F468314

General Info

Members Datasets Scaffolds Average Seq Length
603 228 570 525

Family's Representative Sequence

Representative Sequence 3300046507|Ga0495606_0011564|Ga0495606_0011564_3760_5529
Length 589
Sequence VINTIKSAFGRWRSGDGAAPALPPALLKNLTPILLLAIGVTALVLMVLWKDQSAYKPVFGAREKVVAADMMTVLDGEHIPYRVHPDSGQVLVPESMLGKVRMLLASKGVTAQLPAGLELMDKNDPLGVSQFVQDVRFRRGLEGELAQSIMTLDAIASARVHLSIAKSTSFVTSDGDKSSASVVIATKPGQKLSPETIAAVVNMVAGSVASLSPGRVSLVDQAGNLLSSHVDLADGFESSAATNENGKRLQDDIRNNIRGLLGPIVGEDNFRLSVTATVNNDKVEETVEKYGETPKVTSEAMREEQDRNRLVMGVPGTLSNRPPSADAGKATDPNQQPDGSAKKNATTRQYAYDRSIVQTKHARGTLEKQSIAVVLAQAAAPFPKTGWTAAELANIDKVLRNGLGINAERGDALVVTAMNFPAKAAVTPWWQERDTVVDFSSWLTYAVGALLGYLLLLRPIMRLLTARFAPPAPANVALRGNASGRSGATAEATVVGGQAGAPXXQPXXXXPALGTPDALLPEGQAQTLEGQPVAKPGMPVVPLLENYDLPPTGSSVDVMVDHLKVLAEKEPERVAEVVKQWMQKNGRSQ

Samples

Sample ID Description Type Environment
1 2547132103 Chromobacterium sp. C-61 Isolate Rhizosphere
2 2600255292 Janthinobacterium lividum NFR18 Isolate Rhizoplane
3 2643221554 Duganella sp. Root1480D1 Isolate Unclassified
4 2643221556 Massilia sp. Root1485 Isolate Unclassified
5 2643221638 Duganella sp. Root336D2 Isolate Unclassified
6 2643221645 Massilia sp. Root351 Isolate Unclassified
7 2643221664 Massilia sp. Root418 Isolate Unclassified
8 2643221684 Massilia sp. Root133 Isolate Unclassified
9 2738541280 Massilia sp. GV090 Isolate Unclassified
10 2738541297 Duganella sp. GV083 Isolate Unclassified
11 2738541300 Massilia sp. GV016 Isolate Unclassified
12 2738541357 Duganella sp. GV053 Isolate Unclassified
13 2738543003 Duganella sp. GV066 Isolate Unclassified
14 2738543018 Massilia sp. GV045 Isolate Unclassified
15 2738543026 Duganella sp. GV089 Isolate Unclassified
16 2738543029 Duganella sp. GV039 Isolate Unclassified
17 2738543030 Massilia sp. GV097 Isolate Unclassified
18 2808606418 Herbaspirillum sp. SJZ107 Isolate Rhizosphere
19 2821131069 Duganella sp. 1224 Isolate Unclassified
20 2842711865 Duganella sp. R-73148 Isolate Unclassified
21 2843690924 Chromobacterium rhizoryzae JP2-74 Isolate Rhizosphere
22 2846033681 Chromobacterium sinusclupearum MWU13-2610 Isolate Rhizosphere
23 2846037992 Chromobacterium alticapitis MWU14-2602 Isolate Rhizosphere
24 2857547612 Janthinobacterium sp. R-74502 Isolate Unclassified
25 2857553236 Duganella sp. R-74557 Isolate Unclassified
26 2857558681 Duganella sp. R-74565 Isolate Unclassified
27 2857564685 Duganella sp. R-74599 Isolate Unclassified
28 2885080285 Janthinobacterium sp. AD80 Isolate Rhizosphere
29 2904424332 Duganella sp. 1411 Isolate Rhizosphere
30 2919476304 Duganella sp. 3397 Isolate Unclassified
31 2932410948 Janthinobacterium lividum 2829 Isolate Rhizosphere
32 2932416698 Janthinobacterium lividum 2830 Isolate Rhizosphere
33 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
34 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
35 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
36 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
37 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
38 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
39 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
40 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
41 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
42 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
43 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
44 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
45 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
46 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
47 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
48 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
49 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
50 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
51 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
52 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
53 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
54 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
55 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
56 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
57 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
58 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
59 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
60 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
61 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
62 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
63 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
64 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
65 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
66 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
67 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
68 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
69 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
70 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
71 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
72 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
73 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
74 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
75 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
76 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
77 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
78 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
79 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
80 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
89 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
90 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
91 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
92 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
93 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
94 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
95 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
96 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
97 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
98 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
99 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
100 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
101 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
102 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
103 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
104 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
105 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
106 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
107 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
108 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
109 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
110 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
111 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
112 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
113 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
114 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
115 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
116 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
117 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
118 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
119 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
120 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
121 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
122 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
123 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
124 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
125 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
126 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
127 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
128 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
129 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
130 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
131 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
132 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
133 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
134 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
135 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
136 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
137 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
138 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
139 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
140 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
141 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
142 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
143 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
144 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
145 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
146 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
147 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
148 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
149 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
150 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
151 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
152 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
153 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
154 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
155 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
156 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
157 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
158 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
159 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
160 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
161 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
162 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
163 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
164 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
165 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
166 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
167 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
168 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
169 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
170 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
171 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
172 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
173 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
174 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
175 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
176 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
177 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
178 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
179 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
180 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
181 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
182 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
183 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
184 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
185 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
186 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
187 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
188 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
189 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
190 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
191 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
192 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
193 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
194 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
195 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
196 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
197 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
198 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
199 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
200 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
201 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
202 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
203 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
204 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
205 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
206 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
207 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
208 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
209 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
210 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
211 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
212 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
213 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
214 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
215 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
216 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
217 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
218 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
219 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
220 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
221 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
222 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
223 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
224 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
225 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
226 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
227 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
228 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.53
Metatranscriptomes 0
Isolates 5.47

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.76
Nodule 0.66
Rhizoplane 1.99
Rhizosphere 74.96
Stem 0
Stem Tuber 0
Unclassified 8.62

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25158J39367_1002596 3300002739 Bacteria 2908
2 JGI25158J39367_1005305 3300002739 Bacteria 1893
3 JGI25152J39213_1000260 3300002773 Bacteria 35206
4 JGI25150J39212_1002819 3300002774 Bacteria 4212
5 JGI25150J39212_1008461 3300002774 Bacteria 2010
6 JGI25161J50226_1001335 3300003374 Bacteria 7602
7 Ga0055525_1000006 3300003759 Bacteria 642912
8 Ga0055529_1000032 3300003763 Bacteria 255895
9 Ga0055526_1000894 3300003771 Bacteria 22172
10 Ga0055526_1000936 3300003771 Bacteria 21656
11 Ga0055526_1001845 3300003771 Bacteria 14661
12 Ga0055526_1001903 3300003771 Bacteria 14455
13 Ga0055526_1001937 3300003771 Bacteria 14320
14 Ga0055537_1000030 3300003773 Bacteria 100491
15 Ga0055524_1000003 3300003775 Bacteria 399748
16 Ga0055524_1000094 3300003775 Bacteria 110394
17 Ga0055524_1002401 3300003775 Bacteria 9714
18 Ga0055524_1005766 3300003775 Bacteria 5475
19 Ga0055524_1007783 3300003775 Bacteria 4517
20 Ga0055524_1009711 3300003775 Bacteria 3889
21 Ga0055534_1000203 3300003784 Bacteria 43799
22 Ga0055534_1002029 3300003784 Bacteria 7338
23 Ga0055528_1000036 3300003790 Bacteria 116393
24 Ga0055530_10007328 3300003791 Bacteria 4675
25 Ga0055530_10016757 3300003791 Bacteria 2323
26 Ga0055540_1000004 3300003792 Bacteria 395545
27 Ga0055531_10002157 3300003794 Bacteria 13449
28 Ga0055543_1000823 3300004625 Bacteria 15179
29 Ga0065165_1000353 3300005262 Bacteria 75343
30 Ga0065165_1000666 3300005262 Bacteria 49564
31 Ga0065165_1003232 3300005262 Bacteria 11818
32 Ga0070660_100056906 3300005339 Bacteria 3027
33 Ga0070661_100001791 3300005344 Bacteria 14900
34 Ga0070661_100034253 3300005344 Bacteria 3683
35 Ga0070659_100001056 3300005366 Bacteria 20135
36 Ga0070659_100010372 3300005366 Bacteria 6852
37 Ga0070664_100073780 3300005564 Bacteria 2928
38 Ga0079104_1000252 3300006946 Bacteria 71332
39 Ga0099826_10000002 3300006948 Bacteria 1125830
40 Ga0105241_10010903 3300009174 Bacteria 6668
41 Ga0157371_10000010 3300013102 Bacteria 384921
42 Ga0182008_10000994 3300014497 Bacteria 19717
43 Ga0182006_1000029 3300015261 Bacteria 247579
44 Ga0182006_1000175 3300015261 Bacteria 67518
45 Ga0182007_10000109 3300015262 Bacteria 57731
46 Ga0182005_1000012 3300015265 Bacteria 396944
47 Ga0182005_1000094 3300015265 Bacteria 66986
48 Ga0213872_10000001 3300021361 Bacteria 662532
49 Ga0213872_10003554 3300021361 Bacteria 8586
50 Ga0213872_10010411 3300021361 Bacteria 4428
51 Ga0213872_10011761 3300021361 Bacteria 4137
52 Ga0209436_100579 3300025208 Bacteria 15667
53 Ga0209436_100764 3300025208 Bacteria 13328
54 Ga0209563_100022 3300025230 Bacteria 643318
55 Ga0207425_1000001 3300025245 Bacteria 2525432
56 Ga0207425_1000039 3300025245 Bacteria 219078
57 Ga0207425_1000262 3300025245 Bacteria 38967
58 Ga0209646_1000051 3300025246 Bacteria 296525
59 Ga0209148_1000638 3300025254 Bacteria 30534
60 Ga0209129_1000001 3300025258 Bacteria 1452436
61 Ga0209565_1000017 3300025263 Bacteria 462438
62 Ga0209565_1000561 3300025263 Bacteria 25571
63 Ga0209565_1002115 3300025263 Bacteria 7563
64 Ga0209565_1003811 3300025263 Bacteria 4758
65 Ga0209565_1005707 3300025263 Bacteria 3586
66 Ga0209565_1005832 3300025263 Bacteria 3533
67 Ga0209455_1000043 3300025272 Bacteria 413928
68 Ga0209673_1000007 3300025273 Bacteria 634477
69 Ga0209673_1014727 3300025273 Bacteria 3014
70 Ga0209130_1000078 3300025284 Bacteria 169374
71 Ga0209130_1002318 3300025284 Bacteria 9729
72 Ga0209130_1002816 3300025284 Bacteria 8108
73 Ga0209675_1000009 3300025291 Bacteria 562872
74 Ga0209675_1000243 3300025291 Bacteria 54489
75 Ga0209675_1001406 3300025291 Bacteria 13963
76 Ga0209675_1001675 3300025291 Bacteria 12326
77 Ga0209025_1003975 3300025294 Bacteria 13270
78 Ga0209564_1000011 3300025295 Bacteria 822327
79 Ga0209564_1000036 3300025295 Bacteria 423455
80 Ga0209564_1000055 3300025295 Bacteria 343782
81 Ga0209564_1000089 3300025295 Bacteria 249694
82 Ga0209564_1000109 3300025295 Bacteria 212912
83 Ga0209564_1001236 3300025295 Bacteria 28753
84 Ga0209758_1000020 3300025297 Bacteria 734220
85 Ga0209758_1000625 3300025297 Bacteria 54181
86 Ga0209050_1000074 3300025298 Bacteria 289334
87 Ga0209050_1000116 3300025298 Bacteria 204164
88 Ga0209050_1001248 3300025298 Bacteria 29381
89 Ga0209256_1000007 3300025299 Bacteria 1136599
90 Ga0209256_1000028 3300025299 Bacteria 420213
91 Ga0209256_1000071 3300025299 Bacteria 242618
92 Ga0209256_1000433 3300025299 Bacteria 64898
93 Ga0209256_1000928 3300025299 Bacteria 35783
94 Ga0209256_1001688 3300025299 Bacteria 21364
95 Ga0209051_1000016 3300025303 Bacteria 541891
96 Ga0209051_1011672 3300025303 Bacteria 4315
97 Ga0209257_1000003 3300025304 Bacteria 1702593
98 Ga0209257_1000115 3300025304 Bacteria 230858
99 Ga0207705_10001211 3300025909 Bacteria 20921
100 Ga0207654_10011693 3300025911 Bacteria 4479
101 Ga0207649_10027448 3300025920 Bacteria 3340
102 Ga0207690_10014338 3300025932 Bacteria 4788
103 Ga0207690_10020717 3300025932 Bacteria 4067
104 Ga0207709_10005411 3300025935 Bacteria 7260
105 Ga0207704_10005885 3300025938 Bacteria 5676
106 Ga0207679_10002156 3300025945 Bacteria 12185
107 Ga0207667_10098598 3300025949 Bacteria 3015
108 Ga0209281_1000196 3300027111 Bacteria 137908
109 Ga0209282_1000001 3300027666 Bacteria 2450367
110 Ga0307515_10096049 3300028794 Bacteria 3639
111 Ga0316181_1084405 3300030744 Bacteria 4562
112 Ga0307509_10000110 3300031507 Bacteria 117351
113 Ga0307408_100000157 3300031548 Bacteria 75915
114 Ga0307408_100011844 3300031548 Bacteria 5770
115 Ga0307408_100016288 3300031548 Bacteria 4959
116 Ga0307514_10000369 3300031649 Bacteria 102951
117 Ga0307518_10017949 3300031838 Bacteria 5070
118 Ga0307416_100005844 3300032002 Bacteria 7630
119 Ga0307510_10007975 3300033180 Bacteria 12601
120 Ga0395899_0000098 3300037312 Bacteria 151953
121 Ga0395899_0112545 3300037312 Bacteria 1955
122 Ga0395900_0011234 3300037418 Bacteria 9159
123 Ga0395900_0026428 3300037418 Bacteria 5943
124 Ga0395900_0195973 3300037418 Bacteria 2046
125 Ga0395905_0052305 3300037471 Bacteria 3823
126 Ga0395905_0160311 3300037471 Bacteria 2114
127 Ga0395901_0000019 3300038443 Bacteria 317063
128 Ga0395901_0012921 3300038443 Bacteria 8470
129 Ga0436361_0032036 3300039447 Bacteria 7614
130 Ga0436361_0287651 3300039447 Bacteria 35780
131 Ga0436361_0543340 3300039447 Bacteria 11617
132 Ga0436361_0561713 3300039447 Bacteria 2901
133 Ga0439445_0007381 3300042004 Bacteria 2549
134 Ga0439448_0009885 3300042005 Bacteria 2818
135 Ga0450911_000208 3300042115 Bacteria 23052
136 Ga0450911_002086 3300042115 Bacteria 4102
137 Ga0450904_000143 3300042139 Bacteria 15804
138 Ga0451577_0045919 3300042876 Bacteria 3909
139 Ga0466969_0039263 3300044656 Bacteria 2378
140 Ga0466965_0003497 3300044683 Bacteria 6894
141 Ga0466965_0005156 3300044683 Bacteria 5865
142 Ga0466965_0079099 3300044683 Bacteria 1661
143 Ga0466966_0016354 3300044684 Bacteria 4903
144 Ga0466966_0044146 3300044684 Bacteria 2854
145 Ga0466966_0053207 3300044684 Bacteria 2568
146 Ga0466961_0000034 3300044693 Bacteria 84993
147 Ga0466964_0000399 3300044706 Bacteria 13216
148 Ga0466964_0000497 3300044706 Bacteria 12201
149 Ga0466968_0000664 3300044735 Bacteria 11780
150 Ga0466957_0002510 3300044842 Bacteria 9872
151 Ga0466959_0002327 3300045049 Bacteria 12130
152 Ga0466959_0032735 3300045049 Bacteria 3848
153 Ga0466967_0019728 3300045976 Bacteria 5428
154 Ga0495617_000003 3300046452 Bacteria 541914
155 Ga0495617_000015 3300046452 Bacteria 260968
156 Ga0495617_000985 3300046452 Bacteria 13225
157 Ga0495617_001276 3300046452 Bacteria 11236
158 Ga0495627_000057 3300046453 Bacteria 144773
159 Ga0495627_000320 3300046453 Bacteria 47074
160 Ga0495627_007407 3300046453 Bacteria 4203
161 Ga0495603_0004950 3300046455 Bacteria 7972
162 Ga0495603_0007763 3300046455 Bacteria 6466
163 Ga0495590_0000001 3300046457 Bacteria 762984
164 Ga0495590_0000045 3300046457 Bacteria 119667
165 Ga0495591_000153 3300046458 Bacteria 73339
166 Ga0495629_0010302 3300046459 Bacteria 6810
167 Ga0495629_0031496 3300046459 Bacteria 3755
168 Ga0495638_0000017 3300046460 Bacteria 391117
169 Ga0495638_0002577 3300046460 Bacteria 14658
170 Ga0495638_0034280 3300046460 Bacteria 3241
171 Ga0495653_0000024 3300046463 Bacteria 160810
172 Ga0495653_0014764 3300046463 Bacteria 6369
173 Ga0495653_0063637 3300046463 Bacteria 2782
174 Ga0495650_0000019 3300046471 Bacteria 533849
175 Ga0495650_0000329 3300046471 Bacteria 84971
176 Ga0495650_0000425 3300046471 Bacteria 68464
177 Ga0495650_0000627 3300046471 Bacteria 47536
178 Ga0495650_0004013 3300046471 Bacteria 10330
179 Ga0495580_0032448 3300046472 Bacteria 3769
180 Ga0495580_0067683 3300046472 Bacteria 2498
181 Ga0495582_0001514 3300046473 Bacteria 13094
182 Ga0495605_0000021 3300046474 Bacteria 248512
183 Ga0495605_0000028 3300046474 Bacteria 218471
184 Ga0495605_0003267 3300046474 Bacteria 9730
185 Ga0495605_0011870 3300046474 Bacteria 4845
186 Ga0495605_0054144 3300046474 Bacteria 1944
187 Ga0495639_0011758 3300046475 Bacteria 3776
188 Ga0495584_0000015 3300046491 Bacteria 169335
189 Ga0495584_0000050 3300046491 Bacteria 87308
190 Ga0495584_0000511 3300046491 Bacteria 26555
191 Ga0495584_0004831 3300046491 Bacteria 7198
192 Ga0495584_0008115 3300046491 Bacteria 5454
193 Ga0495584_0012904 3300046491 Bacteria 4265
194 Ga0495584_0031185 3300046491 Bacteria 2698
195 Ga0495584_0048898 3300046491 Bacteria 2131
196 Ga0495585_0000055 3300046492 Bacteria 113899
197 Ga0495585_0000278 3300046492 Bacteria 51304
198 Ga0495585_0000382 3300046492 Bacteria 42557
199 Ga0495585_0000645 3300046492 Bacteria 32066
200 Ga0495585_0001799 3300046492 Bacteria 16296
201 Ga0495585_0004224 3300046492 Bacteria 9369
202 Ga0495585_0004719 3300046492 Bacteria 8776
203 Ga0495585_0012728 3300046492 Bacteria 4951
204 Ga0495585_0014339 3300046492 Bacteria 4619
205 Ga0495585_0021251 3300046492 Bacteria 3728
206 Ga0495585_0022735 3300046492 Bacteria 3599
207 Ga0495585_0029677 3300046492 Bacteria 3112
208 Ga0495585_0042299 3300046492 Bacteria 2552
209 Ga0495585_0045738 3300046492 Bacteria 2442
210 Ga0495594_0002666 3300046499 Bacteria 9284
211 Ga0495594_0004551 3300046499 Bacteria 7132
212 Ga0495594_0018412 3300046499 Bacteria 3698
213 Ga0495594_0052183 3300046499 Bacteria 2251
214 Ga0495596_0000342 3300046500 Bacteria 30218
215 Ga0495596_0007218 3300046500 Bacteria 5026
216 Ga0495596_0007775 3300046500 Bacteria 4810
217 Ga0495596_0008444 3300046500 Bacteria 4582
218 Ga0495607_0001471 3300046501 Bacteria 20986
219 Ga0495607_0001771 3300046501 Bacteria 18464
220 Ga0495607_0002219 3300046501 Bacteria 16083
221 Ga0495607_0005026 3300046501 Bacteria 9593
222 Ga0495607_0022508 3300046501 Bacteria 3955
223 Ga0495607_0026998 3300046501 Bacteria 3556
224 Ga0495607_0042484 3300046501 Bacteria 2693
225 Ga0495607_0061215 3300046501 Bacteria 2139
226 Ga0495583_0000064 3300046506 Bacteria 192380
227 Ga0495583_0000140 3300046506 Bacteria 123415
228 Ga0495583_0000270 3300046506 Bacteria 85327
229 Ga0495583_0000605 3300046506 Bacteria 48655
230 Ga0495583_0000687 3300046506 Bacteria 43738
231 Ga0495583_0001073 3300046506 Bacteria 30539
232 Ga0495583_0001144 3300046506 Bacteria 28860
233 Ga0495583_0001801 3300046506 Bacteria 20273
234 Ga0495583_0012363 3300046506 Bacteria 4838
235 Ga0495583_0027917 3300046506 Bacteria 2779
236 Ga0495606_0000001 3300046507 Bacteria 592123
237 Ga0495606_0000095 3300046507 Bacteria 151634
238 Ga0495606_0000123 3300046507 Bacteria 131654
239 Ga0495606_0000403 3300046507 Bacteria 72945
240 Ga0495606_0000429 3300046507 Bacteria 69904
241 Ga0495606_0001743 3300046507 Bacteria 27920
242 Ga0495606_0004586 3300046507 Bacteria 13705
243 Ga0495606_0011564 3300046507 Bacteria 7183
244 Ga0495606_0022532 3300046507 Bacteria 4586
245 Ga0495606_0027894 3300046507 Bacteria 3993
246 Ga0495610_0000003 3300046512 Bacteria 1203910
247 Ga0495610_0003535 3300046512 Bacteria 12107
248 Ga0495610_0004916 3300046512 Bacteria 9701
249 Ga0495610_0004996 3300046512 Bacteria 9604
250 Ga0495610_0021523 3300046512 Bacteria 3545
251 Ga0495616_0000274 3300046513 Bacteria 41814
252 Ga0495616_0000392 3300046513 Bacteria 34039
253 Ga0495616_0000711 3300046513 Bacteria 24661
254 Ga0495616_0003461 3300046513 Bacteria 10103
255 Ga0495616_0004562 3300046513 Bacteria 8720
256 Ga0495616_0013290 3300046513 Bacteria 4650
257 Ga0495616_0013354 3300046513 Bacteria 4634
258 Ga0495620_0000974 3300046515 Bacteria 17631
259 Ga0495630_0029903 3300046517 Bacteria 4051
260 Ga0495631_0001656 3300046518 Bacteria 13253
261 Ga0495631_0003719 3300046518 Bacteria 8321
262 Ga0495631_0005436 3300046518 Bacteria 6669
263 Ga0495631_0020755 3300046518 Bacteria 3065
264 Ga0495631_0041527 3300046518 Bacteria 2035
265 Ga0495632_0000387 3300046519 Bacteria 41981
266 Ga0495632_0000558 3300046519 Bacteria 34771
267 Ga0495632_0001033 3300046519 Bacteria 24056
268 Ga0495632_0006426 3300046519 Bacteria 7559
269 Ga0495632_0018553 3300046519 Bacteria 3816
270 Ga0495632_0041571 3300046519 Bacteria 2309
271 Ga0495637_0000011 3300046520 Bacteria 337279
272 Ga0495637_0000581 3300046520 Bacteria 26014
273 Ga0495643_0000976 3300046522 Bacteria 29292
274 Ga0495643_0001500 3300046522 Bacteria 21149
275 Ga0495643_0002429 3300046522 Bacteria 14812
276 Ga0495643_0004008 3300046522 Bacteria 10519
277 Ga0495643_0006347 3300046522 Bacteria 7808
278 Ga0495643_0013866 3300046522 Bacteria 4808
279 Ga0495643_0014915 3300046522 Bacteria 4608
280 Ga0495643_0016390 3300046522 Bacteria 4352
281 Ga0495643_0058176 3300046522 Bacteria 2057
282 Ga0495644_0005672 3300046523 Bacteria 4871
283 Ga0495644_0008710 3300046523 Bacteria 3903
284 Ga0495644_0009865 3300046523 Bacteria 3676
285 Ga0495644_0022196 3300046523 Bacteria 2419
286 Ga0495644_0027853 3300046523 Bacteria 2139
287 Ga0495648_0000040 3300046524 Bacteria 184782
288 Ga0495648_0000136 3300046524 Bacteria 87034
289 Ga0495648_0000707 3300046524 Bacteria 35622
290 Ga0495648_0001392 3300046524 Bacteria 23785
291 Ga0495648_0022978 3300046524 Bacteria 4279
292 Ga0495666_0002140 3300046526 Bacteria 9807
293 Ga0495666_0011863 3300046526 Bacteria 4347
294 Ga0495642_0000395 3300046528 Bacteria 23454
295 Ga0495642_0001159 3300046528 Bacteria 12115
296 Ga0495642_0001349 3300046528 Bacteria 10995
297 Ga0495642_0003270 3300046528 Bacteria 6410
298 Ga0495642_0003779 3300046528 Bacteria 5927
299 Ga0495642_0020731 3300046528 Bacteria 2584
300 Ga0495642_0026054 3300046528 Bacteria 2320
301 Ga0495642_0046060 3300046528 Bacteria 1783
302 Ga0495652_0002899 3300046529 Bacteria 17268
303 Ga0495654_0000015 3300046530 Bacteria 307873
304 Ga0495654_0006348 3300046530 Bacteria 6723
305 Ga0495654_0017950 3300046530 Bacteria 3712
306 Ga0495654_0026571 3300046530 Bacteria 2974
307 Ga0495665_0007299 3300046531 Bacteria 5968
308 Ga0495665_0010862 3300046531 Bacteria 4925
309 Ga0495586_0006047 3300046535 Bacteria 6470
310 Ga0495586_0011402 3300046535 Bacteria 4728
311 Ga0495586_0032101 3300046535 Bacteria 2815
312 Ga0495587_0037835 3300046536 Bacteria 2894
313 Ga0495609_0000046 3300046538 Bacteria 158102
314 Ga0495609_0000617 3300046538 Bacteria 27691
315 Ga0495609_0001563 3300046538 Bacteria 14977
316 Ga0495609_0001850 3300046538 Bacteria 13518
317 Ga0495609_0002620 3300046538 Bacteria 10921
318 Ga0495609_0007629 3300046538 Bacteria 5376
319 Ga0495609_0008996 3300046538 Bacteria 4855
320 Ga0495609_0015571 3300046538 Bacteria 3557
321 Ga0495609_0019604 3300046538 Bacteria 3127
322 Ga0495597_0000021 3300046542 Bacteria 157613
323 Ga0495597_0000819 3300046542 Bacteria 24504
324 Ga0495597_0001286 3300046542 Bacteria 18454
325 Ga0495597_0002009 3300046542 Bacteria 13637
326 Ga0495597_0002464 3300046542 Bacteria 11697
327 Ga0495597_0003998 3300046542 Bacteria 8284
328 Ga0495645_0039203 3300046543 Bacteria 3456
329 Ga0495622_0000001 3300046557 Bacteria 365248
330 Ga0495622_0000421 3300046557 Bacteria 27994
331 Ga0495622_0000661 3300046557 Bacteria 19493
332 Ga0495622_0007489 3300046557 Bacteria 5065
333 Ga0495633_0000141 3300046558 Bacteria 95989
334 Ga0495633_0000639 3300046558 Bacteria 32745
335 Ga0495633_0002287 3300046558 Bacteria 13693
336 Ga0495633_0004185 3300046558 Bacteria 9259
337 Ga0495633_0006401 3300046558 Bacteria 6985
338 Ga0495633_0006490 3300046558 Bacteria 6925
339 Ga0495633_0006737 3300046558 Bacteria 6759
340 Ga0495633_0015912 3300046558 Bacteria 3893
341 Ga0495633_0032627 3300046558 Bacteria 2515
342 Ga0495633_0034680 3300046558 Bacteria 2425
343 Ga0495656_0006648 3300046615 Bacteria 4058
344 Ga0495656_0030386 3300046615 Bacteria 2183
345 Ga0495668_0000285 3300046616 Bacteria 70023
346 Ga0495668_0000472 3300046616 Bacteria 50873
347 Ga0495668_0000596 3300046616 Bacteria 43960
348 Ga0495668_0000651 3300046616 Bacteria 41671
349 Ga0495668_0001314 3300046616 Bacteria 24454
350 Ga0495668_0003596 3300046616 Bacteria 11496
351 Ga0495668_0004016 3300046616 Bacteria 10709
352 Ga0495668_0004390 3300046616 Bacteria 10048
353 Ga0495668_0004560 3300046616 Bacteria 9754
354 Ga0495668_0031910 3300046616 Bacteria 2966
355 Ga0495668_0040289 3300046616 Bacteria 2605
356 Ga0495668_0042740 3300046616 Bacteria 2522
357 Ga0495634_0002179 3300046642 Bacteria 16463
358 Ga0495611_0001075 3300046648 Bacteria 14440
359 Ga0495611_0001766 3300046648 Bacteria 10452
360 Ga0495611_0003410 3300046648 Bacteria 7014
361 Ga0495611_0016125 3300046648 Bacteria 3194
362 Ga0495611_0017891 3300046648 Bacteria 3036
363 Ga0495625_0000244 3300046660 Bacteria 85455
364 Ga0495625_0000695 3300046660 Bacteria 47797
365 Ga0495625_0002152 3300046660 Bacteria 21908
366 Ga0495625_0007287 3300046660 Bacteria 9667
367 Ga0495625_0014939 3300046660 Bacteria 6172
368 Ga0495625_0024384 3300046660 Bacteria 4605
369 Ga0495625_0026763 3300046660 Bacteria 4351
370 Ga0495625_0027805 3300046660 Bacteria 4250
371 Ga0495625_0035662 3300046660 Bacteria 3664
372 Ga0495635_0006103 3300046663 Bacteria 8401
373 Ga0495659_0000028 3300046664 Bacteria 67734
374 Ga0495659_0000183 3300046664 Bacteria 27260
375 Ga0495661_0001135 3300046665 Bacteria 23294
376 Ga0495661_0003691 3300046665 Bacteria 11244
377 Ga0495661_0005206 3300046665 Bacteria 9258
378 Ga0495661_0008435 3300046665 Bacteria 7125
379 Ga0495661_0016282 3300046665 Bacteria 4931
380 Ga0495661_0017964 3300046665 Bacteria 4660
381 Ga0495661_0028762 3300046665 Bacteria 3553
382 Ga0495661_0031078 3300046665 Bacteria 3393
383 Ga0495661_0052846 3300046665 Bacteria 2446
384 Ga0495588_0000105 3300046674 Bacteria 148043
385 Ga0495588_0037589 3300046674 Bacteria 2460
386 Ga0495623_0002282 3300046679 Bacteria 12779
387 Ga0495623_0019734 3300046679 Bacteria 4357
388 Ga0495646_0024021 3300046680 Bacteria 3838
389 Ga0495669_0000048 3300046684 Bacteria 81519
390 Ga0495669_0000564 3300046684 Bacteria 16405
391 Ga0495669_0001152 3300046684 Bacteria 10975
392 Ga0495669_0001222 3300046684 Bacteria 10684
393 Ga0495669_0013830 3300046684 Bacteria 3445
394 Ga0495613_0044494 3300046689 Bacteria 3284
395 Ga0495624_0001671 3300046690 Bacteria 16996
396 Ga0495670_0006989 3300046691 Bacteria 5563
397 Ga0495670_0036354 3300046691 Bacteria 2454
398 Ga0495671_0000099 3300046692 Bacteria 79624
399 Ga0495671_0000270 3300046692 Bacteria 43565
400 Ga0495671_0001112 3300046692 Bacteria 18576
401 Ga0495671_0005811 3300046692 Bacteria 7187
402 Ga0495671_0012173 3300046692 Bacteria 4702
403 Ga0495649_0000558 3300046694 Bacteria 31491
404 Ga0495649_0012038 3300046694 Bacteria 5049
405 Ga0495649_0016286 3300046694 Bacteria 4214
406 Ga0495649_0020433 3300046694 Bacteria 3715
407 Ga0495649_0055445 3300046694 Bacteria 2141
408 Ga0495589_0000039 3300046794 Bacteria 148833
409 Ga0495589_0000418 3300046794 Bacteria 31752
410 Ga0495589_0002965 3300046794 Bacteria 9349
411 Ga0495589_0006468 3300046794 Bacteria 6177
412 Ga0495589_0006847 3300046794 Bacteria 5993
413 Ga0495589_0019235 3300046794 Bacteria 3502
414 Ga0495600_0002999 3300046809 Bacteria 9859
415 Ga0495660_0000027 3300046810 Bacteria 254331
416 Ga0495660_0000260 3300046810 Bacteria 50150
417 Ga0495660_0000574 3300046810 Bacteria 29507
418 Ga0495660_0001373 3300046810 Bacteria 16759
419 Ga0495660_0002464 3300046810 Bacteria 11810
420 Ga0495660_0017500 3300046810 Bacteria 4125
421 Ga0495660_0056082 3300046810 Bacteria 2130
422 Ga0495581_0002133 3300047315 Bacteria 11155
423 Ga0495581_0003071 3300047315 Bacteria 9552
424 Ga0495581_0003834 3300047315 Bacteria 8646
425 Ga0495604_0001078 3300047317 Bacteria 22621
426 Ga0495604_0002927 3300047317 Bacteria 13672
427 Ga0495604_0013163 3300047317 Bacteria 6586
428 Ga0495604_0033210 3300047317 Bacteria 4085
429 Ga0495636_0000400 3300047318 Bacteria 16239
430 Ga0495636_0001186 3300047318 Bacteria 9827
431 Ga0495674_0001246 3300047319 Bacteria 24703
432 Ga0495672_0000021 3300047320 Bacteria 422795
433 Ga0495672_0000121 3300047320 Bacteria 121680
434 Ga0495672_0000336 3300047320 Bacteria 61206
435 Ga0495672_0000388 3300047320 Bacteria 54085
436 Ga0495672_0000675 3300047320 Bacteria 37966
437 Ga0495672_0000747 3300047320 Bacteria 35632
438 Ga0495672_0001188 3300047320 Bacteria 26360
439 Ga0495672_0012754 3300047320 Bacteria 5842
440 Ga0495672_0077541 3300047320 Bacteria 1862
441 Ga0495676_0000093 3300047321 Bacteria 66312
442 Ga0495676_0018183 3300047321 Bacteria 6201
443 Ga0495676_0034917 3300047321 Bacteria 4213
444 Ga0495676_0076477 3300047321 Bacteria 2556
445 Ga0495680_0019365 3300047322 Bacteria 5745
446 Ga0495680_0025323 3300047322 Bacteria 4912
447 Ga0495683_0000145 3300047323 Bacteria 69835
448 Ga0495683_0000424 3300047323 Bacteria 33785
449 Ga0495683_0010182 3300047323 Bacteria 4980
450 Ga0495683_0011743 3300047323 Bacteria 4606
451 Ga0495683_0015954 3300047323 Bacteria 3902
452 Ga0495687_000008 3300047443 Bacteria 546666
453 Ga0495687_000096 3300047443 Bacteria 133560
454 Ga0495687_000124 3300047443 Bacteria 118111
455 Ga0495687_000266 3300047443 Bacteria 70002
456 Ga0495687_000753 3300047443 Bacteria 35041
457 Ga0495687_000858 3300047443 Bacteria 32396
458 Ga0495687_002774 3300047443 Bacteria 13566
459 Ga0495687_016786 3300047443 Bacteria 3672
460 Ga0495675_0002127 3300047444 Bacteria 11802
461 Ga0495675_0096533 3300047444 Bacteria 1853
462 Ga0495677_0000008 3300047445 Bacteria 175183
463 Ga0495677_0000688 3300047445 Bacteria 13689
464 Ga0495677_0000919 3300047445 Bacteria 11866
465 Ga0495677_0001085 3300047445 Bacteria 10912
466 Ga0495677_0003891 3300047445 Bacteria 5773
467 Ga0495677_0006739 3300047445 Bacteria 4321
468 Ga0495679_000898 3300047446 Bacteria 18688
469 Ga0495679_002023 3300047446 Bacteria 10721
470 Ga0495679_014570 3300047446 Bacteria 2906
471 Ga0495679_021724 3300047446 Bacteria 2209
472 Ga0495685_000177 3300047447 Bacteria 21593
473 Ga0495685_001435 3300047447 Bacteria 7288
474 Ga0495685_002937 3300047447 Bacteria 5391
475 Ga0495685_003735 3300047447 Bacteria 4874
476 Ga0495673_0000003 3300047469 Bacteria 1491337
477 Ga0495673_0000016 3300047469 Bacteria 580643
478 Ga0495673_0000285 3300047469 Bacteria 68361
479 Ga0495673_0004287 3300047469 Bacteria 8995
480 Ga0495673_0016261 3300047469 Bacteria 3808
481 Ga0495681_0002195 3300047470 Bacteria 14120
482 Ga0495681_0002310 3300047470 Bacteria 13715
483 Ga0495681_0005731 3300047470 Bacteria 8263
484 Ga0495681_0009265 3300047470 Bacteria 6086
485 Ga0495681_0011291 3300047470 Bacteria 5329
486 Ga0495681_0021862 3300047470 Bacteria 3436
487 Ga0495681_0026093 3300047470 Bacteria 3049
488 Ga0495681_0040244 3300047470 Bacteria 2277
489 Ga0495686_0000535 3300047472 Bacteria 54274
490 Ga0495686_0001154 3300047472 Bacteria 31042
491 Ga0495686_0001429 3300047472 Bacteria 26101
492 Ga0495686_0005142 3300047472 Bacteria 10438
493 Ga0495686_0006492 3300047472 Bacteria 8937
494 Ga0495686_0006555 3300047472 Bacteria 8882
495 Ga0495686_0009323 3300047472 Bacteria 7083
496 Ga0495686_0017922 3300047472 Bacteria 4761
497 Ga0495593_0001349 3300047673 Bacteria 14350
498 Ga0495593_0006668 3300047673 Bacteria 6755
499 Ga0495593_0022857 3300047673 Bacteria 3479
500 Ga0495602_0001706 3300048088 Bacteria 21869
501 Ga0495602_0013192 3300048088 Bacteria 8455
502 Ga0495614_0005342 3300048089 Bacteria 5796
503 Ga0495614_0006127 3300048089 Bacteria 5405
504 Ga0495626_0000050 3300048091 Bacteria 160905
505 Ga0495626_0000225 3300048091 Bacteria 66619
506 Ga0495626_0000575 3300048091 Bacteria 36385
507 Ga0495626_0001659 3300048091 Bacteria 17185
508 Ga0495626_0005191 3300048091 Bacteria 7714
509 Ga0495626_0011221 3300048091 Bacteria 4745
510 Ga0495626_0012522 3300048091 Bacteria 4442
511 Ga0495626_0018795 3300048091 Bacteria 3462
512 Ga0495626_0024339 3300048091 Bacteria 2969
513 Ga0495626_0033375 3300048091 Bacteria 2467
514 Ga0495626_0034040 3300048091 Bacteria 2439
515 Ga0496102_0000334 3300048905 Bacteria 57709
516 Ga0496102_0000576 3300048905 Bacteria 39006
517 Ga0496102_0085729 3300048905 Bacteria 2908
518 Ga0496103_0001170 3300048906 Bacteria 18045
519 Ga0496104_0218734 3300048907 Bacteria 1817
520 Ga0496109_0005399 3300048912 Bacteria 10687
521 Ga0496110_0000110 3300048913 Bacteria 44789
522 Ga0496113_0010373 3300048916 Bacteria 6157
523 Ga0496113_0086384 3300048916 Bacteria 2410
524 Ga0496114_0001921 3300048917 Bacteria 15826
525 Ga0496114_0091436 3300048917 Bacteria 2585
526 Ga0496116_0040828 3300048919 Bacteria 3190
527 Ga0496117_0000094 3300048920 Bacteria 201853
528 Ga0496118_0000071 3300048921 Bacteria 201853
529 Ga0496121_0001147 3300048924 Bacteria 46460
530 Ga0496121_0070154 3300048924 Bacteria 2824
531 Ga0496122_0000535 3300048925 Bacteria 78641
532 Ga0496122_0004965 3300048925 Bacteria 16116
533 Ga0496122_0009226 3300048925 Bacteria 10441
534 Ga0496122_0029282 3300048925 Bacteria 4647
535 Ga0496122_0100137 3300048925 Bacteria 1940
536 Ga0496123_0000778 3300048926 Bacteria 51674
537 Ga0496123_0001755 3300048926 Bacteria 28623
538 Ga0496123_0003467 3300048926 Bacteria 17624
539 Ga0496123_0015673 3300048926 Bacteria 6202
540 Ga0496123_0060345 3300048926 Bacteria 2446
541 Ga0496124_0002043 3300048927 Bacteria 27439
542 Ga0496124_0015907 3300048927 Bacteria 7184
543 Ga0496124_0044784 3300048927 Bacteria 3795
544 Ga0496124_0049841 3300048927 Bacteria 3570
545 Ga0496125_0000530 3300048928 Bacteria 65734
546 Ga0496125_0001715 3300048928 Bacteria 30509
547 Ga0496125_0006030 3300048928 Bacteria 13255
548 Ga0496126_0012091 3300048929 Bacteria 8864
549 Ga0496126_0026856 3300048929 Bacteria 5512
550 Ga0495678_000030 3300049459 Bacteria 217986
551 Ga0495678_000251 3300049459 Bacteria 60106
552 Ga0495678_000331 3300049459 Bacteria 49785
553 Ga0495678_000341 3300049459 Bacteria 48737
554 Ga0495678_000772 3300049459 Bacteria 28907
555 Ga0495678_001595 3300049459 Bacteria 17367
556 Ga0495678_005567 3300049459 Bacteria 6901
557 Ga0495682_0000710 3300049460 Bacteria 21826
558 Ga0495682_0010478 3300049460 Bacteria 3589
559 Ga0495682_0016007 3300049460 Bacteria 2838
560 Ga0501198_000027 3300049649 Bacteria 65442
561 Ga0501222_000026 3300049662 Bacteria 63988
562 Ga0501269_000362 3300049766 Bacteria 11337
563 Ga0501280_000199 3300049776 Bacteria 15090
564 Ga0501035_0000902 3300049822 Bacteria 31396
565 Ga0500644_0005591 3300053088 Bacteria 3179
566 Ga0500562_026034 3300053108 Bacteria 1532
567 Ga0500618_000179 3300053125 Bacteria 52538
568 Ga0500559_0000021 3300053136 Bacteria 129980
569 Ga0500622_0002795 3300053156 Bacteria 12264
570 Ga0500645_017360 3300053730 Bacteria 2257

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048907 Ga0496104_0218734 Ga0496104_0218734_30_1559 412
2 3300047446 Ga0495679_014570 Ga0495679_014570_18_1508 413
3 3300053108 Ga0500562_026034 Ga0500562_026034_126_1514 415
4 3300046538 Ga0495609_0008996 Ga0495609_0008996_3355_4839 422
5 3300047444 Ga0495675_0096533 Ga0495675_0096533_12_1478 445
6 3300046474 Ga0495605_0054144 Ga0495605_0054144_11_1612 456
7 3300046523 Ga0495644_0008710 Ga0495644_0008710_37_1677 462
8 3300046528 Ga0495642_0046060 Ga0495642_0046060_158_1762 465
9 3300046499 Ga0495594_0052183 Ga0495594_0052183_17_1576 466
10 3300044683 Ga0466965_0079099 Ga0466965_0079099_67_1647 468
11 3300048929 Ga0496126_0026856 Ga0496126_0026856_1845_3563 471
12 3300046463 Ga0495653_0014764 Ga0495653_0014764_116_1750 474
13 3300042115 Ga0450911_002086 Ga0450911_002086_2312_4021 480
14 3300047321 Ga0495676_0034917 Ga0495676_0034917_2198_3880 480
15 3300042004 Ga0439445_0007381 Ga0439445_0007381_305_1999 482
16 3300042115 Ga0450911_000208 Ga0450911_000208_17818_19512 482
17 3300048927 Ga0496124_0015907 Ga0496124_0015907_608_2302 482
18 3300044683 Ga0466965_0005156 Ga0466965_0005156_3410_5200 483
19 3300045049 Ga0466959_0032735 Ga0466959_0032735_173_1963 483
20 3300047469 Ga0495673_0000285 Ga0495673_0000285_50784_52535 483
21 3300048924 Ga0496121_0001147 Ga0496121_0001147_17614_19305 483
22 3300048928 Ga0496125_0001715 Ga0496125_0001715_4402_6093 483
23 3300048928 Ga0496125_0006030 Ga0496125_0006030_6444_8132 483
24 3300003771 Ga0055526_1001845 Ga0055526_10018457 484
25 3300003775 Ga0055524_1002401 Ga0055524_10024014 484
26 3300003791 Ga0055530_10007328 Ga0055530_100073283 484
27 3300025263 Ga0209565_1002115 Ga0209565_10021156 484
28 3300025291 Ga0209675_1001675 Ga0209675_10016756 484
29 3300025295 Ga0209564_1000109 Ga0209564_100010957 484
30 3300025298 Ga0209050_1000074 Ga0209050_100007456 484
31 3300025299 Ga0209256_1000928 Ga0209256_100092839 484
32 3300046507 Ga0495606_0000429 Ga0495606_0000429_63492_65261 484
33 3300048091 Ga0495626_0034040 Ga0495626_0034040_314_2026 484
34 3300025246 Ga0209646_1000051 Ga0209646_1000051173 485
35 3300031649 Ga0307514_10000369 Ga0307514_1000036970 485
36 3300044842 Ga0466957_0002510 Ga0466957_0002510_1077_2867 485
37 3300047470 Ga0495681_0009265 Ga0495681_0009265_1430_3160 485
38 3300048091 Ga0495626_0005191 Ga0495626_0005191_1074_2819 485
39 3300049459 Ga0495678_000251 Ga0495678_000251_57861_59603 485
40 3300049460 Ga0495682_0000710 Ga0495682_0000710_19349_21091 485
41 3300046501 Ga0495607_0001471 Ga0495607_0001471_3186_4931 486
42 3300046528 Ga0495642_0020731 Ga0495642_0020731_791_2536 486
43 3300046538 Ga0495609_0000046 Ga0495609_0000046_115494_117239 486
44 3300046665 Ga0495661_0003691 Ga0495661_0003691_2203_3948 486
45 3300046794 Ga0495589_0000039 Ga0495589_0000039_109742_111487 486
46 3300047321 Ga0495676_0000093 Ga0495676_0000093_30814_32538 486
47 3300047443 Ga0495687_000008 Ga0495687_000008_385575_387320 486
48 3300047443 Ga0495687_000124 Ga0495687_000124_88705_90435 486
49 3300047445 Ga0495677_0000008 Ga0495677_0000008_140096_141841 486
50 3300003759 Ga0055525_1000006 Ga0055525_1000006426 487
51 3300025230 Ga0209563_100022 Ga0209563_100022424 487
52 3300025932 Ga0207690_10014338 Ga0207690_100143384 487
53 3300037418 Ga0395900_0011234 Ga0395900_0011234_781_2529 487
54 3300046491 Ga0495584_0004831 Ga0495584_0004831_1035_2753 487
55 3300046492 Ga0495585_0004719 Ga0495585_0004719_4339_6057 487
56 3300046506 Ga0495583_0000687 Ga0495583_0000687_22744_24462 487
57 3300046507 Ga0495606_0001743 Ga0495606_0001743_19886_21646 487
58 3300046513 Ga0495616_0000274 Ga0495616_0000274_15895_17604 487
59 3300046518 Ga0495631_0005436 Ga0495631_0005436_1651_3369 487
60 3300046519 Ga0495632_0018553 Ga0495632_0018553_1687_3405 487
61 3300046528 Ga0495642_0001349 Ga0495642_0001349_697_2442 487
62 3300046558 Ga0495633_0006401 Ga0495633_0006401_1581_3299 487
63 3300046648 Ga0495611_0003410 Ga0495611_0003410_3963_5681 487
64 3300046665 Ga0495661_0008435 Ga0495661_0008435_2965_4683 487
65 3300046691 Ga0495670_0006989 Ga0495670_0006989_2748_4466 487
66 3300046794 Ga0495589_0006847 Ga0495589_0006847_2847_4565 487
67 3300046810 Ga0495660_0002464 Ga0495660_0002464_2827_4545 487
68 3300047443 Ga0495687_000266 Ga0495687_000266_38491_40251 487
69 3300047445 Ga0495677_0006739 Ga0495677_0006739_211_1920 487
70 3300047470 Ga0495681_0002195 Ga0495681_0002195_43_1761 487
71 3300048905 Ga0496102_0000576 Ga0496102_0000576_10645_12309 487
72 3300048916 Ga0496113_0010373 Ga0496113_0010373_2512_4251 487
73 3300048925 Ga0496122_0029282 Ga0496122_0029282_1924_3663 487
74 3300048926 Ga0496123_0060345 Ga0496123_0060345_467_2206 487
75 3300003771 Ga0055526_1000936 Ga0055526_100093612 488
76 3300025295 Ga0209564_1000089 Ga0209564_1000089106 488
77 3300037471 Ga0395905_0052305 Ga0395905_0052305_1583_3337 488
78 3300046452 Ga0495617_001276 Ga0495617_001276_143_1861 488
79 3300046491 Ga0495584_0000015 Ga0495584_0000015_139773_141479 488
80 3300046491 Ga0495584_0000050 Ga0495584_0000050_63276_65033 488
81 3300046492 Ga0495585_0000278 Ga0495585_0000278_17391_19109 488
82 3300046492 Ga0495585_0000645 Ga0495585_0000645_7496_9211 488
83 3300046506 Ga0495583_0000064 Ga0495583_0000064_82048_83760 488
84 3300046506 Ga0495583_0001073 Ga0495583_0001073_500_2215 488
85 3300046507 Ga0495606_0022532 Ga0495606_0022532_2241_3947 488
86 3300046513 Ga0495616_0000392 Ga0495616_0000392_22390_24108 488
87 3300046513 Ga0495616_0003461 Ga0495616_0003461_551_2266 488
88 3300046515 Ga0495620_0000974 Ga0495620_0000974_7932_9644 488
89 3300046524 Ga0495648_0000136 Ga0495648_0000136_67243_68961 488
90 3300046528 Ga0495642_0000395 Ga0495642_0000395_8085_9797 488
91 3300046558 Ga0495633_0006490 Ga0495633_0006490_2612_4327 488
92 3300046616 Ga0495668_0004560 Ga0495668_0004560_2354_4069 488
93 3300046810 Ga0495660_0017500 Ga0495660_0017500_1000_2712 488
94 3300047322 Ga0495680_0025323 Ga0495680_0025323_2147_3853 488
95 3300047323 Ga0495683_0000145 Ga0495683_0000145_38320_40035 488
96 3300047323 Ga0495683_0011743 Ga0495683_0011743_2501_4219 488
97 3300047470 Ga0495681_0021862 Ga0495681_0021862_1596_3308 488
98 3300015261 Ga0182006_1000029 Ga0182006_100002971 489
99 3300015265 Ga0182005_1000012 Ga0182005_100001217 489
100 3300044706 Ga0466964_0000399 Ga0466964_0000399_123_1889 489
101 3300046491 Ga0495584_0008115 Ga0495584_0008115_2755_4503 489
102 3300046492 Ga0495585_0000055 Ga0495585_0000055_79952_81661 489
103 3300046507 Ga0495606_0000095 Ga0495606_0000095_146883_148655 489
104 3300046530 Ga0495654_0026571 Ga0495654_0026571_266_2014 489
105 3300046535 Ga0495586_0032101 Ga0495586_0032101_1030_2736 489
106 3300046542 Ga0495597_0003998 Ga0495597_0003998_1424_3172 489
107 3300046616 Ga0495668_0031910 Ga0495668_0031910_332_2080 489
108 3300046663 Ga0495635_0006103 Ga0495635_0006103_6305_8011 489
109 3300047317 Ga0495604_0033210 Ga0495604_0033210_1396_3102 489
110 3300047673 Ga0495593_0001349 Ga0495593_0001349_4767_6473 489
111 3300048089 Ga0495614_0005342 Ga0495614_0005342_1431_3137 489
112 3300005262 Ga0065165_1000666 Ga0065165_100066636 490
113 3300037312 Ga0395899_0112545 Ga0395899_0112545_39_1799 490
114 3300042139 Ga0450904_000143 Ga0450904_000143_3588_5330 490
115 3300046452 Ga0495617_000985 Ga0495617_000985_11274_13019 490
116 3300046463 Ga0495653_0000024 Ga0495653_0000024_20779_22551 490
117 3300046501 Ga0495607_0002219 Ga0495607_0002219_10861_12630 490
118 3300046507 Ga0495606_0004586 Ga0495606_0004586_8181_9950 490
119 3300046522 Ga0495643_0000976 Ga0495643_0000976_3657_5378 490
120 3300046522 Ga0495643_0004008 Ga0495643_0004008_2392_4155 490
121 3300047320 Ga0495672_0000336 Ga0495672_0000336_52054_53817 490
122 3300047320 Ga0495672_0077541 Ga0495672_0077541_77_1804 490
123 3300048091 Ga0495626_0000225 Ga0495626_0000225_58749_60494 490
124 3300049459 Ga0495678_005567 Ga0495678_005567_888_2651 490
125 3300046455 Ga0495603_0004950 Ga0495603_0004950_5640_7385 491
126 3300046471 Ga0495650_0000019 Ga0495650_0000019_260254_262044 491
127 3300046492 Ga0495585_0012728 Ga0495585_0012728_283_2007 491
128 3300046499 Ga0495594_0002666 Ga0495594_0002666_7481_9226 491
129 3300046507 Ga0495606_0000403 Ga0495606_0000403_19979_21724 491
130 3300046513 Ga0495616_0000711 Ga0495616_0000711_8103_9848 491
131 3300046518 Ga0495631_0020755 Ga0495631_0020755_1304_3049 491
132 3300046519 Ga0495632_0001033 Ga0495632_0001033_19824_21569 491
133 3300046528 Ga0495642_0003270 Ga0495642_0003270_4649_6394 491
134 3300046530 Ga0495654_0006348 Ga0495654_0006348_2165_3910 491
135 3300046665 Ga0495661_0052846 Ga0495661_0052846_207_1928 491
136 3300046684 Ga0495669_0000048 Ga0495669_0000048_33794_35518 491
137 3300046684 Ga0495669_0000564 Ga0495669_0000564_5088_6809 491
138 3300046684 Ga0495669_0001222 Ga0495669_0001222_2484_4229 491
139 3300046689 Ga0495613_0044494 Ga0495613_0044494_885_2609 491
140 3300047315 Ga0495581_0003071 Ga0495581_0003071_230_1954 491
141 3300048089 Ga0495614_0006127 Ga0495614_0006127_2898_4622 491
142 3300048091 Ga0495626_0033375 Ga0495626_0033375_311_2035 491
143 3300046457 Ga0495590_0000001 Ga0495590_0000001_27120_28892 492
144 3300046457 Ga0495590_0000045 Ga0495590_0000045_36209_37957 492
145 3300046458 Ga0495591_000153 Ga0495591_000153_31216_32964 492
146 3300046460 Ga0495638_0000017 Ga0495638_0000017_332129_333901 492
147 3300046471 Ga0495650_0000627 Ga0495650_0000627_7245_9017 492
148 3300046475 Ga0495639_0011758 Ga0495639_0011758_1658_3430 492
149 3300046492 Ga0495585_0004224 Ga0495585_0004224_6145_7857 492
150 3300046492 Ga0495585_0042299 Ga0495585_0042299_510_2258 492
151 3300046501 Ga0495607_0042484 Ga0495607_0042484_166_1914 492
152 3300046506 Ga0495583_0000270 Ga0495583_0000270_59015_60787 492
153 3300046512 Ga0495610_0004996 Ga0495610_0004996_780_2528 492
154 3300046519 Ga0495632_0041571 Ga0495632_0041571_166_1914 492
155 3300046520 Ga0495637_0000011 Ga0495637_0000011_171486_173234 492
156 3300046522 Ga0495643_0002429 Ga0495643_0002429_2398_4170 492
157 3300046524 Ga0495648_0000040 Ga0495648_0000040_57310_59082 492
158 3300046528 Ga0495642_0003779 Ga0495642_0003779_1794_3566 492
159 3300046542 Ga0495597_0002009 Ga0495597_0002009_11047_12819 492
160 3300046557 Ga0495622_0000421 Ga0495622_0000421_13921_15693 492
161 3300046558 Ga0495633_0000141 Ga0495633_0000141_69421_71193 492
162 3300046558 Ga0495633_0034680 Ga0495633_0034680_464_2176 492
163 3300046616 Ga0495668_0000472 Ga0495668_0000472_2475_4247 492
164 3300046616 Ga0495668_0000651 Ga0495668_0000651_8131_9870 492
165 3300046660 Ga0495625_0000244 Ga0495625_0000244_24716_26488 492
166 3300046665 Ga0495661_0017964 Ga0495661_0017964_2445_4193 492
167 3300046794 Ga0495589_0002965 Ga0495589_0002965_780_2528 492
168 3300047320 Ga0495672_0000675 Ga0495672_0000675_29157_30905 492
169 3300047323 Ga0495683_0000424 Ga0495683_0000424_31872_33620 492
170 3300047443 Ga0495687_002774 Ga0495687_002774_4038_5810 492
171 3300047445 Ga0495677_0000919 Ga0495677_0000919_7592_9340 492
172 3300047446 Ga0495679_002023 Ga0495679_002023_4674_6422 492
173 3300047470 Ga0495681_0026093 Ga0495681_0026093_562_2310 492
174 3300047470 Ga0495681_0040244 Ga0495681_0040244_519_2231 492
175 3300037312 Ga0395899_0000098 Ga0395899_0000098_8183_9853 493
176 3300046499 Ga0495594_0004551 Ga0495594_0004551_3252_4973 493
177 3300046506 Ga0495583_0001144 Ga0495583_0001144_8706_10445 493
178 3300046522 Ga0495643_0006347 Ga0495643_0006347_2178_3905 493
179 3300046522 Ga0495643_0058176 Ga0495643_0058176_145_1893 493
180 3300046660 Ga0495625_0026763 Ga0495625_0026763_1470_3194 493
181 3300046660 Ga0495625_0035662 Ga0495625_0035662_1766_3484 493
182 3300046665 Ga0495661_0031078 Ga0495661_0031078_49_1806 493
183 3300046694 Ga0495649_0000558 Ga0495649_0000558_15358_17106 493
184 3300046694 Ga0495649_0012038 Ga0495649_0012038_2654_4381 493
185 3300047443 Ga0495687_016786 Ga0495687_016786_184_1923 493
186 3300047470 Ga0495681_0005731 Ga0495681_0005731_784_2565 493
187 3300047470 Ga0495681_0011291 Ga0495681_0011291_3090_4826 493
188 3300048091 Ga0495626_0000575 Ga0495626_0000575_5755_7503 493
189 3300048091 Ga0495626_0018795 Ga0495626_0018795_406_2133 493
190 3300049459 Ga0495678_000331 Ga0495678_000331_43136_44884 493
191 iso_pu_bacteria 2643221638 2644211585 493
192 3300046471 Ga0495650_0004013 Ga0495650_0004013_8533_10308 494
193 3300046474 Ga0495605_0003267 Ga0495605_0003267_280_2034 494
194 3300046491 Ga0495584_0012904 Ga0495584_0012904_51_1742 494
195 3300046491 Ga0495584_0031185 Ga0495584_0031185_785_2533 494
196 3300046500 Ga0495596_0007775 Ga0495596_0007775_2625_4373 494
197 3300046501 Ga0495607_0001771 Ga0495607_0001771_6017_7780 494
198 3300046506 Ga0495583_0001801 Ga0495583_0001801_10681_12444 494
199 3300046513 Ga0495616_0004562 Ga0495616_0004562_5360_7123 494
200 3300046518 Ga0495631_0003719 Ga0495631_0003719_1269_2960 494
201 3300046519 Ga0495632_0000387 Ga0495632_0000387_32161_33894 494
202 3300046522 Ga0495643_0014915 Ga0495643_0014915_178_1932 494
203 3300046538 Ga0495609_0002620 Ga0495609_0002620_4896_6659 494
204 3300046616 Ga0495668_0042740 Ga0495668_0042740_394_2142 494
205 3300046648 Ga0495611_0001075 Ga0495611_0001075_10009_11757 494
206 3300046648 Ga0495611_0017891 Ga0495611_0017891_985_2715 494
207 3300046660 Ga0495625_0002152 Ga0495625_0002152_8837_10600 494
208 3300046684 Ga0495669_0001152 Ga0495669_0001152_5936_7699 494
209 3300046694 Ga0495649_0020433 Ga0495649_0020433_1658_3412 494
210 3300046794 Ga0495589_0000418 Ga0495589_0000418_15944_17698 494
211 3300046810 Ga0495660_0000027 Ga0495660_0000027_41876_43630 494
212 3300047318 Ga0495636_0001186 Ga0495636_0001186_5601_7292 494
213 3300047320 Ga0495672_0000747 Ga0495672_0000747_858_2612 494
214 3300047443 Ga0495687_000858 Ga0495687_000858_28805_30559 494
215 3300047445 Ga0495677_0000688 Ga0495677_0000688_2851_4614 494
216 3300047447 Ga0495685_001435 Ga0495685_001435_2132_3895 494
217 3300047470 Ga0495681_0002310 Ga0495681_0002310_7667_9430 494
218 3300048091 Ga0495626_0000050 Ga0495626_0000050_116993_118747 494
219 3300049459 Ga0495678_001595 Ga0495678_001595_7559_9292 494
220 3300002773 JGI25152J39213_1000260 JGI25152J39213_100026039 495
221 3300002774 JGI25150J39212_1002819 JGI25150J39212_10028195 495
222 3300013102 Ga0157371_10000010 Ga0157371_1000001032 495
223 3300025245 Ga0207425_1000001 Ga0207425_1000001945 495
224 3300025258 Ga0209129_1000001 Ga0209129_1000001122 495
225 3300025263 Ga0209565_1005707 Ga0209565_10057073 495
226 3300025297 Ga0209758_1000020 Ga0209758_1000020331 495
227 3300025909 Ga0207705_10001211 Ga0207705_1000121113 495
228 3300025935 Ga0207709_10005411 Ga0207709_100054113 495
229 3300042005 Ga0439448_0009885 Ga0439448_0009885_224_1990 495
230 3300046452 Ga0495617_000015 Ga0495617_000015_221556_223295 495
231 3300046453 Ga0495627_000320 Ga0495627_000320_22515_24254 495
232 3300046455 Ga0495603_0007763 Ga0495603_0007763_2658_4352 495
233 3300046472 Ga0495580_0067683 Ga0495580_0067683_683_2374 495
234 3300046474 Ga0495605_0000021 Ga0495605_0000021_212920_214659 495
235 3300046492 Ga0495585_0022735 Ga0495585_0022735_1623_3362 495
236 3300046500 Ga0495596_0007218 Ga0495596_0007218_2552_4291 495
237 3300046501 Ga0495607_0026998 Ga0495607_0026998_780_2519 495
238 3300046513 Ga0495616_0013354 Ga0495616_0013354_170_1888 495
239 3300046518 Ga0495631_0041527 Ga0495631_0041527_207_1946 495
240 3300046523 Ga0495644_0022196 Ga0495644_0022196_591_2330 495
241 3300046524 Ga0495648_0000707 Ga0495648_0000707_17897_19636 495
242 3300046526 Ga0495666_0011863 Ga0495666_0011863_1074_2765 495
243 3300046528 Ga0495642_0001159 Ga0495642_0001159_2671_4410 495
244 3300046528 Ga0495642_0026054 Ga0495642_0026054_170_1888 495
245 3300046531 Ga0495665_0007299 Ga0495665_0007299_3965_5656 495
246 3300046538 Ga0495609_0007629 Ga0495609_0007629_1177_2895 495
247 3300046557 Ga0495622_0000661 Ga0495622_0000661_10668_12359 495
248 3300046557 Ga0495622_0007489 Ga0495622_0007489_1274_2968 495
249 3300046615 Ga0495656_0030386 Ga0495656_0030386_76_1815 495
250 3300046616 Ga0495668_0001314 Ga0495668_0001314_744_2483 495
251 3300046690 Ga0495624_0001671 Ga0495624_0001671_9199_10890 495
252 3300046692 Ga0495671_0001112 Ga0495671_0001112_16760_18499 495
253 3300046794 Ga0495589_0019235 Ga0495589_0019235_179_1918 495
254 3300046810 Ga0495660_0000260 Ga0495660_0000260_8832_10613 495
255 3300047315 Ga0495581_0003834 Ga0495581_0003834_2496_4187 495
256 3300047317 Ga0495604_0001078 Ga0495604_0001078_5743_7434 495
257 3300047321 Ga0495676_0018183 Ga0495676_0018183_3170_4864 495
258 3300047445 Ga0495677_0001085 Ga0495677_0001085_74_1813 495
259 3300048088 Ga0495602_0001706 Ga0495602_0001706_18507_20225 495
260 3300048906 Ga0496103_0001170 Ga0496103_0001170_15529_17292 495
261 3300049459 Ga0495678_000030 Ga0495678_000030_143190_144962 495
262 3300049460 Ga0495682_0016007 Ga0495682_0016007_960_2678 495
263 3300049766 Ga0501269_000362 Ga0501269_000362_7587_9347 495
264 iso_pu_bacteria 2547132103 2547376278 495
265 iso_pu_bacteria 2843690924 2843694050 495
266 iso_pu_bacteria 2846033681 2846034561 495
267 iso_pu_bacteria 2846037992 2846038602 495
268 3300046460 Ga0495638_0002577 Ga0495638_0002577_6883_8601 496
269 3300046460 Ga0495638_0034280 Ga0495638_0034280_266_1984 496
270 3300046474 Ga0495605_0011870 Ga0495605_0011870_2581_4299 496
271 3300046491 Ga0495584_0000511 Ga0495584_0000511_3057_4775 496
272 3300046492 Ga0495585_0029677 Ga0495585_0029677_918_2636 496
273 3300046506 Ga0495583_0000140 Ga0495583_0000140_65299_67017 496
274 3300046506 Ga0495583_0027917 Ga0495583_0027917_181_1899 496
275 3300046512 Ga0495610_0021523 Ga0495610_0021523_1281_2999 496
276 3300046513 Ga0495616_0013290 Ga0495616_0013290_1654_3372 496
277 3300046523 Ga0495644_0005672 Ga0495644_0005672_2775_4499 496
278 3300046524 Ga0495648_0001392 Ga0495648_0001392_13602_15320 496
279 3300046538 Ga0495609_0019604 Ga0495609_0019604_833_2569 496
280 3300046542 Ga0495597_0000819 Ga0495597_0000819_22100_23839 496
281 3300046543 Ga0495645_0039203 Ga0495645_0039203_1473_3227 496
282 3300046558 Ga0495633_0002287 Ga0495633_0002287_4239_5960 496
283 3300046615 Ga0495656_0006648 Ga0495656_0006648_1867_3585 496
284 3300046616 Ga0495668_0004390 Ga0495668_0004390_6933_8651 496
285 3300046648 Ga0495611_0016125 Ga0495611_0016125_707_2425 496
286 3300046660 Ga0495625_0027805 Ga0495625_0027805_2304_4022 496
287 3300046664 Ga0495659_0000183 Ga0495659_0000183_8855_10573 496
288 3300046692 Ga0495671_0012173 Ga0495671_0012173_1395_3113 496
289 3300046694 Ga0495649_0055445 Ga0495649_0055445_188_1927 496
290 3300047318 Ga0495636_0000400 Ga0495636_0000400_547_2265 496
291 3300047320 Ga0495672_0012754 Ga0495672_0012754_2497_4215 496
292 3300047323 Ga0495683_0010182 Ga0495683_0010182_2017_3735 496
293 3300047323 Ga0495683_0015954 Ga0495683_0015954_1487_3205 496
294 3300047443 Ga0495687_000753 Ga0495687_000753_18712_20430 496
295 3300047445 Ga0495677_0003891 Ga0495677_0003891_2466_4184 496
296 3300047446 Ga0495679_021724 Ga0495679_021724_156_1883 496
297 3300047447 Ga0495685_000177 Ga0495685_000177_14559_16277 496
298 3300047447 Ga0495685_003735 Ga0495685_003735_1066_2784 496
299 3300047469 Ga0495673_0004287 Ga0495673_0004287_1555_3273 496
300 3300048091 Ga0495626_0011221 Ga0495626_0011221_1916_3634 496
301 3300048926 Ga0496123_0001755 Ga0496123_0001755_14164_15936 496
302 3300049459 Ga0495678_000341 Ga0495678_000341_1255_2973 496
303 3300046501 Ga0495607_0022508 Ga0495607_0022508_1560_3314 497
304 3300046506 Ga0495583_0000605 Ga0495583_0000605_1358_3100 497
305 3300046506 Ga0495583_0012363 Ga0495583_0012363_170_1903 497
306 3300046518 Ga0495631_0001656 Ga0495631_0001656_11314_13047 497
307 3300046524 Ga0495648_0022978 Ga0495648_0022978_2349_4085 497
308 3300046538 Ga0495609_0015571 Ga0495609_0015571_238_1977 497
309 3300046616 Ga0495668_0000596 Ga0495668_0000596_32211_33944 497
310 3300046674 Ga0495588_0037589 Ga0495588_0037589_307_2043 497
311 3300046692 Ga0495671_0005811 Ga0495671_0005811_447_2183 497
312 3300047446 Ga0495679_000898 Ga0495679_000898_14657_16393 497
313 3300049459 Ga0495678_000772 Ga0495678_000772_447_2183 497
314 3300005339 Ga0070660_100056906 Ga0070660_1000569062 498
315 3300005344 Ga0070661_100001791 Ga0070661_10000179112 498
316 3300005564 Ga0070664_100073780 Ga0070664_1000737803 498
317 3300009174 Ga0105241_10010903 Ga0105241_100109037 498
318 3300025263 Ga0209565_1003811 Ga0209565_10038112 498
319 3300025911 Ga0207654_10011693 Ga0207654_100116933 498
320 3300025945 Ga0207679_10002156 Ga0207679_100021566 498
321 3300025949 Ga0207667_10098598 Ga0207667_100985982 498
322 3300044656 Ga0466969_0039263 Ga0466969_0039263_385_2139 498
323 3300044684 Ga0466966_0053207 Ga0466966_0053207_768_2522 498
324 3300044735 Ga0466968_0000664 Ga0466968_0000664_4680_6434 498
325 3300046453 Ga0495627_000057 Ga0495627_000057_110734_112506 498
326 3300046507 Ga0495606_0027894 Ga0495606_0027894_1269_3011 498
327 3300046512 Ga0495610_0004916 Ga0495610_0004916_7059_8801 498
328 3300046542 Ga0495597_0002464 Ga0495597_0002464_6036_7703 498
329 3300046660 Ga0495625_0000695 Ga0495625_0000695_40450_42225 498
330 3300048905 Ga0496102_0000334 Ga0496102_0000334_25132_26868 498
331 3300049822 Ga0501035_0000902 Ga0501035_0000902_3050_4801 498
332 3300003775 Ga0055524_1009711 Ga0055524_10097112 499
333 3300025299 Ga0209256_1000028 Ga0209256_1000028303 499
334 3300046471 Ga0495650_0000425 Ga0495650_0000425_38710_40437 499
335 3300046558 Ga0495633_0004185 Ga0495633_0004185_2328_4058 499
336 3300046660 Ga0495625_0024384 Ga0495625_0024384_1040_2722 499
337 3300048917 Ga0496114_0091436 Ga0496114_0091436_612_2372 499
338 3300048924 Ga0496121_0070154 Ga0496121_0070154_114_1844 499
339 3300049460 Ga0495682_0010478 Ga0495682_0010478_267_2000 499
340 3300014497 Ga0182008_10000994 Ga0182008_1000099413 500
341 3300015261 Ga0182006_1000175 Ga0182006_100017513 500
342 3300015262 Ga0182007_10000109 Ga0182007_1000010913 500
343 3300015265 Ga0182005_1000094 Ga0182005_100009413 500
344 3300046459 Ga0495629_0010302 Ga0495629_0010302_1214_2884 500
345 3300046500 Ga0495596_0000342 Ga0495596_0000342_26219_27946 500
346 3300046538 Ga0495609_0000617 Ga0495609_0000617_22553_24280 500
347 3300046557 Ga0495622_0000001 Ga0495622_0000001_24992_26773 500
348 3300047319 Ga0495674_0001246 Ga0495674_0001246_13476_15149 500
349 3300047320 Ga0495672_0001188 Ga0495672_0001188_22762_24489 500
350 3300047321 Ga0495676_0076477 Ga0495676_0076477_90_1817 500
351 3300048920 Ga0496117_0000094 Ga0496117_0000094_55468_57204 500
352 3300048921 Ga0496118_0000071 Ga0496118_0000071_55468_57204 500
353 3300048925 Ga0496122_0004965 Ga0496122_0004965_4787_6523 500
354 3300048925 Ga0496122_0100137 Ga0496122_0100137_78_1850 500
355 3300048926 Ga0496123_0003467 Ga0496123_0003467_7383_9119 500
356 3300049649 Ga0501198_000027 Ga0501198_000027_33300_34955 500
357 3300049662 Ga0501222_000026 Ga0501222_000026_33179_34834 500
358 3300005344 Ga0070661_100034253 Ga0070661_1000342532 501
359 3300044706 Ga0466964_0000497 Ga0466964_0000497_5934_7688 501
360 3300046492 Ga0495585_0021251 Ga0495585_0021251_403_2139 501
361 3300046542 Ga0495597_0000021 Ga0495597_0000021_138387_140126 501
362 3300046665 Ga0495661_0001135 Ga0495661_0001135_7990_9744 501
363 3300046665 Ga0495661_0028762 Ga0495661_0028762_223_1959 501
364 3300046674 Ga0495588_0000105 Ga0495588_0000105_110303_112054 501
365 3300048927 Ga0496124_0002043 Ga0496124_0002043_24174_25874 501
366 3300046472 Ga0495580_0032448 Ga0495580_0032448_1772_3490 502
367 3300046473 Ga0495582_0001514 Ga0495582_0001514_7753_9471 502
368 3300046529 Ga0495652_0002899 Ga0495652_0002899_2622_4340 502
369 3300046642 Ga0495634_0002179 Ga0495634_0002179_48_1766 502
370 3300046679 Ga0495623_0002282 Ga0495623_0002282_5321_7039 502
371 3300047317 Ga0495604_0002927 Ga0495604_0002927_11437_13155 502
372 3300047443 Ga0495687_000096 Ga0495687_000096_39979_41718 502
373 3300047444 Ga0495675_0002127 Ga0495675_0002127_2520_4238 502
374 3300044684 Ga0466966_0044146 Ga0466966_0044146_271_2028 503
375 3300045976 Ga0466967_0019728 Ga0466967_0019728_1468_3246 503
376 3300006946 Ga0079104_1000252 Ga0079104_100025227 504
377 3300021361 Ga0213872_10000001 Ga0213872_10000001373 504
378 3300025254 Ga0209148_1000638 Ga0209148_100063829 504
379 3300027111 Ga0209281_1000196 Ga0209281_100019644 504
380 3300039447 Ga0436361_0287651 Ga0436361_0287651_9631_11427 504
381 3300046459 Ga0495629_0031496 Ga0495629_0031496_908_2581 504
382 3300046463 Ga0495653_0063637 Ga0495653_0063637_889_2562 504
383 3300046474 Ga0495605_0000028 Ga0495605_0000028_84725_86503 504
384 3300046512 Ga0495610_0000003 Ga0495610_0000003_1141432_1143204 504
385 3300046517 Ga0495630_0029903 Ga0495630_0029903_518_2191 504
386 3300046519 Ga0495632_0006426 Ga0495632_0006426_3315_5099 504
387 3300046522 Ga0495643_0001500 Ga0495643_0001500_18754_20499 504
388 3300046526 Ga0495666_0002140 Ga0495666_0002140_2791_4464 504
389 3300046531 Ga0495665_0010862 Ga0495665_0010862_917_2590 504
390 3300046535 Ga0495586_0011402 Ga0495586_0011402_2954_4627 504
391 3300046536 Ga0495587_0037835 Ga0495587_0037835_10_1683 504
392 3300046679 Ga0495623_0019734 Ga0495623_0019734_2464_4137 504
393 3300046680 Ga0495646_0024021 Ga0495646_0024021_591_2264 504
394 3300046809 Ga0495600_0002999 Ga0495600_0002999_6097_7770 504
395 3300047315 Ga0495581_0002133 Ga0495581_0002133_7983_9656 504
396 3300047317 Ga0495604_0013163 Ga0495604_0013163_1619_3292 504
397 3300047320 Ga0495672_0000388 Ga0495672_0000388_22424_24178 504
398 3300047472 Ga0495686_0001154 Ga0495686_0001154_22578_24311 504
399 3300047673 Ga0495593_0006668 Ga0495593_0006668_2327_4000 504
400 3300048088 Ga0495602_0013192 Ga0495602_0013192_5894_7567 504
401 3300048919 Ga0496116_0040828 Ga0496116_0040828_1311_3092 504
402 3300003775 Ga0055524_1000094 Ga0055524_10000944 505
403 3300025299 Ga0209256_1000071 Ga0209256_1000071176 505
404 3300046452 Ga0495617_000003 Ga0495617_000003_449652_451424 505
405 3300046492 Ga0495585_0001799 Ga0495585_0001799_13685_15457 505
406 3300046530 Ga0495654_0017950 Ga0495654_0017950_158_1930 505
407 3300046558 Ga0495633_0032627 Ga0495633_0032627_382_2154 505
408 3300046616 Ga0495668_0004016 Ga0495668_0004016_4331_6103 505
409 3300046665 Ga0495661_0005206 Ga0495661_0005206_5741_7513 505
410 3300047469 Ga0495673_0000016 Ga0495673_0000016_62069_63841 505
411 3300048917 Ga0496114_0001921 Ga0496114_0001921_7964_9637 505
412 3300048925 Ga0496122_0009226 Ga0496122_0009226_8492_10228 505
413 3300048926 Ga0496123_0015673 Ga0496123_0015673_1535_3271 505
414 3300048927 Ga0496124_0044784 Ga0496124_0044784_1957_3723 505
415 iso_pu_bacteria 2600255292 2601669728 505
416 iso_pu_bacteria 2643221556 2643796670 505
417 iso_pu_bacteria 2643221684 2644470225 505
418 iso_pu_bacteria 2808606418 2809141966 505
419 iso_pu_bacteria 2857547612 2857551204 505
420 iso_pu_bacteria 2932410948 2932413215 505
421 iso_pu_bacteria 2932416698 2932417276 505
422 iso_pu_bacteria 8047673197 8047677068 505
423 3300003791 Ga0055530_10016757 Ga0055530_100167571 506
424 3300003792 Ga0055540_1000004 Ga0055540_1000004344 506
425 3300025245 Ga0207425_1000262 Ga0207425_100026231 506
426 3300025294 Ga0209025_1003975 Ga0209025_10039754 506
427 3300025297 Ga0209758_1000625 Ga0209758_100062542 506
428 3300025298 Ga0209050_1001248 Ga0209050_10012488 506
429 3300025303 Ga0209051_1000016 Ga0209051_1000016438 506
430 3300025304 Ga0209257_1000115 Ga0209257_1000115147 506
431 3300037471 Ga0395905_0160311 Ga0395905_0160311_71_1846 506
432 3300038443 Ga0395901_0012921 Ga0395901_0012921_6533_8308 506
433 3300046491 Ga0495584_0048898 Ga0495584_0048898_230_1966 506
434 3300046501 Ga0495607_0005026 Ga0495607_0005026_2178_3962 506
435 3300046501 Ga0495607_0061215 Ga0495607_0061215_166_1902 506
436 3300046523 Ga0495644_0027853 Ga0495644_0027853_166_1902 506
437 3300046794 Ga0495589_0006468 Ga0495589_0006468_3679_5415 506
438 3300046810 Ga0495660_0056082 Ga0495660_0056082_229_1965 506
439 3300047322 Ga0495680_0019365 Ga0495680_0019365_1784_3511 506
440 3300047447 Ga0495685_002937 Ga0495685_002937_3418_5154 506
441 iso_pu_bacteria 2885080285 2885085265 506
442 3300003763 Ga0055529_1000032 Ga0055529_100003251 507
443 3300003771 Ga0055526_1000894 Ga0055526_100089413 507
444 3300005366 Ga0070659_100010372 Ga0070659_1000103725 507
445 3300025272 Ga0209455_1000043 Ga0209455_1000043145 507
446 3300025295 Ga0209564_1000011 Ga0209564_1000011199 507
447 3300025920 Ga0207649_10027448 Ga0207649_100274483 507
448 3300025932 Ga0207690_10020717 Ga0207690_100207172 507
449 3300037418 Ga0395900_0026428 Ga0395900_0026428_3787_5532 507
450 3300037418 Ga0395900_0195973 Ga0395900_0195973_225_2003 507
451 3300038443 Ga0395901_0000019 Ga0395901_0000019_51445_53190 507
452 3300044683 Ga0466965_0003497 Ga0466965_0003497_2483_4216 507
453 3300045049 Ga0466959_0002327 Ga0466959_0002327_2794_4527 507
454 3300046453 Ga0495627_007407 Ga0495627_007407_606_2339 507
455 3300046492 Ga0495585_0014339 Ga0495585_0014339_2479_4212 507
456 3300046492 Ga0495585_0045738 Ga0495585_0045738_123_1865 507
457 3300046499 Ga0495594_0018412 Ga0495594_0018412_298_2031 507
458 3300046522 Ga0495643_0016390 Ga0495643_0016390_2286_3968 507
459 3300046523 Ga0495644_0009865 Ga0495644_0009865_539_2221 507
460 3300046558 Ga0495633_0006737 Ga0495633_0006737_859_2610 507
461 3300046648 Ga0495611_0001766 Ga0495611_0001766_1895_3628 507
462 3300046665 Ga0495661_0016282 Ga0495661_0016282_2439_4184 507
463 3300046684 Ga0495669_0013830 Ga0495669_0013830_436_2169 507
464 3300046694 Ga0495649_0016286 Ga0495649_0016286_198_1949 507
465 3300047469 Ga0495673_0016261 Ga0495673_0016261_1327_3009 507
466 3300048091 Ga0495626_0001659 Ga0495626_0001659_2681_4369 507
467 3300048912 Ga0496109_0005399 Ga0496109_0005399_715_2460 507
468 3300048916 Ga0496113_0086384 Ga0496113_0086384_167_1912 507
469 3300048925 Ga0496122_0000535 Ga0496122_0000535_41207_42952 507
470 3300048926 Ga0496123_0000778 Ga0496123_0000778_16506_18251 507
471 3300048928 Ga0496125_0000530 Ga0496125_0000530_35719_37464 507
472 3300053136 Ga0500559_0000021 Ga0500559_0000021_73538_75217 507
473 iso_pu_bacteria 2919476304 2919480268 507
474 3300025938 Ga0207704_10005885 Ga0207704_100058855 508
475 3300028794 Ga0307515_10096049 Ga0307515_100960493 508
476 3300031548 Ga0307408_100011844 Ga0307408_1000118447 508
477 3300033180 Ga0307510_10007975 Ga0307510_100079759 508
478 3300046507 Ga0495606_0000001 Ga0495606_0000001_447933_449720 508
479 3300046512 Ga0495610_0003535 Ga0495610_0003535_2038_3825 508
480 3300046519 Ga0495632_0000558 Ga0495632_0000558_9689_11443 508
481 3300046558 Ga0495633_0015912 Ga0495633_0015912_1541_3328 508
482 3300046616 Ga0495668_0003596 Ga0495668_0003596_71_1858 508
483 3300047472 Ga0495686_0005142 Ga0495686_0005142_1196_2983 508
484 3300047472 Ga0495686_0009323 Ga0495686_0009323_447_2186 508
485 3300048091 Ga0495626_0024339 Ga0495626_0024339_537_2273 508
486 3300048913 Ga0496110_0000110 Ga0496110_0000110_12823_14544 508
487 3300048927 Ga0496124_0049841 Ga0496124_0049841_655_2400 508
488 3300003771 Ga0055526_1001903 Ga0055526_10019038 509
489 3300003773 Ga0055537_1000030 Ga0055537_100003041 509
490 3300003775 Ga0055524_1007783 Ga0055524_10077832 509
491 3300003784 Ga0055534_1000203 Ga0055534_10002037 509
492 3300003790 Ga0055528_1000036 Ga0055528_100003696 509
493 3300005366 Ga0070659_100001056 Ga0070659_1000010563 509
494 3300025263 Ga0209565_1000017 Ga0209565_100001765 509
495 3300025273 Ga0209673_1000007 Ga0209673_1000007364 509
496 3300025291 Ga0209675_1000009 Ga0209675_1000009154 509
497 3300025295 Ga0209564_1000036 Ga0209564_1000036364 509
498 3300025295 Ga0209564_1000055 Ga0209564_100005589 509
499 3300025299 Ga0209256_1000433 Ga0209256_100043351 509
500 3300031507 Ga0307509_10000110 Ga0307509_1000011095 509
501 3300031838 Ga0307518_10017949 Ga0307518_100179493 509
502 3300039447 Ga0436361_0543340 Ga0436361_0543340_428_2227 509
503 3300046471 Ga0495650_0000329 Ga0495650_0000329_34573_36360 509
504 3300046507 Ga0495606_0000123 Ga0495606_0000123_112388_114148 509
505 3300046535 Ga0495586_0006047 Ga0495586_0006047_1956_3620 509
506 3300046616 Ga0495668_0040289 Ga0495668_0040289_748_2535 509
507 3300047472 Ga0495686_0000535 Ga0495686_0000535_30127_31836 509
508 3300047673 Ga0495593_0022857 Ga0495593_0022857_702_2366 509
509 3300053088 Ga0500644_0005591 Ga0500644_0005591_954_2633 509
510 3300053156 Ga0500622_0002795 Ga0500622_0002795_5867_7546 509
511 iso_pu_bacteria 2738541297 2738830058 509
512 iso_pu_bacteria 2738541357 2739153854 509
513 iso_pu_bacteria 2738543003 2739195774 509
514 iso_pu_bacteria 2738543026 2739322250 509
515 iso_pu_bacteria 2738543029 2739340491 509
516 iso_pu_bacteria 2821131069 2821131996 509
517 iso_pu_bacteria 2857553236 2857557743 509
518 iso_pu_bacteria 2857558681 2857564006 509
519 iso_pu_bacteria 2857564685 2857568549 509
520 iso_pu_bacteria 2904424332 2904425540 509
521 3300025303 Ga0209051_1011672 Ga0209051_10116722 510
522 3300042876 Ga0451577_0045919 Ga0451577_0045919_1754_3481 510
523 3300046492 Ga0495585_0000382 Ga0495585_0000382_5659_7359 510
524 3300046500 Ga0495596_0008444 Ga0495596_0008444_142_1824 510
525 3300046522 Ga0495643_0013866 Ga0495643_0013866_2467_4182 510
526 3300046538 Ga0495609_0001563 Ga0495609_0001563_7501_9273 510
527 3300046558 Ga0495633_0000639 Ga0495633_0000639_885_2645 510
528 3300046691 Ga0495670_0036354 Ga0495670_0036354_314_2014 510
529 3300046692 Ga0495671_0000270 Ga0495671_0000270_32147_33922 510
530 3300046810 Ga0495660_0001373 Ga0495660_0001373_8818_10590 510
531 3300047472 Ga0495686_0017922 Ga0495686_0017922_2129_3895 510
532 3300048091 Ga0495626_0012522 Ga0495626_0012522_2072_3754 510
533 iso_pu_bacteria 2842711865 2842712761 510
534 3300044684 Ga0466966_0016354 Ga0466966_0016354_2593_4323 511
535 3300044693 Ga0466961_0000034 Ga0466961_0000034_80929_82659 511
536 3300046542 Ga0495597_0001286 Ga0495597_0001286_2392_4131 511
537 3300047469 Ga0495673_0000003 Ga0495673_0000003_790018_791781 511
538 3300048929 Ga0496126_0012091 Ga0496126_0012091_462_2225 511
539 iso_pu_bacteria 2643221645 2644253361 511
540 iso_pu_bacteria 2643221664 2644355592 511
541 iso_pu_bacteria 2738541280 2738737288 511
542 iso_pu_bacteria 2738541300 2738841508 511
543 iso_pu_bacteria 2738543018 2739272378 511
544 iso_pu_bacteria 2738543030 2739341422 511
545 3300021361 Ga0213872_10003554 Ga0213872_100035546 512
546 3300046660 Ga0495625_0007287 Ga0495625_0007287_2927_4684 512
547 3300047320 Ga0495672_0000021 Ga0495672_0000021_123976_125733 512
548 3300047472 Ga0495686_0001429 Ga0495686_0001429_17212_18933 512
549 3300049776 Ga0501280_000199 Ga0501280_000199_12596_14317 512
550 iso_pu_bacteria 2643221554 2643790641 512
551 3300003775 Ga0055524_1000003 Ga0055524_100000374 513
552 3300025299 Ga0209256_1000007 Ga0209256_1000007290 513
553 3300030744 Ga0316181_1084405 Ga0316181_10844052 513
554 3300046520 Ga0495637_0000581 Ga0495637_0000581_16877_18646 513
555 3300046530 Ga0495654_0000015 Ga0495654_0000015_36636_38405 513
556 3300048905 Ga0496102_0085729 Ga0496102_0085729_783_2486 513
557 3300053125 Ga0500618_000179 Ga0500618_000179_27551_29308 513
558 3300006948 Ga0099826_10000002 Ga0099826_10000002527 514
559 3300021361 Ga0213872_10010411 Ga0213872_100104112 514
560 3300021361 Ga0213872_10011761 Ga0213872_100117613 514
561 3300027666 Ga0209282_1000001 Ga0209282_1000001626 514
562 3300031548 Ga0307408_100000157 Ga0307408_10000015742 514
563 3300039447 Ga0436361_0032036 Ga0436361_0032036_3205_5019 514
564 3300039447 Ga0436361_0561713 Ga0436361_0561713_419_2230 514
565 3300046538 Ga0495609_0001850 Ga0495609_0001850_11450_13126 514
566 3300053730 Ga0500645_017360 Ga0500645_017360_64_1752 514
567 3300025263 Ga0209565_1005832 Ga0209565_10058323 515
568 3300031548 Ga0307408_100016288 Ga0307408_1000162882 515
569 3300046507 Ga0495606_0011564 Ga0495606_0011564_3760_5529 515
570 3300046660 Ga0495625_0014939 Ga0495625_0014939_3014_4771 515
571 3300046664 Ga0495659_0000028 Ga0495659_0000028_13914_15671 515
572 3300046692 Ga0495671_0000099 Ga0495671_0000099_52140_53897 515
573 3300046810 Ga0495660_0000574 Ga0495660_0000574_9941_11710 515
574 3300047320 Ga0495672_0000121 Ga0495672_0000121_37094_38851 515
575 3300047472 Ga0495686_0006555 Ga0495686_0006555_1237_3009 515
576 3300002739 JGI25158J39367_1002596 JGI25158J39367_10025962 516
577 3300002739 JGI25158J39367_1005305 JGI25158J39367_10053051 516
578 3300002774 JGI25150J39212_1008461 JGI25150J39212_10084611 516
579 3300003374 JGI25161J50226_1001335 JGI25161J50226_10013355 516
580 3300003771 Ga0055526_1001937 Ga0055526_100193710 516
581 3300003775 Ga0055524_1005766 Ga0055524_10057664 516
582 3300003784 Ga0055534_1002029 Ga0055534_10020294 516
583 3300003794 Ga0055531_10002157 Ga0055531_100021577 516
584 3300004625 Ga0055543_1000823 Ga0055543_10008235 516
585 3300005262 Ga0065165_1000353 Ga0065165_100035347 516
586 3300005262 Ga0065165_1003232 Ga0065165_10032322 516
587 3300025208 Ga0209436_100579 Ga0209436_1005795 516
588 3300025208 Ga0209436_100764 Ga0209436_1007643 516
589 3300025245 Ga0207425_1000039 Ga0207425_100003957 516
590 3300025263 Ga0209565_1000561 Ga0209565_100056112 516
591 3300025273 Ga0209673_1014727 Ga0209673_10147273 516
592 3300025284 Ga0209130_1000078 Ga0209130_10000789 516
593 3300025284 Ga0209130_1002318 Ga0209130_10023185 516
594 3300025284 Ga0209130_1002816 Ga0209130_10028165 516
595 3300025291 Ga0209675_1000243 Ga0209675_100024314 516
596 3300025291 Ga0209675_1001406 Ga0209675_10014068 516
597 3300025295 Ga0209564_1001236 Ga0209564_100123615 516
598 3300025298 Ga0209050_1000116 Ga0209050_100011676 516
599 3300025299 Ga0209256_1001688 Ga0209256_10016884 516
600 3300025304 Ga0209257_1000003 Ga0209257_1000003164 516
601 3300032002 Ga0307416_100005844 Ga0307416_1000058445 516
602 3300046616 Ga0495668_0000285 Ga0495668_0000285_56331_58103 516
603 3300047472 Ga0495686_0006492 Ga0495686_0006492_1703_3475 516

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01514

YscJ_FliF

Secretory protein of YscJ/FliF family

50

228

0.97

PF08345

YscJ_FliF_C

Flagellar M-ring protein C-terminal

261

420

0.87

Feature Viewer

pLDDT pTM Quality
70.09 0.37 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map