7676
351 Ga0207678_10070265 3300026067 Bacteria 3002
352 Ga0207678_10160247 3300026067 Bacteria 1922
353 Ga0207678_10163267 3300026067 Unclassified 1902
354 Ga0207678_10271609 3300026067 Unclassified 1454
355 Ga0207708_10017410 3300026075 Bacteria 5409
356 Ga0207702_10009509 3300026078 Bacteria 8163
357 Ga0207702_10015971 3300026078 Bacteria 6216
358 Ga0207702_10070862 3300026078 Bacteria 2999
359 Ga0207702_10260818 3300026078 Bacteria 1632
360 Ga0207702_10691157 3300026078 Unclassified 1005
361 Ga0207641_10091642 3300026088 Bacteria 2660
362 Ga0207641_10120951 3300026088 Bacteria 2336
363 Ga0207641_10442840 3300026088 Unclassified 1254
364 Ga0207676_10050087 3300026095 Bacteria 3254
365 Ga0207674_10018058 3300026116 Bacteria 7683
366 Ga0207674_10067730 3300026116 Unclassified 3593
367 Ga0207674_10302869 3300026116 Unclassified 1547
368 Ga0207675_100032063 3300026118 Bacteria 4894
369 Ga0207675_100211392 3300026118 Bacteria 1866
370 Ga0207683_10011081 3300026121 Bacteria 7683
371 Ga0207683_10288002 3300026121 Bacteria 1502
372 Ga0207698_10008297 3300026142 Bacteria 6560
373 Ga0207698_10030565 3300026142 Unclassified 3875
374 Ga0207698_10268189 3300026142 Bacteria 1572
375 Ga0207698_10748353 3300026142 Unclassified 976
376 Ga0207428_10130154 3300027907 Unclassified 1926
377 Ga0268266_10001822 3300028379 Bacteria 24095
378 Ga0268266_10003502 3300028379 Bacteria 15605
379 Ga0268266_10010748 3300028379 Bacteria 7975
380 Ga0268266_10069552 3300028379 Bacteria 3050
381 Ga0268266_10164593 3300028379 Unclassified 2008
382 Ga0268266_10215581 3300028379 Bacteria 1762
383 Ga0268264_10009485 3300028381 Bacteria 8060
384 Ga0268264_10074739 3300028381 Bacteria 2879
385 Ga0268264_10263615 3300028381 Bacteria 1606
386 Ga0265334_10092040 3300028573 Bacteria 1105
387 Ga0265338_10021009 3300028800 Bacteria 6829
388 Ga0265338_10048667 3300028800 Bacteria 3854
389 Ga0265338_10090924 3300028800 Bacteria 2524
390 Ga0265338_10194351 3300028800 Unclassified 1535
391 Ga0265338_10211551 3300028800 Bacteria 1455
392 Ga0265760_10009076 3300031090 Bacteria 2841
393 Ga0265330_10001094 3300031235 Bacteria 16318
394 Ga0265325_10071797 3300031241 Unclassified 1736
395 Ga0265339_10005264 3300031249 Bacteria 8631
396 Ga0265339_10049523 3300031249 Bacteria 2300
397 Ga0265339_10110992 3300031249 Bacteria 1419
398 Ga0265316_10014579 3300031344 Bacteria 6911
399 Ga0265316_10017922 3300031344 Bacteria 6104
400 Ga0265313_10017403 3300031595 Unclassified 4087
401 Ga0265314_10000261 3300031711 Bacteria 77506
402 Ga0265314_10002439 3300031711 Bacteria 19051
403 Ga0265342_10004473 3300031712 Bacteria 10988
404 Ga0307412_10175260 3300031911 Bacteria 1607
405 Ga0307416_100584046 3300032002 Bacteria 1195
406 Ga0307510_10017003 3300033180 Bacteria 8581
407 Ga0307510_10156041 3300033180 Unclassified 1889
408 Ga0373943_0232299 3300035170 Bacteria 1031
409 Ga0373935_0331489 3300035692 Unclassified 1082
410 Ga0373927_0002154 3300035695 Bacteria 14469
411 Ga0373927_0002368 3300035695 Bacteria 13732
412 Ga0373927_0009413 3300035695 Bacteria 6549
413 Ga0373933_0200042 3300035724 Bacteria 1278
414 Ga0373947_0007434 3300035725 Bacteria 6344
415 Ga0373937_0012045 3300036401 Bacteria 7589
416 Ga0373925_0027370 3300037068 Unclassified 4173
417 Ga0373925_0049320 3300037068 Unclassified 3138
418 Ga0395900_0070767 3300037418 Bacteria 3586
419 Ga0395900_0382929 3300037418 Unclassified 1374
420 Ga0395900_0409391 3300037418 Bacteria 1319
421 Ga0395898_0066377 3300037466 Bacteria 3496
422 Ga0436364_0032202 3300037853 Unclassified 1116
423 Ga0436364_0068230 3300037853 Unclassified 1038
424 Ga0436364_0080170 3300037853 Bacteria 70161
425 Ga0436364_0260875 3300037853 Bacteria 1837
426 Ga0436364_0278774 3300037853 Bacteria 400541
427 Ga0436364_0310874 3300037853 Bacteria 18169
428 Ga0436364_0376502 3300037853 Bacteria 5619
429 Ga0436364_0630365 3300037853 Bacteria 4977
430 Ga0436364_0718428 3300037853 Bacteria 8650
431 Ga0436364_0733005 3300037853 Unclassified 1370
432 Ga0436364_0753292 3300037853 Bacteria 13640
433 Ga0436364_1150628 3300037853 Bacteria 5754
434 Ga0436364_1419803 3300037853 Bacteria 9396
435 Ga0436364_1470570 3300037853 Bacteria 1287
436 Ga0436364_1551588 3300037853 Unclassified 1615
437 Ga0436365_0463178 3300039437 Bacteria 1151
438 Ga0436365_0531012 3300039437 Bacteria 5689
439 Ga0436365_0955181 3300039437 Unclassified 3498
440 Ga0436365_1005832 3300039437 Bacteria 8439
441 Ga0436365_1330341 3300039437 Bacteria 32804
442 Ga0436365_1374761 3300039437 Unclassified 1541
443 Ga0436365_1475398 3300039437 Bacteria 1721
444 Ga0436365_1701082 3300039437 Bacteria 6957
445 Ga0436360_0246149 3300039438 Unclassified 3352
446 Ga0436361_0468997 3300039447 Bacteria 3886
447 Ga0436361_0567168 3300039447 Bacteria 164343
448 Ga0436361_0671658 3300039447 Bacteria 3037
449 Ga0436363_1408881 3300039450 Bacteria 10747
450 Ga0436363_1631220 3300039450 Bacteria 5551
451 Ga0436362_0480869 3300039453 Bacteria 1250
452 Ga0436362_0582991 3300039453 Bacteria 2379
453 Ga0436362_0693803 3300039453 Bacteria 6331
454 Ga0436362_1282706 3300039453 Bacteria 4860
455 Ga0466969_0168779 3300044656 Unclassified 1004
456 Ga0466966_0035991 3300044684 Bacteria 3198
457 Ga0466966_0157362 3300044684 Bacteria 1384
458 Ga0466963_0108503 3300044694 Unclassified 1904
459 Ga0466963_0144498 3300044694 Bacteria 1650
460 Ga0466957_0190714 3300044842 Bacteria 1343
461 Ga0466959_0358181 3300045049 Unclassified 994
462 Ga0466958_0156472 3300045836 Bacteria 1439
463 Ga0466958_0285692 3300045836 Bacteria 1058
464 Ga0495580_0052559 3300046472 Unclassified 2877
465 Ga0495580_0120351 3300046472 Unclassified 1823
466 Ga0495582_0005880 3300046473 Bacteria 6836
467 Ga0495582_0092786 3300046473 Bacteria 1685
468 Ga0495662_0013059 3300046476 Bacteria 4046
469 Ga0495664_0013075 3300046477 Bacteria 4706
470 Ga0495594_0000369 3300046499 Bacteria 22598
471 Ga0495594_0004624 3300046499 Bacteria 7090
472 Ga0495594_0180376 3300046499 Bacteria 1202
473 Ga0495583_0021321 3300046506 Bacteria 3337
474 Ga0495583_0049871 3300046506 Unclassified 1915
475 Ga0495606_0026970 3300046507 Bacteria 4081
476 Ga0495628_0203099 3300046516 Bacteria 1492
477 Ga0495630_0152282 3300046517 Bacteria 1760
478 Ga0495631_0173971 3300046518 Unclassified 923
479 Ga0495644_0000023 3300046523 Bacteria 79095
480 Ga0495648_0113351 3300046524 Unclassified 1470
481 Ga0495666_0006772 3300046526 Bacteria 5758
482 Ga0495642_0010152 3300046528 Bacteria 3607
483 Ga0495652_0006361 3300046529 Bacteria 10998
484 Ga0495665_0101134 3300046531 Unclassified 1513
485 Ga0495665_0245559 3300046531 Bacteria 922
486 Ga0495665_0350252 3300046531 Bacteria 752
487 Ga0495640_0052530 3300046533 Bacteria 2798
488 Ga0495586_0032907 3300046535 Bacteria 2781
489 Ga0495609_0005042 3300046538 Bacteria 7060
490 Ga0495667_0007248 3300046559 Bacteria 7526
491 Ga0495668_0167913 3300046616 Unclassified 1202
492 Ga0495634_0046425 3300046642 Unclassified 2931
493 Ga0495625_0000796 3300046660 Bacteria 43709
494 Ga0495625_0123758 3300046660 Bacteria 1757
495 Ga0495635_0015069 3300046663 Bacteria 5407
496 Ga0495659_0022869 3300046664 Bacteria 2119
497 Ga0495657_0116627 3300046675 Bacteria 1686
498 Ga0495646_0188731 3300046680 Bacteria 1127
499 Ga0495669_0006062 3300046684 Bacteria 5047
500 Ga0495613_0023005 3300046689 Bacteria 4644
501 Ga0495613_0040073 3300046689 Bacteria 3471
502 Ga0495624_0156772 3300046690 Bacteria 1391
503 Ga0495649_0019338 3300046694 Bacteria 3828
504 Ga0495649_0100446 3300046694 Bacteria 1538
505 Ga0495649_0134880 3300046694 Unclassified 1302
506 Ga0495600_0018704 3300046809 Bacteria 4418
507 Ga0495581_0003369 3300047315 Bacteria 9179
508 Ga0495581_0269157 3300047315 Bacteria 996
509 Ga0495581_0328623 3300047315 Unclassified 893
510 Ga0495604_0098545 3300047317 Unclassified 2153
511 Ga0495604_0270831 3300047317 Bacteria 1150
512 Ga0495674_0296787 3300047319 Bacteria 1320
513 Ga0495674_0567882 3300047319 Bacteria 901
514 Ga0495672_0001628 3300047320 Bacteria 21845
515 Ga0495672_0169286 3300047320 Unclassified 1116
516 Ga0495676_0035083 3300047321 Bacteria 4198
517 Ga0495675_0003532 3300047444 Bacteria 9421
518 Ga0495677_0003312 3300047445 Bacteria 6270
519 Ga0495673_0090525 3300047469 Bacteria 1251
520 Ga0495684_0266274 3300047471 Unclassified 1241
521 Ga0495686_0000030 3300047472 Bacteria 365121
522 Ga0495614_0005209 3300048089 Bacteria 5864
523 Ga0495614_0089596 3300048089 Unclassified 1338
524 Ga0495614_0103287 3300048089 Bacteria 1247
525 Ga0496104_0000673 3300048907 Bacteria 29343
526 Ga0496112_0037929 3300048915 Bacteria 4706
527 Ga0496115_0013551 3300048918 Bacteria 6168
528 Ga0496115_0237880 3300048918 Bacteria 1501
529 Ga0496126_0000024 3300048929 Bacteria 462877
530 Ga0496126_0000820 3300048929 Bacteria 55350
531 Ga0496126_0078426 3300048929 Unclassified 2927
532 Ga0496126_0424626 3300048929 Bacteria 1074
533 Ga0501032_0007424 3300049569 Bacteria 8009
534 Ga0501032_0011478 3300049569 Bacteria 6364
535 Ga0501032_0177519 3300049569 Bacteria 1395
536 Ga0501033_0000876 3300049570 Bacteria 27523
537 Ga0501033_0144835 3300049570 Unclassified 1716
538 Ga0501034_0005794 3300049571 Bacteria 13439
539 Ga0501034_0247055 3300049571 Bacteria 1729
540 Ga0501036_0003020 3300049572 Bacteria 13394
541 Ga0501036_0011178 3300049572 Bacteria 7428
542 Ga0501036_0121499 3300049572 Bacteria 2206
543 Ga0501036_0237575 3300049572 Bacteria 1529
544 Ga0501037_0183518 3300049573 Bacteria 1484
545 Ga0501038_0003247 3300049574 Bacteria 15159
546 Ga0501038_0068831 3300049574 Unclassified 3008
547 Ga0501038_0310120 3300049574 Unclassified 1237
548 Ga0501039_0001248 3300049575 Bacteria 18575
549 Ga0501039_0237840 3300049575 Bacteria 1432
550 Ga0501040_0258461 3300049576 Bacteria 1243
551 Ga0501042_0107469 3300049578 Unclassified 2009
552 Ga0501043_0010410 3300049579 Bacteria 7287
553 Ga0501043_0015859 3300049579 Bacteria 5906
554 Ga0501043_0051263 3300049579 Bacteria 3242
555 Ga0501046_0000265 3300049580 Bacteria 53355
556 Ga0501046_0001882 3300049580 Bacteria 19958
557 Ga0501046_0018775 3300049580 Bacteria 5746
558 Ga0501047_0003679 3300049581 Bacteria 14454
559 Ga0501047_0006951 3300049581 Bacteria 10631
560 Ga0501047_0014170 3300049581 Bacteria 7576
561 Ga0501047_0073674 3300049581 Unclassified 3288
562 Ga0501048_0022987 3300049582 Unclassified 4557
563 Ga0501048_0208340 3300049582 Bacteria 1387
564 Ga0501068_0028802 3300049584 Bacteria 3286
565 Ga0501070_0033458 3300049586 Unclassified 4301
566 Ga0501070_0039615 3300049586 Unclassified 3930
567 Ga0501070_0055212 3300049586 Bacteria 3292
568 Ga0501072_0040654 3300049588 Bacteria 3652
569 Ga0501072_0099967 3300049588 Unclassified 2305
570 Ga0501073_0005637 3300049589 Bacteria 9369
571 Ga0501073_0067085 3300049589 Bacteria 2501
572 Ga0501073_0264137 3300049589 Unclassified 1188
573 Ga0501074_0100470 3300049590 Unclassified 2070
574 Ga0501075_0042987 3300049591 Bacteria 3389
575 Ga0501075_0144984 3300049591 Bacteria 1810
576 Ga0501076_0225501 3300049592 Bacteria 1531
577 Ga0501077_0027235 3300049593 Unclassified 3629
578 Ga0501079_0000098 3300049741 Bacteria 43658
579 Ga0501079_0551791 3300049741 Unclassified 906
580 Ga0501080_0001904 3300049742 Bacteria 17982
581 Ga0501080_0033703 3300049742 Bacteria 4781
582 Ga0501035_0002898 3300049822 Bacteria 16521
583 Ga0501035_0031116 3300049822 Unclassified 4860
584 Ga0501035_0051920 3300049822 Bacteria 3669
585 Ga0501035_0055431 3300049822 Bacteria 3539
586 Ga0501035_0072637 3300049822 Bacteria 3045
587 Ga0501035_0155099 3300049822 Unclassified 1985
588 Ga0501044_0002699 3300049823 Bacteria 20171
589 Ga0501044_0003102 3300049823 Bacteria 18821
590 Ga0501044_0003333 3300049823 Bacteria 18107
591 Ga0501044_0005795 3300049823 Bacteria 13681
592 Ga0501044_0006355 3300049823 Bacteria 13062
593 Ga0501044_0145800 3300049823 Bacteria 2353
594 Ga0501044_0181597 3300049823 Unclassified 2070
595 Ga0501044_0348297 3300049823 Unclassified 1401
596 nmdc:mga08y16_331743_c1 3300050511 Unclassified 1565
597 nmdc:mga0rr50_408819_c1 3300050513 Bacteria 1147
598 nmdc:mga0rr50_529404_c1 3300050513 Unclassified 1003
599 nmdc:mga08x19_2741_c1 3300050514 Bacteria 10641
600 nmdc:mga08x19_8813_c1 3300050514 Bacteria 6019
601 Ga0500595_000025 3300053119 Bacteria 142073
602 Ga0500595_005243 3300053119 Bacteria 5681
603 Ga0501084_0002112 3300054114 Bacteria 15883
604 Ga0501082_0162237 3300060353 Unclassified 1942

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046531 Ga0495665_0245559 Ga0495665_0245559_204_878 217
2 3300046531 Ga0495665_0350252 Ga0495665_0350252_37_711 217
3 3300047315 Ga0495581_0328623 Ga0495581_0328623_47_721 217
4 3300049581 Ga0501047_0073674 Ga0501047_0073674_1443_2300 238
5 3300049586 Ga0501070_0039615 Ga0501070_0039615_357_1214 238
6 3300049822 Ga0501035_0155099 Ga0501035_0155099_668_1525 238
7 3300049823 Ga0501044_0003102 Ga0501044_0003102_16131_16988 238
8 3300049823 Ga0501044_0003333 Ga0501044_0003333_4416_5273 238
9 3300006871 Ga0075434_100437062 Ga0075434_1004370622 241
10 3300013105 Ga0157369_10503294 Ga0157369_105032942 246
11 3300027907 Ga0207428_10130154 Ga0207428_101301542 248
12 3300021358 Ga0213873_10000753 Ga0213873_100007537 252
13 3300021384 Ga0213876_10015893 Ga0213876_100158933 252
14 3300039437 Ga0436365_1701082 Ga0436365_1701082_1765_2658 252
15 3300039453 Ga0436362_0693803 Ga0436362_0693803_4268_5161 252
16 3300009093 Ga0105240_10002300 Ga0105240_1000230011 253
17 3300009545 Ga0105237_10007159 Ga0105237_100071595 253
18 3300049741 Ga0501079_0551791 Ga0501079_0551791_78_866 253
19 3300005455 Ga0070663_100291367 Ga0070663_1002913672 254
20 3300009093 Ga0105240_10001940 Ga0105240_100019405 254
21 3300009545 Ga0105237_10005232 Ga0105237_100052325 254
22 3300022467 Ga0224712_10012106 Ga0224712_100121062 254
23 3300025913 Ga0207695_10106648 Ga0207695_101066483 254
24 3300025921 Ga0207652_10296030 Ga0207652_102960302 254
25 3300026067 Ga0207678_10271609 Ga0207678_102716092 254
26 3300026116 Ga0207674_10302869 Ga0207674_103028692 254
27 3300037418 Ga0395900_0070767 Ga0395900_0070767_1700_2515 254
28 3300049571 Ga0501034_0247055 Ga0501034_0247055_403_1317 254
29 3300049572 Ga0501036_0121499 Ga0501036_0121499_794_1708 254
30 3300049574 Ga0501038_0310120 Ga0501038_0310120_223_1137 254
31 3300049579 Ga0501043_0015859 Ga0501043_0015859_3124_4038 254
32 3300049581 Ga0501047_0006951 Ga0501047_0006951_7480_8394 254
33 3300049586 Ga0501070_0055212 Ga0501070_0055212_1901_2815 254
34 3300049589 Ga0501073_0264137 Ga0501073_0264137_242_1156 254
35 3300049822 Ga0501035_0051920 Ga0501035_0051920_623_1537 254
36 3300049823 Ga0501044_0348297 Ga0501044_0348297_317_1231 254
37 3300009545 Ga0105237_10024235 Ga0105237_100242352 255
38 3300005434 Ga0070709_10056950 Ga0070709_100569502 256
39 3300005435 Ga0070714_100000338 Ga0070714_10000033820 256
40 3300005437 Ga0070710_10280974 Ga0070710_102809741 256
41 3300005937 Ga0081455_10021250 Ga0081455_100212504 256
42 3300006028 Ga0070717_10189470 Ga0070717_101894702 256
43 3300025898 Ga0207692_10243863 Ga0207692_102438631 256
44 3300025906 Ga0207699_10092916 Ga0207699_100929162 256
45 3300025915 Ga0207693_10065260 Ga0207693_100652603 256
46 3300025928 Ga0207700_10382896 Ga0207700_103828962 256
47 3300025929 Ga0207664_10031957 Ga0207664_100319573 256
48 3300026067 Ga0207678_10160247 Ga0207678_101602471 256
49 3300035170 Ga0373943_0232299 Ga0373943_0232299_112_900 256
50 3300035724 Ga0373933_0200042 Ga0373933_0200042_419_1207 256
51 3300036401 Ga0373937_0012045 Ga0373937_0012045_3832_4620 256
52 3300037418 Ga0395900_0409391 Ga0395900_0409391_286_1206 256
53 3300037853 Ga0436364_1470570 Ga0436364_1470570_11_874 256
54 3300049580 Ga0501046_0018775 Ga0501046_0018775_1770_2690 256
55 3300049742 Ga0501080_0033703 Ga0501080_0033703_535_1455 256
56 3300005548 Ga0070665_100060487 Ga0070665_1000604872 257
57 3300009551 Ga0105238_10133131 Ga0105238_101331312 257
58 3300010375 Ga0105239_10242156 Ga0105239_102421561 257
59 3300049569 Ga0501032_0007424 Ga0501032_0007424_6020_6832 257
60 3300049570 Ga0501033_0144835 Ga0501033_0144835_404_1216 257
61 3300049571 Ga0501034_0005794 Ga0501034_0005794_3131_3943 257
62 3300049572 Ga0501036_0003020 Ga0501036_0003020_1254_2066 257
63 3300049574 Ga0501038_0068831 Ga0501038_0068831_404_1216 257
64 3300049575 Ga0501039_0001248 Ga0501039_0001248_2343_3155 257
65 3300049578 Ga0501042_0107469 Ga0501042_0107469_581_1393 257
66 3300049579 Ga0501043_0051263 Ga0501043_0051263_2325_3137 257
67 3300049580 Ga0501046_0001882 Ga0501046_0001882_7393_8205 257
68 3300049582 Ga0501048_0022987 Ga0501048_0022987_2135_2947 257
69 3300049584 Ga0501068_0028802 Ga0501068_0028802_2347_3159 257
70 3300049586 Ga0501070_0033458 Ga0501070_0033458_2413_3225 257
71 3300049588 Ga0501072_0099967 Ga0501072_0099967_1090_1902 257
72 3300049589 Ga0501073_0005637 Ga0501073_0005637_5879_6691 257
73 3300049590 Ga0501074_0100470 Ga0501074_0100470_855_1667 257
74 3300049592 Ga0501076_0225501 Ga0501076_0225501_138_950 257
75 3300049593 Ga0501077_0027235 Ga0501077_0027235_1720_2532 257
76 3300049741 Ga0501079_0000098 Ga0501079_0000098_12804_13616 257
77 3300049742 Ga0501080_0001904 Ga0501080_0001904_7876_8688 257
78 3300049822 Ga0501035_0031116 Ga0501035_0031116_918_1730 257
79 3300049823 Ga0501044_0181597 Ga0501044_0181597_404_1216 257
80 3300054114 Ga0501084_0002112 Ga0501084_0002112_8003_8815 257
81 3300060353 Ga0501082_0162237 Ga0501082_0162237_727_1539 257
82 3300006028 Ga0070717_10005887 Ga0070717_100058875 258
83 3300007265 Ga0099794_10261954 Ga0099794_102619541 258
84 3300005437 Ga0070710_10114669 Ga0070710_101146692 259
85 3300035692 Ga0373935_0331489 Ga0373935_0331489_44_850 259
86 3300035725 Ga0373947_0007434 Ga0373947_0007434_1476_2282 259
87 3300037068 Ga0373925_0049320 Ga0373925_0049320_340_1146 259
88 3300049822 Ga0501035_0072637 Ga0501035_0072637_88_873 259
89 3300005339 Ga0070660_100015575 Ga0070660_1000155753 260
90 3300005366 Ga0070659_100023438 Ga0070659_1000234384 260
91 3300005563 Ga0068855_100078424 Ga0068855_1000784244 260
92 3300005563 Ga0068855_100215309 Ga0068855_1002153093 260
93 3300005564 Ga0070664_100122596 Ga0070664_1001225964 260
94 3300005614 Ga0068856_100019095 Ga0068856_1000190954 260
95 3300005614 Ga0068856_100320192 Ga0068856_1003201923 260
96 3300010375 Ga0105239_10704963 Ga0105239_107049631 260
97 3300013100 Ga0157373_10251314 Ga0157373_102513142 260
98 3300013105 Ga0157369_10003819 Ga0157369_100038197 260
99 3300013105 Ga0157369_10025285 Ga0157369_100252855 260
100 3300013296 Ga0157374_10007242 Ga0157374_100072425 260
101 3300013307 Ga0157372_10025965 Ga0157372_100259651 260
102 3300013307 Ga0157372_10137323 Ga0157372_101373234 260
103 3300025919 Ga0207657_10062686 Ga0207657_100626862 260
104 3300025949 Ga0207667_10063419 Ga0207667_100634192 260
105 3300025949 Ga0207667_10191759 Ga0207667_101917593 260
106 3300026067 Ga0207678_10011788 Ga0207678_100117882 260
107 3300026078 Ga0207702_10009509 Ga0207702_100095094 260
108 3300026078 Ga0207702_10260818 Ga0207702_102608182 260
109 3300048918 Ga0496115_0013551 Ga0496115_0013551_2009_2863 260
110 3300005435 Ga0070714_100444930 Ga0070714_1004449302 261
111 3300021384 Ga0213876_10035428 Ga0213876_100354282 261
112 3300021388 Ga0213875_10061676 Ga0213875_100616761 261
113 3300037853 Ga0436364_0260875 Ga0436364_0260875_341_1222 261
114 3300037853 Ga0436364_0733005 Ga0436364_0733005_183_1061 261
115 3300037853 Ga0436364_0753292 Ga0436364_0753292_9035_10006 261
116 3300039437 Ga0436365_0531012 Ga0436365_0531012_3289_4167 261
117 3300039450 Ga0436363_1631220 Ga0436363_1631220_3948_4826 261
118 3300039453 Ga0436362_0480869 Ga0436362_0480869_198_1079 261
119 3300039453 Ga0436362_0582991 Ga0436362_0582991_215_1093 261
120 3300044684 Ga0466966_0035991 Ga0466966_0035991_196_1062 261
121 3300044694 Ga0466963_0108503 Ga0466963_0108503_516_1394 261
122 3300045836 Ga0466958_0285692 Ga0466958_0285692_20_973 261
123 3300005334 Ga0068869_100060918 Ga0068869_1000609182 262
124 3300005336 Ga0070680_100465250 Ga0070680_1004652501 262
125 3300005345 Ga0070692_10053668 Ga0070692_100536682 262
126 3300005406 Ga0070703_10076787 Ga0070703_100767872 262
127 3300005438 Ga0070701_10000981 Ga0070701_100009812 262
128 3300005546 Ga0070696_100359340 Ga0070696_1003593401 262
129 3300005549 Ga0070704_100074410 Ga0070704_1000744102 262
130 3300005617 Ga0068859_100041054 Ga0068859_1000410542 262
131 3300006931 Ga0097620_100041054 Ga0097620_1000410543 262
132 3300009553 Ga0105249_10202080 Ga0105249_102020802 262
133 3300014326 Ga0157380_10003481 Ga0157380_100034812 262
134 3300025917 Ga0207660_10151341 Ga0207660_101513412 262
135 3300025942 Ga0207689_10070543 Ga0207689_100705432 262
136 3300025961 Ga0207712_10071685 Ga0207712_100716852 262
137 3300026075 Ga0207708_10017410 Ga0207708_100174103 262
138 3300026118 Ga0207675_100032063 Ga0207675_1000320633 262
139 3300031911 Ga0307412_10175260 Ga0307412_101752601 262
140 3300032002 Ga0307416_100584046 Ga0307416_1005840462 262
141 3300035695 Ga0373927_0009413 Ga0373927_0009413_1460_2275 262
142 3300037068 Ga0373925_0027370 Ga0373925_0027370_1780_2595 262
143 3300039437 Ga0436365_0955181 Ga0436365_0955181_269_1075 262
144 3300049572 Ga0501036_0237575 Ga0501036_0237575_473_1315 262
145 3300049576 Ga0501040_0258461 Ga0501040_0258461_20_865 262
146 3300049591 Ga0501075_0144984 Ga0501075_0144984_817_1668 262
147 3300005467 Ga0070706_100082040 Ga0070706_1000820404 263
148 3300006844 Ga0075428_100372349 Ga0075428_1003723491 263
149 3300006846 Ga0075430_100027318 Ga0075430_1000273183 263
150 3300009093 Ga0105240_10002071 Ga0105240_100020716 263
151 3300009094 Ga0111539_10266039 Ga0111539_102660392 263
152 3300009545 Ga0105237_10001515 Ga0105237_100015154 263
153 3300013104 Ga0157370_10071875 Ga0157370_100718754 263
154 3300014326 Ga0157380_10242931 Ga0157380_102429312 263
155 3300025913 Ga0207695_10022482 Ga0207695_100224827 263
156 3300025914 Ga0207671_10057473 Ga0207671_100574733 263
157 3300026118 Ga0207675_100211392 Ga0207675_1002113922 263
158 3300039437 Ga0436365_1374761 Ga0436365_1374761_510_1325 263
159 3300039437 Ga0436365_1475398 Ga0436365_1475398_682_1521 263
160 3300047471 Ga0495684_0266274 Ga0495684_0266274_176_997 263
161 3300049582 Ga0501048_0208340 Ga0501048_0208340_355_1191 263
162 3300049588 Ga0501072_0040654 Ga0501072_0040654_1915_2751 263
163 3300049591 Ga0501075_0042987 Ga0501075_0042987_1075_1911 263
164 3300050511 nmdc:mga08y16_331743_c1 nmdc:mga08y16_331743_c1_182_1024 263
165 3300005467 Ga0070706_100208419 Ga0070706_1002084191 264
166 3300005536 Ga0070697_100539159 Ga0070697_1005391591 264
167 3300006914 Ga0075436_100000108 Ga0075436_10000010833 264
168 3300025912 Ga0207707_10111642 Ga0207707_101116423 264
169 3300035695 Ga0373927_0002368 Ga0373927_0002368_4590_5417 264
170 3300039437 Ga0436365_0463178 Ga0436365_0463178_62_889 264
171 3300046531 Ga0495665_0101134 Ga0495665_0101134_590_1429 264
172 3300050513 nmdc:mga0rr50_408819_c1 nmdc:mga0rr50_408819_c1_38_865 264
173 3300050514 nmdc:mga08x19_2741_c1 nmdc:mga08x19_2741_c1_3550_4377 264
174 3300039447 Ga0436361_0468997 Ga0436361_0468997_1205_2002 265
175 3300005355 Ga0070671_100061186 Ga0070671_1000611861 266
176 3300005367 Ga0070667_100281147 Ga0070667_1002811472 266
177 3300005456 Ga0070678_100174669 Ga0070678_1001746692 266
178 3300005548 Ga0070665_100378122 Ga0070665_1003781222 266
179 3300005618 Ga0068864_100015618 Ga0068864_1000156182 266
180 3300005841 Ga0068863_100015286 Ga0068863_1000152863 266
181 3300009101 Ga0105247_10144793 Ga0105247_101447931 266
182 3300009177 Ga0105248_10251417 Ga0105248_102514172 266
183 3300010375 Ga0105239_10403191 Ga0105239_104031912 266
184 3300013296 Ga0157374_10021637 Ga0157374_100216374 266
185 3300013306 Ga0163162_10058713 Ga0163162_100587134 266
186 3300014325 Ga0163163_10134452 Ga0163163_101344522 266
187 3300014968 Ga0157379_10626519 Ga0157379_106265191 266
188 3300014969 Ga0157376_10313630 Ga0157376_103136302 266
189 3300025913 Ga0207695_10002232 Ga0207695_100022327 266
190 3300025914 Ga0207671_10016353 Ga0207671_100163532 266
191 3300025931 Ga0207644_10013990 Ga0207644_100139904 266
192 3300026121 Ga0207683_10288002 Ga0207683_102880022 266
193 3300028379 Ga0268266_10069552 Ga0268266_100695523 266
194 3300045836 Ga0466958_0156472 Ga0466958_0156472_428_1261 266
195 3300046507 Ga0495606_0026970 Ga0495606_0026970_2534_3340 266
196 3300046528 Ga0495642_0010152 Ga0495642_0010152_1090_1896 266
197 3300046538 Ga0495609_0005042 Ga0495609_0005042_1381_2187 266
198 3300046664 Ga0495659_0022869 Ga0495659_0022869_246_1052 266
199 3300048089 Ga0495614_0005209 Ga0495614_0005209_1158_1964 266
200 3300005535 Ga0070684_100325646 Ga0070684_1003256462 267
201 3300009176 Ga0105242_10277150 Ga0105242_102771502 267
202 3300025934 Ga0207686_10161485 Ga0207686_101614852 267
203 3300037853 Ga0436364_0376502 Ga0436364_0376502_3994_4815 267
204 3300046690 Ga0495624_0156772 Ga0495624_0156772_14_823 267
205 3300048089 Ga0495614_0089596 Ga0495614_0089596_483_1319 267
206 3300005335 Ga0070666_10000867 Ga0070666_100008678 268
207 3300005338 Ga0068868_100093551 Ga0068868_1000935513 268
208 3300005356 Ga0070674_100334430 Ga0070674_1003344302 268
209 3300005367 Ga0070667_100018244 Ga0070667_1000182444 268
210 3300005458 Ga0070681_10012721 Ga0070681_100127211 268
211 3300005459 Ga0068867_100018673 Ga0068867_1000186733 268
212 3300005530 Ga0070679_100483413 Ga0070679_1004834132 268
213 3300005535 Ga0070684_100160391 Ga0070684_1001603911 268
214 3300005548 Ga0070665_100069541 Ga0070665_1000695412 268
215 3300005563 Ga0068855_100082093 Ga0068855_1000820932 268
216 3300005577 Ga0068857_100038628 Ga0068857_1000386282 268
217 3300005617 Ga0068859_100017005 Ga0068859_1000170054 268
218 3300005618 Ga0068864_100466696 Ga0068864_1004666961 268
219 3300005841 Ga0068863_100259769 Ga0068863_1002597692 268
220 3300005841 Ga0068863_100303582 Ga0068863_1003035821 268
221 3300005842 Ga0068858_100007380 Ga0068858_1000073802 268
222 3300005843 Ga0068860_100011760 Ga0068860_1000117607 268
223 3300005843 Ga0068860_100616289 Ga0068860_1006162891 268
224 3300006237 Ga0097621_100002398 Ga0097621_1000023987 268
225 3300006237 Ga0097621_100017321 Ga0097621_1000173214 268
226 3300006358 Ga0068871_100040114 Ga0068871_1000401144 268
227 3300006358 Ga0068871_100048999 Ga0068871_1000489993 268
228 3300006881 Ga0068865_100010826 Ga0068865_1000108264 268
229 3300006931 Ga0097620_100017005 Ga0097620_1000170054 268
230 3300009093 Ga0105240_10008037 Ga0105240_100080373 268
231 3300009093 Ga0105240_10305603 Ga0105240_103056032 268
232 3300009098 Ga0105245_10013658 Ga0105245_100136583 268
233 3300009098 Ga0105245_10050570 Ga0105245_100505702 268
234 3300009098 Ga0105245_10320077 Ga0105245_103200772 268
235 3300009176 Ga0105242_10150562 Ga0105242_101505622 268
236 3300009177 Ga0105248_10004449 Ga0105248_1000444910 268
237 3300009551 Ga0105238_10033069 Ga0105238_100330694 268
238 3300010375 Ga0105239_10039631 Ga0105239_100396313 268
239 3300013104 Ga0157370_10030360 Ga0157370_100303602 268
240 3300013296 Ga0157374_10035024 Ga0157374_100350244 268
241 3300013297 Ga0157378_10016931 Ga0157378_100169313 268
242 3300013306 Ga0163162_10251945 Ga0163162_102519452 268
243 3300014325 Ga0163163_10010693 Ga0163163_1001069311 268
244 3300025903 Ga0207680_10001088 Ga0207680_100010886 268
245 3300025912 Ga0207707_10001236 Ga0207707_100012366 268
246 3300025913 Ga0207695_10067847 Ga0207695_100678472 268
247 3300025914 Ga0207671_10172143 Ga0207671_101721432 268
248 3300025921 Ga0207652_10179868 Ga0207652_101798682 268
249 3300025927 Ga0207687_10162493 Ga0207687_101624932 268
250 3300025934 Ga0207686_10008101 Ga0207686_100081013 268
251 3300025938 Ga0207704_10007360 Ga0207704_100073604 268
252 3300025941 Ga0207711_10019653 Ga0207711_100196532 268
253 3300025949 Ga0207667_10255582 Ga0207667_102555822 268
254 3300025986 Ga0207658_10011414 Ga0207658_100114147 268
255 3300026088 Ga0207641_10442840 Ga0207641_104428402 268
256 3300028381 Ga0268264_10009485 Ga0268264_100094853 268
257 3300028800 Ga0265338_10211551 Ga0265338_102115512 268
258 3300037853 Ga0436364_0310874 Ga0436364_0310874_12539_13363 268
259 3300005338 Ga0068868_100003367 Ga0068868_1000033672 269
260 3300005458 Ga0070681_10259845 Ga0070681_102598452 269
261 3300005539 Ga0068853_100036291 Ga0068853_1000362911 269
262 3300005548 Ga0070665_100034223 Ga0070665_1000342234 269
263 3300005563 Ga0068855_100499146 Ga0068855_1004991461 269
264 3300005577 Ga0068857_100029235 Ga0068857_1000292354 269
265 3300005617 Ga0068859_100463612 Ga0068859_1004636122 269
266 3300005618 Ga0068864_100534170 Ga0068864_1005341702 269
267 3300005841 Ga0068863_100039728 Ga0068863_1000397282 269
268 3300005842 Ga0068858_100019068 Ga0068858_1000190683 269
269 3300005843 Ga0068860_100137361 Ga0068860_1001373612 269
270 3300006237 Ga0097621_100064753 Ga0097621_1000647532 269
271 3300006237 Ga0097621_100068163 Ga0097621_1000681632 269
272 3300006358 Ga0068871_100007571 Ga0068871_1000075712 269
273 3300006931 Ga0097620_100463629 Ga0097620_1004636292 269
274 3300009093 Ga0105240_10314158 Ga0105240_103141582 269
275 3300009093 Ga0105240_10595764 Ga0105240_105957642 269
276 3300009098 Ga0105245_10023003 Ga0105245_100230035 269
277 3300009098 Ga0105245_10078237 Ga0105245_100782372 269
278 3300009176 Ga0105242_10398554 Ga0105242_103985542 269
279 3300009177 Ga0105248_10033698 Ga0105248_100336982 269
280 3300009545 Ga0105237_10358903 Ga0105237_103589032 269
281 3300009551 Ga0105238_10007197 Ga0105238_100071972 269
282 3300009551 Ga0105238_10273126 Ga0105238_102731262 269
283 3300010375 Ga0105239_10154156 Ga0105239_101541562 269
284 3300011119 Ga0105246_10158518 Ga0105246_101585182 269
285 3300013104 Ga0157370_10263731 Ga0157370_102637312 269
286 3300013105 Ga0157369_10068313 Ga0157369_100683132 269
287 3300013105 Ga0157369_10248687 Ga0157369_102486872 269
288 3300013297 Ga0157378_10065088 Ga0157378_100650882 269
289 3300013297 Ga0157378_10131003 Ga0157378_101310032 269
290 3300013306 Ga0163162_10006750 Ga0163162_100067503 269
291 3300013308 Ga0157375_10074165 Ga0157375_100741652 269
292 3300014325 Ga0163163_10003155 Ga0163163_1000315517 269
293 3300025911 Ga0207654_10349637 Ga0207654_103496372 269
294 3300025912 Ga0207707_10164735 Ga0207707_101647352 269
295 3300025912 Ga0207707_10167910 Ga0207707_101679102 269
296 3300025913 Ga0207695_10426428 Ga0207695_104264282 269
297 3300025914 Ga0207671_10227370 Ga0207671_102273702 269
298 3300025919 Ga0207657_10001968 Ga0207657_100019683 269
299 3300025924 Ga0207694_10202954 Ga0207694_102029542 269
300 3300025927 Ga0207687_10023862 Ga0207687_100238623 269
301 3300025931 Ga0207644_10150571 Ga0207644_101505712 269
302 3300025941 Ga0207711_10219133 Ga0207711_102191332 269
303 3300025949 Ga0207667_10139705 Ga0207667_101397052 269
304 3300026035 Ga0207703_10008427 Ga0207703_100084274 269
305 3300026078 Ga0207702_10691157 Ga0207702_106911572 269
306 3300026088 Ga0207641_10120951 Ga0207641_101209512 269
307 3300026095 Ga0207676_10050087 Ga0207676_100500873 269
308 3300026116 Ga0207674_10018058 Ga0207674_100180582 269
309 3300026142 Ga0207698_10748353 Ga0207698_107483531 269
310 3300028379 Ga0268266_10010748 Ga0268266_100107485 269
311 3300028381 Ga0268264_10074739 Ga0268264_100747393 269
312 3300031249 Ga0265339_10110992 Ga0265339_101109922 269
313 3300031711 Ga0265314_10002439 Ga0265314_1000243911 269
314 3300046472 Ga0495580_0120351 Ga0495580_0120351_440_1279 269
315 3300046499 Ga0495594_0180376 Ga0495594_0180376_308_1147 269
316 3300046694 Ga0495649_0100446 Ga0495649_0100446_161_973 269
317 3300047317 Ga0495604_0098545 Ga0495604_0098545_150_992 269
318 3300053119 Ga0500595_000025 Ga0500595_000025_139368_140177 269
319 3300005548 Ga0070665_100244742 Ga0070665_1002447421 270
320 3300005563 Ga0068855_100029557 Ga0068855_1000295573 270
321 3300005937 Ga0081455_10194456 Ga0081455_101944562 270
322 3300009177 Ga0105248_10066107 Ga0105248_100661072 270
323 3300013104 Ga0157370_10050837 Ga0157370_100508373 270
324 3300025903 Ga0207680_10249067 Ga0207680_102490672 270
325 3300025913 Ga0207695_10086722 Ga0207695_100867222 270
326 3300028379 Ga0268266_10215581 Ga0268266_102155813 270
327 3300046694 Ga0495649_0019338 Ga0495649_0019338_519_1352 270
328 3300049573 Ga0501037_0183518 Ga0501037_0183518_457_1299 270
329 3300049581 Ga0501047_0014170 Ga0501047_0014170_3210_4046 270
330 3300049822 Ga0501035_0055431 Ga0501035_0055431_2459_3301 270
331 3300049823 Ga0501044_0002699 Ga0501044_0002699_3579_4415 270
332 3300049823 Ga0501044_0005795 Ga0501044_0005795_12435_13277 270
333 iso_pu_bacteria 2884215851 2884216312 270
334 3300005327 Ga0070658_10097019 Ga0070658_100970193 272
335 3300005435 Ga0070714_100149869 Ga0070714_1001498692 272
336 3300005458 Ga0070681_10105662 Ga0070681_101056624 272
337 3300005545 Ga0070695_100235529 Ga0070695_1002355291 272
338 3300006914 Ga0075436_100009556 Ga0075436_1000095562 272
339 3300009551 Ga0105238_10102576 Ga0105238_101025763 272
340 3300025912 Ga0207707_10058879 Ga0207707_100588792 272
341 3300025921 Ga0207652_10020050 Ga0207652_100200505 272
342 3300025929 Ga0207664_10492828 Ga0207664_104928281 272
343 3300028800 Ga0265338_10194351 Ga0265338_101943512 272
344 3300031344 Ga0265316_10014579 Ga0265316_100145792 272
345 3300035695 Ga0373927_0002154 Ga0373927_0002154_128_952 272
346 3300044694 Ga0466963_0144498 Ga0466963_0144498_765_1607 272
347 3300047320 Ga0495672_0169286 Ga0495672_0169286_223_1053 272
348 3300047472 Ga0495686_0000030 Ga0495686_0000030_152270_153094 272
349 3300048907 Ga0496104_0000673 Ga0496104_0000673_14066_14890 272
350 3300050513 nmdc:mga0rr50_529404_c1 nmdc:mga0rr50_529404_c1_74_898 272
351 3300050514 nmdc:mga08x19_8813_c1 nmdc:mga08x19_8813_c1_116_940 272
352 3300013100 Ga0157373_10249959 Ga0157373_102499592 273
353 3300037853 Ga0436364_1419803 Ga0436364_1419803_4933_5772 273
354 3300037853 Ga0436364_1551588 Ga0436364_1551588_232_1107 273
355 3300039438 Ga0436360_0246149 Ga0436360_0246149_1619_2458 273
356 3300039447 Ga0436361_0567168 Ga0436361_0567168_132455_133294 273
357 3300039447 Ga0436361_0671658 Ga0436361_0671658_1599_2438 273
358 3300044656 Ga0466969_0168779 Ga0466969_0168779_136_975 273
359 3300045049 Ga0466959_0358181 Ga0466959_0358181_35_874 273
360 3300048929 Ga0496126_0000820 Ga0496126_0000820_26358_27185 273
361 3300005329 Ga0070683_100525215 Ga0070683_1005252152 274
362 3300005366 Ga0070659_100016154 Ga0070659_1000161546 274
363 3300005530 Ga0070679_100030586 Ga0070679_1000305862 274
364 3300005548 Ga0070665_100115814 Ga0070665_1001158143 274
365 3300005563 Ga0068855_100108734 Ga0068855_1001087342 274
366 3300005614 Ga0068856_100022940 Ga0068856_1000229405 274
367 3300005616 Ga0068852_100481491 Ga0068852_1004814911 274
368 3300009093 Ga0105240_10102083 Ga0105240_101020833 274
369 3300010375 Ga0105239_10262439 Ga0105239_102624392 274
370 3300013102 Ga0157371_10054199 Ga0157371_100541992 274
371 3300013105 Ga0157369_10410370 Ga0157369_104103702 274
372 3300013296 Ga0157374_10003283 Ga0157374_1000328310 274
373 3300013296 Ga0157374_10179241 Ga0157374_101792413 274
374 3300014969 Ga0157376_10501729 Ga0157376_105017292 274
375 3300020069 Ga0197907_11375067 Ga0197907_113750673 274
376 3300020076 Ga0206355_1614066 Ga0206355_16140663 274
377 3300021377 Ga0213874_10024539 Ga0213874_100245392 274
378 3300021384 Ga0213876_10005055 Ga0213876_100050557 274
379 3300021388 Ga0213875_10000005 Ga0213875_1000000555 274
380 3300021388 Ga0213875_10000196 Ga0213875_100001968 274
381 3300021388 Ga0213875_10036423 Ga0213875_100364232 274
382 3300021388 Ga0213875_10083536 Ga0213875_100835362 274
383 3300022467 Ga0224712_10086811 Ga0224712_100868112 274
384 3300025912 Ga0207707_10201515 Ga0207707_102015152 274
385 3300025919 Ga0207657_10213571 Ga0207657_102135712 274
386 3300025921 Ga0207652_10087987 Ga0207652_100879873 274
387 3300025932 Ga0207690_10038790 Ga0207690_100387902 274
388 3300026067 Ga0207678_10163267 Ga0207678_101632672 274
389 3300026078 Ga0207702_10015971 Ga0207702_100159715 274
390 3300028379 Ga0268266_10164593 Ga0268266_101645933 274
391 3300037853 Ga0436364_0032202 Ga0436364_0032202_178_1053 274
392 3300037853 Ga0436364_0068230 Ga0436364_0068230_45_941 274
393 3300037853 Ga0436364_0080170 Ga0436364_0080170_57424_58266 274
394 3300037853 Ga0436364_0278774 Ga0436364_0278774_251082_251930 274
395 3300037853 Ga0436364_0630365 Ga0436364_0630365_252_1094 274
396 3300037853 Ga0436364_0718428 Ga0436364_0718428_4101_4943 274
397 3300037853 Ga0436364_1150628 Ga0436364_1150628_4293_5135 274
398 3300039437 Ga0436365_1005832 Ga0436365_1005832_39_887 274
399 3300039437 Ga0436365_1330341 Ga0436365_1330341_25336_26178 274
400 3300039450 Ga0436363_1408881 Ga0436363_1408881_39_887 274
401 3300039453 Ga0436362_1282706 Ga0436362_1282706_1015_1863 274
402 3300044684 Ga0466966_0157362 Ga0466966_0157362_459_1283 274
403 3300044842 Ga0466957_0190714 Ga0466957_0190714_384_1226 274
404 3300048915 Ga0496112_0037929 Ga0496112_0037929_3607_4449 274
405 3300048918 Ga0496115_0237880 Ga0496115_0237880_245_1072 274
406 3300049569 Ga0501032_0011478 Ga0501032_0011478_3779_4603 274
407 3300049569 Ga0501032_0177519 Ga0501032_0177519_545_1369 274
408 3300049570 Ga0501033_0000876 Ga0501033_0000876_20421_21245 274
409 3300049572 Ga0501036_0011178 Ga0501036_0011178_6557_7381 274
410 3300049574 Ga0501038_0003247 Ga0501038_0003247_13599_14423 274
411 3300049575 Ga0501039_0237840 Ga0501039_0237840_182_1006 274
412 3300049579 Ga0501043_0010410 Ga0501043_0010410_3826_4650 274
413 3300049580 Ga0501046_0000265 Ga0501046_0000265_32402_33226 274
414 3300049581 Ga0501047_0003679 Ga0501047_0003679_5552_6376 274
415 3300049589 Ga0501073_0067085 Ga0501073_0067085_147_971 274
416 3300049822 Ga0501035_0002898 Ga0501035_0002898_5134_5958 274
417 3300049823 Ga0501044_0006355 Ga0501044_0006355_6542_7366 274
418 3300049823 Ga0501044_0145800 Ga0501044_0145800_1003_1845 274
419 3300003320 rootH2_10156923 rootH2_101569231 275
420 3300004799 Ga0058863_10127638 Ga0058863_101276382 275
421 3300004803 Ga0058862_12661585 Ga0058862_126615851 275
422 3300005327 Ga0070658_10009641 Ga0070658_100096416 275
423 3300005327 Ga0070658_10019305 Ga0070658_100193055 275
424 3300005336 Ga0070680_100017692 Ga0070680_1000176923 275
425 3300005336 Ga0070680_100126939 Ga0070680_1001269392 275
426 3300005339 Ga0070660_100007684 Ga0070660_1000076846 275
427 3300005339 Ga0070660_100012775 Ga0070660_1000127754 275
428 3300005347 Ga0070668_100012225 Ga0070668_1000122253 275
429 3300005347 Ga0070668_100035497 Ga0070668_1000354972 275
430 3300005364 Ga0070673_100054851 Ga0070673_1000548513 275
431 3300005435 Ga0070714_100000992 Ga0070714_10000099212 275
432 3300005435 Ga0070714_100422047 Ga0070714_1004220472 275
433 3300005436 Ga0070713_100170015 Ga0070713_1001700152 275
434 3300005437 Ga0070710_10104289 Ga0070710_101042892 275
435 3300005456 Ga0070678_100118782 Ga0070678_1001187823 275
436 3300005457 Ga0070662_100072938 Ga0070662_1000729382 275
437 3300005458 Ga0070681_10040595 Ga0070681_100405955 275
438 3300005458 Ga0070681_10692694 Ga0070681_106926941 275
439 3300005530 Ga0070679_100037253 Ga0070679_1000372535 275
440 3300005530 Ga0070679_100213691 Ga0070679_1002136912 275
441 3300005530 Ga0070679_100235461 Ga0070679_1002354611 275
442 3300005535 Ga0070684_100184391 Ga0070684_1001843912 275
443 3300005539 Ga0068853_100030405 Ga0068853_1000304051 275
444 3300005548 Ga0070665_100277908 Ga0070665_1002779082 275
445 3300005563 Ga0068855_100007892 Ga0068855_1000078922 275
446 3300005563 Ga0068855_100037522 Ga0068855_1000375223 275
447 3300005563 Ga0068855_100090590 Ga0068855_1000905902 275
448 3300005563 Ga0068855_100093481 Ga0068855_1000934813 275
449 3300005563 Ga0068855_100214113 Ga0068855_1002141132 275
450 3300005563 Ga0068855_100228378 Ga0068855_1002283781 275
451 3300005578 Ga0068854_100133014 Ga0068854_1001330141 275
452 3300005614 Ga0068856_100063719 Ga0068856_1000637192 275
453 3300005616 Ga0068852_100004648 Ga0068852_1000046485 275
454 3300005616 Ga0068852_100033624 Ga0068852_1000336242 275
455 3300005616 Ga0068852_100135130 Ga0068852_1001351303 275
456 3300005834 Ga0068851_10034231 Ga0068851_100342313 275
457 3300005841 Ga0068863_100134865 Ga0068863_1001348652 275
458 3300005842 Ga0068858_100127039 Ga0068858_1001270392 275
459 3300005843 Ga0068860_100101383 Ga0068860_1001013831 275
460 3300005983 Ga0081540_1017053 Ga0081540_10170532 275
461 3300006028 Ga0070717_10005941 Ga0070717_100059415 275
462 3300006175 Ga0070712_100043245 Ga0070712_1000432452 275
463 3300006237 Ga0097621_100103043 Ga0097621_1001030432 275
464 3300006881 Ga0068865_100258110 Ga0068865_1002581101 275
465 3300009093 Ga0105240_10003079 Ga0105240_1000307917 275
466 3300009093 Ga0105240_10065336 Ga0105240_100653364 275
467 3300009174 Ga0105241_10107222 Ga0105241_101072222 275
468 3300009545 Ga0105237_10506803 Ga0105237_105068031 275
469 3300009545 Ga0105237_10554920 Ga0105237_105549201 275
470 3300009551 Ga0105238_10038312 Ga0105238_100383124 275
471 3300009551 Ga0105238_10064619 Ga0105238_100646193 275
472 3300009553 Ga0105249_10350615 Ga0105249_103506152 275
473 3300010375 Ga0105239_10734968 Ga0105239_107349681 275
474 3300011119 Ga0105246_10170019 Ga0105246_101700191 275
475 3300013102 Ga0157371_10249364 Ga0157371_102493641 275
476 3300013104 Ga0157370_10078802 Ga0157370_100788022 275
477 3300013105 Ga0157369_10010057 Ga0157369_100100577 275
478 3300013105 Ga0157369_10077474 Ga0157369_100774742 275
479 3300013105 Ga0157369_10104792 Ga0157369_101047922 275
480 3300013105 Ga0157369_10193901 Ga0157369_101939012 275
481 3300013105 Ga0157369_10227386 Ga0157369_102273862 275
482 3300013296 Ga0157374_10032303 Ga0157374_100323036 275
483 3300013297 Ga0157378_10279212 Ga0157378_102792122 275
484 3300013297 Ga0157378_10290258 Ga0157378_102902582 275
485 3300013307 Ga0157372_10012096 Ga0157372_100120966 275
486 3300013307 Ga0157372_10019755 Ga0157372_100197554 275
487 3300013307 Ga0157372_10091926 Ga0157372_100919265 275
488 3300013307 Ga0157372_10099974 Ga0157372_100999744 275
489 3300013307 Ga0157372_10125754 Ga0157372_101257541 275
490 3300013307 Ga0157372_10295501 Ga0157372_102955012 275
491 3300013307 Ga0157372_10595132 Ga0157372_105951322 275
492 3300014969 Ga0157376_10278545 Ga0157376_102785452 275
493 3300014969 Ga0157376_10282891 Ga0157376_102828912 275
494 3300017792 Ga0163161_10043331 Ga0163161_100433312 275
495 3300020080 Ga0206350_11349122 Ga0206350_113491222 275
496 3300021361 Ga0213872_10056354 Ga0213872_100563542 275
497 3300021388 Ga0213875_10023873 Ga0213875_100238732 275
498 3300025898 Ga0207692_10033257 Ga0207692_100332572 275
499 3300025906 Ga0207699_10106750 Ga0207699_101067502 275
500 3300025907 Ga0207645_10040033 Ga0207645_100400332 275
501 3300025909 Ga0207705_10008017 Ga0207705_100080173 275
502 3300025909 Ga0207705_10254910 Ga0207705_102549102 275
503 3300025911 Ga0207654_10120735 Ga0207654_101207352 275
504 3300025912 Ga0207707_10196410 Ga0207707_101964102 275
505 3300025913 Ga0207695_10000804 Ga0207695_1000080420 275
506 3300025913 Ga0207695_10540405 Ga0207695_105404052 275
507 3300025914 Ga0207671_10169263 Ga0207671_101692633 275
508 3300025917 Ga0207660_10070983 Ga0207660_100709832 275
509 3300025917 Ga0207660_10153124 Ga0207660_101531241 275
510 3300025919 Ga0207657_10005349 Ga0207657_1000534910 275
511 3300025919 Ga0207657_10046559 Ga0207657_100465592 275
512 3300025921 Ga0207652_10040614 Ga0207652_100406144 275
513 3300025921 Ga0207652_10240559 Ga0207652_102405592 275
514 3300025924 Ga0207694_10018555 Ga0207694_100185554 275
515 3300025924 Ga0207694_10096664 Ga0207694_100966643 275
516 3300025924 Ga0207694_10393553 Ga0207694_103935532 275
517 3300025929 Ga0207664_10410534 Ga0207664_104105342 275
518 3300025933 Ga0207706_10013900 Ga0207706_100139004 275
519 3300025938 Ga0207704_10063485 Ga0207704_100634851 275
520 3300025940 Ga0207691_10022122 Ga0207691_100221223 275
521 3300025941 Ga0207711_10108729 Ga0207711_101087292 275
522 3300025949 Ga0207667_10000538 Ga0207667_1000053813 275
523 3300025949 Ga0207667_10229611 Ga0207667_102296113 275
524 3300025949 Ga0207667_10320680 Ga0207667_103206802 275
525 3300025972 Ga0207668_10160938 Ga0207668_101609382 275
526 3300025972 Ga0207668_10286702 Ga0207668_102867021 275
527 3300025981 Ga0207640_10222110 Ga0207640_102221102 275
528 3300025981 Ga0207640_10293528 Ga0207640_102935281 275
529 3300026035 Ga0207703_10132207 Ga0207703_101322072 275
530 3300026041 Ga0207639_10007682 Ga0207639_100076826 275
531 3300026041 Ga0207639_10059066 Ga0207639_100590662 275
532 3300026067 Ga0207678_10070265 Ga0207678_100702652 275
533 3300026078 Ga0207702_10070862 Ga0207702_100708622 275
534 3300026088 Ga0207641_10091642 Ga0207641_100916422 275
535 3300026116 Ga0207674_10067730 Ga0207674_100677304 275
536 3300026121 Ga0207683_10011081 Ga0207683_100110816 275
537 3300026142 Ga0207698_10008297 Ga0207698_100082975 275
538 3300026142 Ga0207698_10030565 Ga0207698_100305653 275
539 3300026142 Ga0207698_10268189 Ga0207698_102681892 275
540 3300028379 Ga0268266_10001822 Ga0268266_100018222 275
541 3300028379 Ga0268266_10003502 Ga0268266_100035022 275
542 3300028381 Ga0268264_10263615 Ga0268264_102636152 275
543 3300028573 Ga0265334_10092040 Ga0265334_100920401 275
544 3300028800 Ga0265338_10021009 Ga0265338_100210095 275
545 3300028800 Ga0265338_10048667 Ga0265338_100486673 275
546 3300028800 Ga0265338_10090924 Ga0265338_100909242 275
547 3300031090 Ga0265760_10009076 Ga0265760_100090762 275
548 3300031235 Ga0265330_10001094 Ga0265330_100010944 275
549 3300031241 Ga0265325_10071797 Ga0265325_100717972 275
550 3300031249 Ga0265339_10005264 Ga0265339_100052643 275
551 3300031249 Ga0265339_10049523 Ga0265339_100495232 275
552 3300031344 Ga0265316_10017922 Ga0265316_100179225 275
553 3300031595 Ga0265313_10017403 Ga0265313_100174032 275
554 3300031711 Ga0265314_10000261 Ga0265314_1000026152 275
555 3300031712 Ga0265342_10004473 Ga0265342_100044736 275
556 3300033180 Ga0307510_10017003 Ga0307510_100170032 275
557 3300033180 Ga0307510_10156041 Ga0307510_101560412 275
558 3300037418 Ga0395900_0382929 Ga0395900_0382929_329_1204 275
559 3300037466 Ga0395898_0066377 Ga0395898_0066377_852_1727 275
560 3300046472 Ga0495580_0052559 Ga0495580_0052559_730_1563 275
561 3300046473 Ga0495582_0005880 Ga0495582_0005880_4809_5642 275
562 3300046473 Ga0495582_0092786 Ga0495582_0092786_507_1337 275
563 3300046476 Ga0495662_0013059 Ga0495662_0013059_882_1715 275
564 3300046477 Ga0495664_0013075 Ga0495664_0013075_3466_4299 275
565 3300046499 Ga0495594_0000369 Ga0495594_0000369_6646_7473 275
566 3300046499 Ga0495594_0004624 Ga0495594_0004624_4970_5803 275
567 3300046506 Ga0495583_0021321 Ga0495583_0021321_584_1423 275
568 3300046506 Ga0495583_0049871 Ga0495583_0049871_191_1018 275
569 3300046516 Ga0495628_0203099 Ga0495628_0203099_63_896 275
570 3300046517 Ga0495630_0152282 Ga0495630_0152282_873_1706 275
571 3300046518 Ga0495631_0173971 Ga0495631_0173971_50_877 275
572 3300046523 Ga0495644_0000023 Ga0495644_0000023_70825_71652 275
573 3300046524 Ga0495648_0113351 Ga0495648_0113351_469_1296 275
574 3300046526 Ga0495666_0006772 Ga0495666_0006772_2634_3467 275
575 3300046529 Ga0495652_0006361 Ga0495652_0006361_2234_3067 275
576 3300046533 Ga0495640_0052530 Ga0495640_0052530_617_1450 275
577 3300046535 Ga0495586_0032907 Ga0495586_0032907_1852_2685 275
578 3300046559 Ga0495667_0007248 Ga0495667_0007248_222_1055 275
579 3300046616 Ga0495668_0167913 Ga0495668_0167913_136_975 275
580 3300046642 Ga0495634_0046425 Ga0495634_0046425_19_852 275
581 3300046660 Ga0495625_0000796 Ga0495625_0000796_23482_24309 275
582 3300046660 Ga0495625_0123758 Ga0495625_0123758_439_1278 275
583 3300046663 Ga0495635_0015069 Ga0495635_0015069_1318_2151 275
584 3300046675 Ga0495657_0116627 Ga0495657_0116627_28_861 275
585 3300046680 Ga0495646_0188731 Ga0495646_0188731_14_847 275
586 3300046684 Ga0495669_0006062 Ga0495669_0006062_450_1277 275
587 3300046689 Ga0495613_0023005 Ga0495613_0023005_1126_1959 275
588 3300046689 Ga0495613_0040073 Ga0495613_0040073_1345_2178 275
589 3300046694 Ga0495649_0134880 Ga0495649_0134880_85_924 275
590 3300046809 Ga0495600_0018704 Ga0495600_0018704_1352_2185 275
591 3300047315 Ga0495581_0003369 Ga0495581_0003369_597_1430 275
592 3300047315 Ga0495581_0269157 Ga0495581_0269157_100_933 275
593 3300047317 Ga0495604_0270831 Ga0495604_0270831_207_1040 275
594 3300047319 Ga0495674_0296787 Ga0495674_0296787_80_913 275
595 3300047319 Ga0495674_0567882 Ga0495674_0567882_29_862 275
596 3300047320 Ga0495672_0001628 Ga0495672_0001628_7137_7964 275
597 3300047321 Ga0495676_0035083 Ga0495676_0035083_85_918 275
598 3300047444 Ga0495675_0003532 Ga0495675_0003532_1373_2206 275
599 3300047445 Ga0495677_0003312 Ga0495677_0003312_2466_3293 275
600 3300047469 Ga0495673_0090525 Ga0495673_0090525_130_969 275
601 3300048089 Ga0495614_0103287 Ga0495614_0103287_134_967 275
602 3300048929 Ga0496126_0000024 Ga0496126_0000024_139051_139881 275
603 3300048929 Ga0496126_0078426 Ga0496126_0078426_638_1465 275
604 3300048929 Ga0496126_0424626 Ga0496126_0424626_109_942 275
605 3300053119 Ga0500595_005243 Ga0500595_005243_3148_3987 275

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13709

DUF4159

Domain of unknown function (DUF4159)

126

324

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
4i66-assembly1.cif.gz_A-2 crystal structure of hoch_4089 protein from haliangium ochraceum 0.813 51 273
4i66-assembly1.cif.gz_A-2 crystal structure of hoch_4089 protein from haliangium ochraceum 0.8016 51 273
3mhe-assembly1.cif.gz_B crystal structure of ketosteroid isomerase p39a from pseudomonas testosteroni (tksi) 0.745 218 239
6dbs-assembly1.cif.gz_A fusion surface structure, function, and dynamics of gamete fusogen hap2 0.7444 218 240
6dbs-assembly1.cif.gz_B fusion surface structure, function, and dynamics of gamete fusogen hap2 0.744 218 240
ID Description Score Start End Superfamily
af_Q6TMK2_24_122_3.10.450.50 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.7958 217 239 3.10.450.50
4i66A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Domain of unknown function DUF4159 0.7926 51 273 3.40.50.12140
4i66A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Domain of unknown function DUF4159 0.7813 51 273 3.40.50.12140
5hgrA02 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.766 216 238 3.10.450.50
6fejB00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.7545 218 236 3.10.450.50
ID Description Score Start End GO Terms
AF-A0A1H4SNU6-F1-model_v4 DUF4159 domain-containing protein 0.9957 26 275
AF-A0A2Z5FU96-F1-model_v4 DUF4159 domain-containing protein 0.99 34 275
AF-A0A2Z5FU96-F1-model_v4 DUF4159 domain-containing protein 0.9819 34 275
AF-A0A7Y8LJX4-F1-model_v4 DUF4159 domain-containing protein 0.9748 97 275
AF-A0A7C2JWL8-F1-model_v4 DUF4159 domain-containing protein 0.9731 70 275

Feature Viewer

pLDDT pTM Quality
92.68 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map