F468170

General Info

Members Datasets Scaffolds Average Seq Length
602 354 1204 115

Family's Representative Sequence

Representative Sequence 3300009177|Ga0105248_10149531|Ga0105248_101495315
Length 133
Sequence MEEADMTEYVIRFLAGGVVVSAFAMLGDVLRPKSFAGLFGAAPSVALATLGIAIYQHGESYAATQTLSMMAGAVALAVYGVVVCQLLIRARMRALPATLLSLVVWLIAALGLWALAGGQARSEEGEMRLGNAR

Samples

Sample ID Description Type Environment
1 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
4 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
5 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
26 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
27 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
36 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
41 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
52 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
53 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
54 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
55 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
56 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
57 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
58 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
59 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
60 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
61 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
62 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
63 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
64 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
65 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
66 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
67 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
68 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
69 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
70 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
72 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
73 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
74 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
75 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
76 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
78 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
79 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
80 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
82 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
83 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
84 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
85 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
86 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
87 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
88 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
89 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
90 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
91 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
92 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
93 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
94 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
95 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
96 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
97 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
98 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
99 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
100 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
101 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
102 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
103 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
104 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
105 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
106 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
107 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
155 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
156 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
157 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
158 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
162 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
163 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
164 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
165 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
166 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
167 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
168 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
169 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
170 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
171 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
172 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
173 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
174 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
175 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
176 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
177 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
178 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
179 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
180 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
181 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
182 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
183 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
184 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
185 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
186 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
187 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
188 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
189 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
190 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
191 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
192 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
193 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
194 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
195 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
196 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
197 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
198 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
199 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
200 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
201 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
202 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
203 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
204 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
205 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
206 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
207 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
208 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
209 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
210 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
211 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
212 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
213 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
214 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
215 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
216 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
217 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
218 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
219 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
220 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
221 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
222 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
223 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
224 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
225 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
226 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
227 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
228 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
229 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
230 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
231 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
232 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
233 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
234 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
235 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
236 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
237 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
238 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
239 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
240 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
241 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
242 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
243 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
244 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
245 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
246 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
247 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
248 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
249 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
250 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
251 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
252 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
253 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
254 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
255 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
256 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
257 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
258 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
259 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
260 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
261 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
262 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
263 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
264 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
265 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
266 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
267 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
268 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
269 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
270 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
271 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
272 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
273 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
274 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
275 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
276 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
277 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
278 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
279 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
280 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
281 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
282 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
283 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
284 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
285 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
286 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
287 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
288 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
289 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
290 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
291 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
292 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
293 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
294 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
295 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
296 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
297 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
298 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
299 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
300 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
301 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
302 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
303 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
304 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
305 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
306 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
307 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
308 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
309 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
310 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
311 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
312 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
313 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
314 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
315 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
316 2791355199
317 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
318 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
319 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
320 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
321 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
322 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
323 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
324 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
325 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
326 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
327 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
328 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
329 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
330 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
331 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
332 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
333 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
334 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
335 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
336 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
337 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
338 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
339 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
340 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
341 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
342 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
343 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
344 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
345 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
346 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
347 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
348 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
349 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
350 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
351 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
352 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
353 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
354 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 91.68
Metatranscriptomes 0
Isolates 8.32

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.81
Nodule 8.64
Rhizoplane 10.13
Rhizosphere 68.44
Stem 0
Stem Tuber 0
Unclassified 1.5

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105248_10149531 3300009177 Bacteria 2635
2 JGI24737J22298_10031892 3300001990 Bacteria 1644
3 JGI24034J26672_10110417 3300002239 Unclassified 525
4 JGI25404J52841_10023494 3300003659 Bacteria 1330
5 Ga0055529_1039745 3300003763 Bacteria 570
6 Ga0070658_10313744 3300005327 Bacteria 1338
7 Ga0070676_10339923 3300005328 Bacteria 1029
8 Ga0070690_100033286 3300005330 Bacteria 3225
9 Ga0070670_100018647 3300005331 Bacteria 5947
10 Ga0070670_100293638 3300005331 Bacteria 1421
11 Ga0068869_100015788 3300005334 Bacteria 5075
12 Ga0068869_100018516 3300005334 Bacteria 4743
13 Ga0068869_100058059 3300005334 Bacteria 2828
14 Ga0070682_100070185 3300005337 Bacteria 2239
15 Ga0068868_100000691 3300005338 Bacteria 22637
16 Ga0068868_101265011 3300005338 Bacteria 684
17 Ga0070660_100213790 3300005339 Bacteria 1566
18 Ga0070689_100059142 3300005340 Bacteria 2978
19 Ga0070661_100016132 3300005344 Bacteria 5273
20 Ga0070661_101156434 3300005344 Bacteria 646
21 Ga0070692_10222093 3300005345 Bacteria 1117
22 Ga0070668_100068026 3300005347 Bacteria 2768
23 Ga0070668_100129113 3300005347 Bacteria 2027
24 Ga0070668_100629279 3300005347 Bacteria 941
25 Ga0070669_100183262 3300005353 Bacteria 1639
26 Ga0070669_100263152 3300005353 Bacteria 1377
27 Ga0070669_101224444 3300005353 Bacteria 649
28 Ga0070675_100191177 3300005354 Bacteria 1774
29 Ga0070671_100005910 3300005355 Bacteria 9752
30 Ga0070671_100474229 3300005355 Bacteria 1075
31 Ga0070673_101230052 3300005364 Bacteria 702
32 Ga0070688_100023245 3300005365 Bacteria 3644
33 Ga0070659_100010834 3300005366 Bacteria 6721
34 Ga0070667_100017335 3300005367 Bacteria 5968
35 Ga0070713_100034117 3300005436 Bacteria 4084
36 Ga0070713_100735669 3300005436 Bacteria 943
37 Ga0070710_10744648 3300005437 Unclassified 695
38 Ga0070705_101007364 3300005440 Bacteria 676
39 Ga0070700_101840287 3300005441 Bacteria 522
40 Ga0070694_101115915 3300005444 Bacteria 658
41 Ga0070663_100006201 3300005455 Bacteria 7167
42 Ga0070663_100049794 3300005455 Bacteria 2977
43 Ga0070663_100930819 3300005455 Bacteria 752
44 Ga0070663_101551241 3300005455 Bacteria 590
45 Ga0070678_100078484 3300005456 Bacteria 2494
46 Ga0070662_100009952 3300005457 Bacteria 6227
47 Ga0070662_100252236 3300005457 Bacteria 1419
48 Ga0070681_10013969 3300005458 Bacteria 7990
49 Ga0068867_100176711 3300005459 Bacteria 1695
50 Ga0068867_100347205 3300005459 Bacteria 1237
51 Ga0070685_10016846 3300005466 Bacteria 3901
52 Ga0070699_100112700 3300005518 Bacteria 2389
53 Ga0070679_100056822 3300005530 Bacteria 3900
54 Ga0070679_101747582 3300005530 Unclassified 570
55 Ga0070684_100361898 3300005535 Bacteria 1335
56 Ga0070672_100074804 3300005543 Bacteria 2703
57 Ga0070695_100201056 3300005545 Bacteria 1424
58 Ga0070693_100004070 3300005547 Bacteria 6883
59 Ga0070665_100041292 3300005548 Bacteria 4636
60 Ga0068855_100018135 3300005563 Bacteria 8458
61 Ga0070664_100006395 3300005564 Bacteria 9500
62 Ga0068857_100008304 3300005577 Bacteria 8971
63 Ga0068857_100959230 3300005577 Bacteria 822
64 Ga0068856_100001454 3300005614 Bacteria 24843
65 Ga0068856_100744143 3300005614 Bacteria 1000
66 Ga0070702_100005971 3300005615 Bacteria 5728
67 Ga0070702_100336245 3300005615 Bacteria 1058
68 Ga0070702_100500853 3300005615 Bacteria 892
69 Ga0068852_100013683 3300005616 Bacteria 6216
70 Ga0068859_100007205 3300005617 Bacteria 11286
71 Ga0068859_100813726 3300005617 Bacteria 1021
72 Ga0068864_100012087 3300005618 Bacteria 7131
73 Ga0068864_100017268 3300005618 Bacteria 6016
74 Ga0068864_100515597 3300005618 Bacteria 1152
75 Ga0068861_100001012 3300005719 Bacteria 17189
76 Ga0068861_100067514 3300005719 Bacteria 2760
77 Ga0068861_101395605 3300005719 Bacteria 684
78 Ga0068851_10151207 3300005834 Bacteria 1269
79 Ga0068870_10741529 3300005840 Bacteria 681
80 Ga0068863_100009851 3300005841 Bacteria 9311
81 Ga0068858_100004959 3300005842 Bacteria 13040
82 Ga0068858_100016204 3300005842 Bacteria 7001
83 Ga0068858_100178654 3300005842 Bacteria 2003
84 Ga0068860_100020359 3300005843 Bacteria 6426
85 Ga0068860_100729189 3300005843 Bacteria 1002
86 Ga0068862_100061062 3300005844 Bacteria 3239
87 Ga0068862_100116974 3300005844 Bacteria 2346
88 Ga0068862_100794676 3300005844 Bacteria 923
89 Ga0081455_10814854 3300005937 Bacteria 585
90 Ga0081455_11059271 3300005937 Bacteria 501
91 Ga0081540_1000746 3300005983 Bacteria 29936
92 Ga0081540_1008241 3300005983 Bacteria 7302
93 Ga0081540_1027584 3300005983 Bacteria 3212
94 Ga0070717_10464985 3300006028 Bacteria 1141
95 Ga0070717_11530684 3300006028 Bacteria 605
96 Ga0075365_10004208 3300006038 Bacteria 7580
97 Ga0075368_10019389 3300006042 Bacteria 2567
98 Ga0075363_100003404 3300006048 Bacteria 6760
99 Ga0075364_10000622 3300006051 Bacteria 18236
100 Ga0070712_100169299 3300006175 Bacteria 1694
101 Ga0070712_100273346 3300006175 Bacteria 1358
102 Ga0070712_101142935 3300006175 Bacteria 677
103 Ga0075362_10031885 3300006177 Bacteria 2284
104 Ga0075367_10006277 3300006178 Bacteria 5994
105 Ga0075367_10597833 3300006178 Bacteria 701
106 Ga0075369_10297577 3300006186 Bacteria 753
107 Ga0075366_10003457 3300006195 Bacteria 8337
108 Ga0097621_100207687 3300006237 Bacteria 1702
109 Ga0097621_100315348 3300006237 Bacteria 1384
110 Ga0097621_100359803 3300006237 Bacteria 1296
111 Ga0075370_10007057 3300006353 Bacteria 5700
112 Ga0075370_10252646 3300006353 Bacteria 1045
113 Ga0068871_100005789 3300006358 Bacteria 8683
114 Ga0068871_100215484 3300006358 Bacteria 1662
115 Ga0075428_102274706 3300006844 Bacteria 558
116 Ga0075434_100002311 3300006871 Bacteria 16681
117 Ga0068865_100918423 3300006881 Bacteria 762
118 Ga0068865_100995485 3300006881 Bacteria 734
119 Ga0068865_101622674 3300006881 Bacteria 582
120 Ga0097620_100007205 3300006931 Bacteria 11286
121 Ga0097620_100813885 3300006931 Bacteria 1021
122 Ga0099825_1048782 3300006941 Bacteria 966
123 Ga0075435_100021613 3300007076 Bacteria 4952
124 Ga0075435_100059095 3300007076 Bacteria 3108
125 Ga0105251_10135599 3300009011 Bacteria 1115
126 Ga0111539_10334923 3300009094 Bacteria 1762
127 Ga0105245_10004489 3300009098 Bacteria 12338
128 Ga0105245_10068791 3300009098 Bacteria 3209
129 Ga0105245_11604191 3300009098 Bacteria 702
130 Ga0105245_12992264 3300009098 Bacteria 524
131 Ga0105247_10005396 3300009101 Bacteria 8057
132 Ga0105243_10014150 3300009148 Bacteria 6035
133 Ga0105243_11465342 3300009148 Bacteria 705
134 Ga0105241_10002107 3300009174 Bacteria 15029
135 Ga0105241_10450865 3300009174 Bacteria 1138
136 Ga0105241_12203978 3300009174 Bacteria 546
137 Ga0105242_10084620 3300009176 Bacteria 2658
138 Ga0105242_10379442 3300009176 Bacteria 1314
139 Ga0105248_10004484 3300009177 Bacteria 15448
140 Ga0105237_10007570 3300009545 Bacteria 11873
141 Ga0105237_10067707 3300009545 Bacteria 3565
142 Ga0105237_11371226 3300009545 Bacteria 713
143 Ga0105237_11784864 3300009545 Bacteria 623
144 Ga0105238_10005107 3300009551 Bacteria 12978
145 Ga0105238_11615349 3300009551 Bacteria 678
146 Ga0105249_10056342 3300009553 Bacteria 3598
147 Ga0105239_10008731 3300010375 Bacteria 11474
148 Ga0105239_10020568 3300010375 Bacteria 7282
149 Ga0105239_10378883 3300010375 Bacteria 1599
150 Ga0105239_10468118 3300010375 Bacteria 1431
151 Ga0105239_10861993 3300010375 Bacteria 1039
152 Ga0105246_10018255 3300011119 Bacteria 4470
153 Ga0105246_10258609 3300011119 Bacteria 1386
154 Ga0105246_11748115 3300011119 Bacteria 592
155 Ga0157374_10002234 3300013296 Bacteria 16312
156 Ga0157374_10261889 3300013296 Bacteria 1703
157 Ga0157374_10865309 3300013296 Bacteria 921
158 Ga0157378_10003173 3300013297 Bacteria 14596
159 Ga0157378_12547324 3300013297 Bacteria 564
160 Ga0163162_10014181 3300013306 Bacteria 7789
161 Ga0163162_10075494 3300013306 Bacteria 3431
162 Ga0163162_10104780 3300013306 Bacteria 2923
163 Ga0163162_11113515 3300013306 Bacteria 895
164 Ga0163162_11801095 3300013306 Bacteria 700
165 Ga0157372_12733377 3300013307 Bacteria 566
166 Ga0157372_13299856 3300013307 Unclassified 514
167 Ga0157375_10036826 3300013308 Bacteria 4684
168 Ga0157375_10405132 3300013308 Bacteria 1530
169 Ga0157375_10600169 3300013308 Bacteria 1260
170 Ga0157375_10679545 3300013308 Bacteria 1184
171 Ga0157375_10752621 3300013308 Bacteria 1126
172 Ga0163163_10015286 3300014325 Bacteria 7093
173 Ga0163163_10042873 3300014325 Bacteria 4434
174 Ga0163163_10045186 3300014325 Bacteria 4323
175 Ga0157380_10362198 3300014326 Bacteria 1361
176 Ga0157377_10139882 3300014745 Bacteria 1486
177 Ga0157379_10010554 3300014968 Bacteria 8055
178 Ga0157379_10206329 3300014968 Bacteria 1778
179 Ga0157376_10023821 3300014969 Bacteria 4798
180 Ga0157376_10421208 3300014969 Bacteria 1296
181 Ga0157376_10940183 3300014969 Bacteria 884
182 Ga0157376_10978644 3300014969 Bacteria 868
183 Ga0163161_10706588 3300017792 Bacteria 840
184 Ga0213874_10143420 3300021377 Bacteria 828
185 Ga0209148_1004505 3300025254 Bacteria 3414
186 Ga0209233_1001406 3300025261 Bacteria 9517
187 Ga0209455_1002672 3300025272 Bacteria 6714
188 Ga0209455_1009245 3300025272 Bacteria 2603
189 Ga0209758_1151877 3300025297 Bacteria 587
190 Ga0207696_1107402 3300025711 Bacteria 758
191 Ga0207692_10280327 3300025898 Bacteria 1008
192 Ga0207692_11005877 3300025898 Bacteria 550
193 Ga0207710_10012671 3300025900 Bacteria 3548
194 Ga0207688_10001741 3300025901 Bacteria 11554
195 Ga0207647_10009616 3300025904 Bacteria 6865
196 Ga0207647_10210518 3300025904 Bacteria 1123
197 Ga0207699_11037891 3300025906 Bacteria 606
198 Ga0207645_10307185 3300025907 Bacteria 1057
199 Ga0207643_10603090 3300025908 Bacteria 707
200 Ga0207654_10009260 3300025911 Bacteria 4996
201 Ga0207707_10025826 3300025912 Bacteria 5137
202 Ga0207671_10019507 3300025914 Bacteria 5184
203 Ga0207671_10659583 3300025914 Bacteria 833
204 Ga0207693_10047138 3300025915 Bacteria 3387
205 Ga0207657_10216967 3300025919 Bacteria 1534
206 Ga0207649_10382476 3300025920 Bacteria 1049
207 Ga0207681_10065392 3300025923 Bacteria 2514
208 Ga0207681_10228777 3300025923 Bacteria 1442
209 Ga0207681_11105080 3300025923 Bacteria 666
210 Ga0207694_10011173 3300025924 Bacteria 6777
211 Ga0207687_10010933 3300025927 Bacteria 5932
212 Ga0207687_10043107 3300025927 Bacteria 3108
213 Ga0207700_10017738 3300025928 Bacteria 4762
214 Ga0207644_10114132 3300025931 Bacteria 2046
215 Ga0207644_10124261 3300025931 Bacteria 1968
216 Ga0207644_10509202 3300025931 Bacteria 994
217 Ga0207644_10869640 3300025931 Bacteria 755
218 Ga0207690_10015632 3300025932 Bacteria 4604
219 Ga0207706_10004339 3300025933 Bacteria 13314
220 Ga0207706_10734533 3300025933 Bacteria 842
221 Ga0207686_10624104 3300025934 Bacteria 850
222 Ga0207709_10040672 3300025935 Bacteria 2785
223 Ga0207670_10015452 3300025936 Bacteria 4563
224 Ga0207670_10435236 3300025936 Bacteria 1055
225 Ga0207704_10767135 3300025938 Bacteria 803
226 Ga0207704_11162118 3300025938 Bacteria 657
227 Ga0207711_10038303 3300025941 Bacteria 4076
228 Ga0207711_10187296 3300025941 Bacteria 1885
229 Ga0207689_10001834 3300025942 Bacteria 20086
230 Ga0207689_10150585 3300025942 Bacteria 1918
231 Ga0207689_10610101 3300025942 Bacteria 918
232 Ga0207689_10772034 3300025942 Bacteria 811
233 Ga0207661_11781649 3300025944 Bacteria 561
234 Ga0207679_10097615 3300025945 Bacteria 2289
235 Ga0207667_10054945 3300025949 Bacteria 4188
236 Ga0207651_10968128 3300025960 Bacteria 760
237 Ga0207712_10037527 3300025961 Bacteria 3307
238 Ga0207668_10010227 3300025972 Bacteria 5663
239 Ga0207668_10103897 3300025972 Bacteria 2116
240 Ga0207668_10147528 3300025972 Bacteria 1817
241 Ga0207668_11438815 3300025972 Bacteria 622
242 Ga0207658_10686829 3300025986 Bacteria 924
243 Ga0207677_10011764 3300026023 Bacteria 5002
244 Ga0207703_10016414 3300026035 Bacteria 5773
245 Ga0207703_10018378 3300026035 Bacteria 5458
246 Ga0207639_10291695 3300026041 Bacteria 1439
247 Ga0207678_10000784 3300026067 Bacteria 29033
248 Ga0207678_10253270 3300026067 Bacteria 1508
249 Ga0207678_10702597 3300026067 Bacteria 890
250 Ga0207708_10092427 3300026075 Bacteria 2335
251 Ga0207702_10016276 3300026078 Bacteria 6154
252 Ga0207702_11339877 3300026078 Bacteria 710
253 Ga0207702_11797467 3300026078 Bacteria 605
254 Ga0207641_10018366 3300026088 Bacteria 5733
255 Ga0207641_10022441 3300026088 Bacteria 5196
256 Ga0207641_12141345 3300026088 Bacteria 560
257 Ga0207648_10106325 3300026089 Bacteria 2462
258 Ga0207648_10223606 3300026089 Bacteria 1673
259 Ga0207676_10056029 3300026095 Bacteria 3097
260 Ga0207676_10491392 3300026095 Bacteria 1164
261 Ga0207674_10011141 3300026116 Bacteria 10112
262 Ga0207674_10316469 3300026116 Bacteria 1510
263 Ga0207674_10907985 3300026116 Bacteria 849
264 Ga0207675_100001345 3300026118 Bacteria 24662
265 Ga0207675_100054166 3300026118 Bacteria 3742
266 Ga0207683_10087356 3300026121 Bacteria 2773
267 Ga0207683_10156594 3300026121 Bacteria 2058
268 Ga0207683_10445327 3300026121 Bacteria 1194
269 Ga0207698_10009228 3300026142 Bacteria 6276
270 Ga0207698_12480411 3300026142 Bacteria 529
271 Ga0209389_1006498 3300027296 Bacteria 10168
272 Ga0209489_121784 3300027361 Bacteria 1512
273 Ga0209700_100483 3300027363 Bacteria 74857
274 Ga0207428_10100228 3300027907 Bacteria 2238
275 Ga0268266_10012303 3300028379 Bacteria 7404
276 Ga0268266_10139411 3300028379 Bacteria 2175
277 Ga0268265_10011302 3300028380 Bacteria 6036
278 Ga0268265_10057351 3300028380 Bacteria 2967
279 Ga0268265_10197053 3300028380 Bacteria 1744
280 Ga0268264_10034038 3300028381 Bacteria 4189
281 Ga0268264_10483151 3300028381 Bacteria 1205
282 Ga0268264_12418412 3300028381 Bacteria 531
283 Ga0265328_10149610 3300031239 Bacteria 878
284 Ga0307508_10139805 3300031616 Bacteria 2025
285 Ga0307508_10250262 3300031616 Bacteria 1368
286 Ga0307416_100137776 3300032002 Bacteria 2212
287 Ga0307411_11825133 3300032005 Bacteria 565
288 Ga0307415_100175226 3300032126 Bacteria 1677
289 Ga0315911_1000035 3300033442 Bacteria 66589
290 Ga0373923_0004572 3300035111 Bacteria 4604
291 Ga0373953_0056347 3300035117 Bacteria 1598
292 Ga0373954_0006825 3300035118 Bacteria 4981
293 Ga0373954_0039075 3300035118 Bacteria 2209
294 Ga0373956_0006406 3300035119 Bacteria 4715
295 Ga0373957_0023574 3300035120 Bacteria 2203
296 Ga0373957_0119945 3300035120 Bacteria 1064
297 Ga0373943_0256565 3300035170 Bacteria 983
298 Ga0373946_0454488 3300035171 Bacteria 653
299 Ga0373955_0041101 3300035172 Bacteria 2477
300 Ga0373955_0099575 3300035172 Bacteria 1666
301 Ga0373924_0016044 3300035410 Bacteria 2856
302 Ga0373935_0944003 3300035692 Bacteria 640
303 Ga0373927_0003199 3300035695 Bacteria 11798
304 Ga0373927_0314376 3300035695 Bacteria 1031
305 Ga0373933_0012676 3300035724 Bacteria 4660
306 Ga0373947_0095343 3300035725 Bacteria 1862
307 Ga0373947_0100012 3300035725 Bacteria 1821
308 Ga0373947_0231816 3300035725 Bacteria 1216
309 Ga0373937_0002720 3300036401 Bacteria 14769
310 Ga0373937_0087967 3300036401 Bacteria 2876
311 Ga0373937_0831697 3300036401 Bacteria 871
312 Ga0373925_0092791 3300037068 Bacteria 2310
313 Ga0373925_0391905 3300037068 Bacteria 1132
314 Ga0395898_0145745 3300037466 Bacteria 2266
315 Ga0436364_0812179 3300037853 Bacteria 2023
316 Ga0395901_0695774 3300038443 Bacteria 1015
317 Ga0436363_1648725 3300039450 Bacteria 3664
318 Ga0451807_0995783 3300041486 Bacteria 617
319 Ga0451833_0514708 3300041491 Unclassified 539
320 Ga0466972_0563723 3300044658 Bacteria 537
321 Ga0466968_0520302 3300044735 Bacteria 594
322 Ga0466960_0010572 3300044901 Bacteria 3836
323 Ga0495592_0001866 3300046454 Bacteria 14837
324 Ga0495592_0156577 3300046454 Bacteria 1571
325 Ga0495592_0423250 3300046454 Bacteria 839
326 Ga0495603_0121179 3300046455 Bacteria 1524
327 Ga0495590_0008137 3300046457 Bacteria 4016
328 Ga0495629_0025362 3300046459 Bacteria 4215
329 Ga0495638_0002524 3300046460 Bacteria 14895
330 Ga0495651_0001962 3300046462 Bacteria 15915
331 Ga0495651_0002719 3300046462 Bacteria 13717
332 Ga0495651_0583938 3300046462 Bacteria 706
333 Ga0495651_0777090 3300046462 Bacteria 592
334 Ga0495653_0002019 3300046463 Bacteria 15967
335 Ga0495653_0084983 3300046463 Bacteria 2329
336 Ga0495580_0289848 3300046472 Bacteria 1116
337 Ga0495582_0214315 3300046473 Bacteria 1101
338 Ga0495639_0244620 3300046475 Bacteria 886
339 Ga0495662_0554684 3300046476 Bacteria 563
340 Ga0495594_0243802 3300046499 Bacteria 1024
341 Ga0495583_0176838 3300046506 Bacteria 875
342 Ga0495606_0108812 3300046507 Bacteria 1675
343 Ga0495608_0000371 3300046511 Bacteria 31446
344 Ga0495608_0039605 3300046511 Bacteria 3158
345 Ga0495610_0030602 3300046512 Bacteria 2818
346 Ga0495618_0134825 3300046514 Bacteria 1580
347 Ga0495618_0699415 3300046514 Bacteria 596
348 Ga0495628_0009828 3300046516 Bacteria 8148
349 Ga0495628_0463168 3300046516 Bacteria 919
350 Ga0495628_1180852 3300046516 Unclassified 520
351 Ga0495630_0980787 3300046517 Unclassified 642
352 Ga0495630_1486211 3300046517 Bacteria 508
353 Ga0495643_0161472 3300046522 Bacteria 1102
354 Ga0495652_0000409 3300046529 Bacteria 50086
355 Ga0495652_0231813 3300046529 Bacteria 1380
356 Ga0495665_0137513 3300046531 Bacteria 1278
357 Ga0495665_0594068 3300046531 Bacteria 554
358 Ga0495640_0026203 3300046533 Bacteria 4216
359 Ga0495587_0000416 3300046536 Bacteria 29922
360 Ga0495587_0053757 3300046536 Bacteria 2374
361 Ga0495587_0274452 3300046536 Bacteria 945
362 Ga0495587_0592791 3300046536 Bacteria 610
363 Ga0495587_0798696 3300046536 Bacteria 515
364 Ga0495609_0073009 3300046538 Bacteria 1506
365 Ga0495597_0234441 3300046542 Bacteria 725
366 Ga0495645_0123923 3300046543 Bacteria 1817
367 Ga0495645_0383430 3300046543 Bacteria 899
368 Ga0495645_0420083 3300046543 Bacteria 849
369 Ga0495622_0052745 3300046557 Bacteria 1887
370 Ga0495667_0000952 3300046559 Bacteria 18708
371 Ga0495667_0433736 3300046559 Bacteria 826
372 Ga0495667_0587648 3300046559 Bacteria 694
373 Ga0495668_0034663 3300046616 Bacteria 2830
374 Ga0495668_0076470 3300046616 Bacteria 1838
375 Ga0495668_0284621 3300046616 Bacteria 906
376 Ga0495634_0034412 3300046642 Bacteria 3477
377 Ga0495625_0020714 3300046660 Bacteria 5070
378 Ga0495625_0191708 3300046660 Unclassified 1354
379 Ga0495635_0002491 3300046663 Bacteria 12573
380 Ga0495635_0148154 3300046663 Bacteria 1598
381 Ga0495635_0181599 3300046663 Bacteria 1430
382 Ga0495661_0502558 3300046665 Bacteria 578
383 Ga0495588_0289043 3300046674 Bacteria 864
384 Ga0495657_0003963 3300046675 Bacteria 11883
385 Ga0495657_0005216 3300046675 Bacteria 10285
386 Ga0495657_0295547 3300046675 Bacteria 967
387 Ga0495599_0001695 3300046678 Bacteria 12742
388 Ga0495599_0048004 3300046678 Bacteria 2676
389 Ga0495623_0001152 3300046679 Bacteria 17884
390 Ga0495623_0160731 3300046679 Bacteria 1320
391 Ga0495623_0247208 3300046679 Bacteria 1005
392 Ga0495646_0033811 3300046680 Bacteria 3178
393 Ga0495647_0371274 3300046681 Bacteria 654
394 Ga0495613_0761312 3300046689 Bacteria 634
395 Ga0495671_0063438 3300046692 Bacteria 1820
396 Ga0495649_0204047 3300046694 Bacteria 1026
397 Ga0495649_0243982 3300046694 Bacteria 924
398 Ga0495589_0285282 3300046794 Bacteria 767
399 Ga0495600_0000161 3300046809 Bacteria 39013
400 Ga0495600_0010070 3300046809 Bacteria 5860
401 Ga0495600_0419824 3300046809 Bacteria 830
402 Ga0495581_0041179 3300047315 Bacteria 2673
403 Ga0495581_0098943 3300047315 Bacteria 1694
404 Ga0495581_0332689 3300047315 Bacteria 887
405 Ga0495604_0001291 3300047317 Bacteria 20490
406 Ga0495604_0025153 3300047317 Bacteria 4744
407 Ga0495604_0320007 3300047317 Bacteria 1037
408 Ga0495674_0009006 3300047319 Bacteria 9485
409 Ga0495674_0203863 3300047319 Bacteria 1640
410 Ga0495680_0001102 3300047322 Bacteria 29889
411 Ga0495680_0147049 3300047322 Bacteria 1720
412 Ga0495683_0385201 3300047323 Bacteria 586
413 Ga0495675_0001265 3300047444 Bacteria 15306
414 Ga0495675_0021626 3300047444 Bacteria 4098
415 Ga0495673_0140989 3300047469 Bacteria 939
416 Ga0495684_0006155 3300047471 Bacteria 9339
417 Ga0495686_0010217 3300047472 Bacteria 6686
418 Ga0495686_0596591 3300047472 Bacteria 572
419 Ga0495593_0042150 3300047673 Bacteria 2451
420 Ga0495593_0101748 3300047673 Bacteria 1473
421 Ga0495593_0213036 3300047673 Bacteria 970
422 Ga0495593_0484221 3300047673 Bacteria 620
423 Ga0495602_0002351 3300048088 Bacteria 19147
424 Ga0495602_0221755 3300048088 Bacteria 1427
425 Ga0495602_0328291 3300048088 Bacteria 1110
426 Ga0495614_0199485 3300048089 Bacteria 905
427 Ga0496100_0013918 3300048903 Bacteria 4656
428 Ga0496100_0380241 3300048903 Bacteria 1072
429 Ga0496100_0439182 3300048903 Bacteria 999
430 Ga0496101_0029125 3300048904 Bacteria 3861
431 Ga0496101_0142855 3300048904 Bacteria 1825
432 Ga0496101_0251010 3300048904 Bacteria 1378
433 Ga0496101_1109331 3300048904 Bacteria 621
434 Ga0496102_0039985 3300048905 Bacteria 4240
435 Ga0496102_0055346 3300048905 Bacteria 3618
436 Ga0496102_1296478 3300048905 Bacteria 647
437 Ga0496102_1323357 3300048905 Bacteria 640
438 Ga0496103_0002244 3300048906 Bacteria 12240
439 Ga0496103_0299040 3300048906 Bacteria 1035
440 Ga0496104_0066817 3300048907 Bacteria 3414
441 Ga0496104_0106408 3300048907 Bacteria 2688
442 Ga0496104_0115562 3300048907 Bacteria 2575
443 Ga0496104_0267108 3300048907 Bacteria 1623
444 Ga0496104_0340857 3300048907 Bacteria 1412
445 Ga0496104_0474732 3300048907 Bacteria 1162
446 Ga0496104_0548292 3300048907 Bacteria 1067
447 Ga0496104_0658128 3300048907 Bacteria 956
448 Ga0496105_0047482 3300048908 Bacteria 3543
449 Ga0496105_0191092 3300048908 Bacteria 1674
450 Ga0496106_0009482 3300048909 Bacteria 7196
451 Ga0496106_0102475 3300048909 Bacteria 2221
452 Ga0496106_0117531 3300048909 Bacteria 2075
453 Ga0496106_0777099 3300048909 Bacteria 760
454 Ga0496106_1276992 3300048909 Bacteria 571
455 Ga0496107_0002914 3300048910 Bacteria 11312
456 Ga0496107_0104776 3300048910 Bacteria 2076
457 Ga0496107_0781648 3300048910 Bacteria 699
458 Ga0496108_0010908 3300048911 Bacteria 7377
459 Ga0496108_0122576 3300048911 Bacteria 2230
460 Ga0496109_0009657 3300048912 Bacteria 8231
461 Ga0496109_1621915 3300048912 Bacteria 581
462 Ga0496110_0024795 3300048913 Bacteria 5117
463 Ga0496110_0134507 3300048913 Bacteria 2234
464 Ga0496110_0139521 3300048913 Bacteria 2191
465 Ga0496110_0253365 3300048913 Bacteria 1602
466 Ga0496110_0806368 3300048913 Bacteria 843
467 Ga0496110_1225314 3300048913 Bacteria 659
468 Ga0496111_0005750 3300048914 Bacteria 8001
469 Ga0496111_0175227 3300048914 Bacteria 1594
470 Ga0496111_0235251 3300048914 Bacteria 1361
471 Ga0496112_0003234 3300048915 Bacteria 13418
472 Ga0496112_0106241 3300048915 Bacteria 2777
473 Ga0496112_0134395 3300048915 Bacteria 2444
474 Ga0496112_0348001 3300048915 Bacteria 1425
475 Ga0496113_0107414 3300048916 Bacteria 2168
476 Ga0496113_0134549 3300048916 Bacteria 1942
477 Ga0496113_0225249 3300048916 Bacteria 1495
478 Ga0496114_0021094 3300048917 Bacteria 5296
479 Ga0496114_0810606 3300048917 Bacteria 815
480 Ga0496114_1078601 3300048917 Bacteria 688
481 Ga0496114_1323537 3300048917 Bacteria 607
482 Ga0496115_0029761 3300048918 Bacteria 4292
483 Ga0496115_0238477 3300048918 Bacteria 1499
484 Ga0496115_0492477 3300048918 Bacteria 986
485 Ga0496115_0775862 3300048918 Bacteria 748
486 Ga0496115_0882903 3300048918 Bacteria 690
487 Ga0496117_0107188 3300048920 Bacteria 1751
488 Ga0496118_0027252 3300048921 Bacteria 4841
489 Ga0496118_0028063 3300048921 Bacteria 4749
490 Ga0496118_0210876 3300048921 Bacteria 1140
491 Ga0496119_0127053 3300048922 Bacteria 1394
492 Ga0496120_0417457 3300048923 Bacteria 590
493 Ga0496121_0015237 3300048924 Bacteria 8078
494 Ga0496121_0043657 3300048924 Bacteria 3879
495 Ga0496121_0079043 3300048924 Bacteria 2612
496 Ga0496121_0205310 3300048924 Bacteria 1400
497 Ga0496121_0280622 3300048924 Bacteria 1140
498 Ga0496121_0400060 3300048924 Bacteria 900
499 Ga0496121_0558374 3300048924 Bacteria 715
500 Ga0496124_0225764 3300048927 Bacteria 1404
501 Ga0496124_0524603 3300048927 Bacteria 788
502 Ga0496125_0035713 3300048928 Bacteria 4354
503 Ga0496125_0237398 3300048928 Bacteria 1160
504 Ga0496126_0047484 3300048929 Bacteria 3930
505 Ga0496126_0184931 3300048929 Bacteria 1768
506 Ga0496126_0249634 3300048929 Bacteria 1479
507 Ga0501047_1011582 3300049581 Bacteria 644
508 Ga0501073_1040560 3300049589 Unclassified 563
509 Ga0501044_0304203 3300049823 Bacteria 1523
510 nmdc:mga03683_27846_c1 3300050489 Bacteria 2242
511 nmdc:mga03n38_3192_c1 3300050490 Bacteria 5226
512 nmdc:mga00v17_3438_c1 3300050491 Bacteria 8185
513 nmdc:mga0yw44_12426_c1 3300050492 Bacteria 4438
514 nmdc:mga0k408_8575_c1 3300050493 Bacteria 5492
515 nmdc:mga06z11_1792_c1 3300050494 Bacteria 8078
516 nmdc:mga06z11_556908_c1 3300050494 Bacteria 696
517 nmdc:mga04h51_100879_c1 3300050495 Bacteria 1052
518 nmdc:mga07m45_423040_c1 3300050496 Bacteria 773
519 nmdc:mga07m45_6678_c1 3300050496 Bacteria 5852
520 nmdc:mga08y16_408001_c1 3300050511 Bacteria 1390
521 nmdc:mga0n895_301214_c1 3300050512 Bacteria 1625
522 nmdc:mga0n895_9487_c1 3300050512 Bacteria 8517
523 nmdc:mga0rr50_2778_c1 3300050513 Bacteria 9948
524 nmdc:mga0rr50_47481_c1 3300050513 Bacteria 3167
525 nmdc:mga0a205_665963_c1 3300050515 Bacteria 892
526 nmdc:mga0sz30_801_c1 3300050516 Bacteria 11367
527 Ga0495601_0325293 3300053077 Bacteria 1001
528 Ga0495595_0004899 3300053084 Bacteria 5400
529 Ga0495595_0069265 3300053084 Bacteria 1665
530 Ga0495619_0000939 3300053085 Bacteria 19110
531 Ga0495619_0031033 3300053085 Bacteria 3461
532 Ga0495619_0108080 3300053085 Bacteria 1898
533 Ga0500578_0109626 3300053086 Bacteria 1741
534 Ga0500646_0010439 3300053090 Bacteria 2382
535 Ga0500651_0455751 3300053093 Bacteria 711
536 Ga0500555_008463 3300053103 Bacteria 2934
537 Ga0500556_0004308 3300053104 Bacteria 4058
538 Ga0500562_000293 3300053108 Bacteria 12207
539 Ga0500594_0070984 3300053118 Bacteria 1024
540 Ga0500642_0001884 3300053130 Bacteria 6061
541 Ga0500655_054880 3300053133 Bacteria 797
542 Ga0500658_0136809 3300053134 Bacteria 1096
543 Ga0500568_0045789 3300053139 Bacteria 1739
544 Ga0500577_0032108 3300053142 Bacteria 1843
545 Ga0500588_0020630 3300053146 Bacteria 1768
546 Ga0500604_0083974 3300053151 Bacteria 1032
547 Ga0500616_0005765 3300053153 Bacteria 8320
548 Ga0500622_0000642 3300053156 Bacteria 31278
549 Ga0500627_0053653 3300053158 Bacteria 1762
550 Ga0500634_0289261 3300053161 Bacteria 656
551 Ga0500599_000131 3300053736 Bacteria 6820
552 2513646364 2513237095 Bacteria 8976980
553 2513660698 2513237096 Bacteria 8722461
554 2513862534 2513237137 Bacteria 9558895
555 2513922494 2513237145 Bacteria 8979722
556 2517888433 2517572143 Bacteria 9484767
557 2528857860 2528768022 Bacteria 10457665
558 2793081374
559 2818241308 2816332527 Bacteria 8933356
560 2824666209 2824661429 Bacteria 9877870
561 2879103829 2879099564 Bacteria 10442239
562 2904699275 2904690495 Bacteria 9412302
563 2906638823 2906635258 Bacteria 8601019
564 2906660914 2906660503 Bacteria 8595048
565 2908758873 2908756301 Bacteria 8864324
566 2932791966 2932784394 Bacteria 9704911
567 2932815724 2932809354 Bacteria 9135765
568 2932827753 2932818245 Bacteria 9955613
569 2932835912 2932828146 Bacteria 9745859
570 2935619966 2935616580 Bacteria 9032984
571 2935631314 2935630451 Bacteria 8169952
572 2935636618 2935630451 Bacteria 8169952
573 2935642208 2935638405 Bacteria 10015038
574 2935668488 2935665750 Bacteria 9571747
575 2935706348 2935703347 Bacteria 10242284
576 2935810299 2935801545 Bacteria 9301974
577 2935814663 2935810662 Bacteria 9401221
578 2935831801 2935827899 Bacteria 10038562
579 2935838842 2935837841 Bacteria 9454360
580 2935857719 2935855204 Bacteria 9035059
581 2935868940 2935864058 Bacteria 9784707
582 2935874355 2935873716 Bacteria 9632195
583 2935998901 2935992306 Bacteria 9802711
584 2936001250 2935992306 Bacteria 9802711
585 2936007754 2936002035 Bacteria 9362176
586 2936010465 2936002035 Bacteria 9362176
587 2936040220 2936037263 Bacteria 9446081
588 2941510055 2941507105 Bacteria 8166816
589 2941513254 2941507105 Bacteria 8166816
590 2941518858 2941515067 Bacteria 8166720
591 2941521217 2941515067 Bacteria 8166720
592 2941525454 2941523033 Bacteria 8169134
593 2941529071 2941523033 Bacteria 8169134
594 2941538560 2941538514 Bacteria 9402094
595 8016514356 8016511872 Bacteria 9921665
596 8017062067 8017057580 Bacteria 10023680
597 8019561974 8019555841 Bacteria 9642137
598 8019582449 8019576017 Bacteria 10049540
599 8019590232 8019586578 Bacteria 10212056
600 8019601115 8019597564 Bacteria 10041141
601 8019617430 8019608314 Bacteria 10042931
602 8056674724 8056673599 Bacteria 7871253
603 Ga0105248_10149531
604 JGI24737J22298_10031892
605 JGI24034J26672_10110417
606 JGI25404J52841_10023494
607 Ga0055529_1039745
608 Ga0070658_10313744
609 Ga0070676_10339923
610 Ga0070690_100033286
611 Ga0070670_100018647
612 Ga0070670_100293638
613 Ga0068869_100015788
614 Ga0068869_100018516
615 Ga0068869_100058059
616 Ga0070682_100070185
617 Ga0068868_100000691
618 Ga0068868_101265011
619 Ga0070660_100213790
620 Ga0070689_100059142
621 Ga0070661_100016132
622 Ga0070661_101156434
623 Ga0070692_10222093
624 Ga0070668_100068026
625 Ga0070668_100129113
626 Ga0070668_100629279
627 Ga0070669_100183262
628 Ga0070669_100263152
629 Ga0070669_101224444
630 Ga0070675_100191177
631 Ga0070671_100005910
632 Ga0070671_100474229
633 Ga0070673_101230052
634 Ga0070688_100023245
635 Ga0070659_100010834
636 Ga0070667_100017335
637 Ga0070713_100034117
638 Ga0070713_100735669
639 Ga0070710_10744648
640 Ga0070705_101007364
641 Ga0070700_101840287
642 Ga0070694_101115915
643 Ga0070663_100006201
644 Ga0070663_100049794
645 Ga0070663_100930819
646 Ga0070663_101551241
647 Ga0070678_100078484
648 Ga0070662_100009952
649 Ga0070662_100252236
650 Ga0070681_10013969
651 Ga0068867_100176711
652 Ga0068867_100347205
653 Ga0070685_10016846
654 Ga0070699_100112700
655 Ga0070679_100056822
656 Ga0070679_101747582
657 Ga0070684_100361898
658 Ga0070672_100074804
659 Ga0070695_100201056
660 Ga0070693_100004070
661 Ga0070665_100041292
662 Ga0068855_100018135
663 Ga0070664_100006395
664 Ga0068857_100008304
665 Ga0068857_100959230
666 Ga0068856_100001454
667 Ga0068856_100744143
668 Ga0070702_100005971
669 Ga0070702_100336245
670 Ga0070702_100500853
671 Ga0068852_100013683
672 Ga0068859_100007205
673 Ga0068859_100813726
674 Ga0068864_100012087
675 Ga0068864_100017268
676 Ga0068864_100515597
677 Ga0068861_100001012
678 Ga0068861_100067514
679 Ga0068861_101395605
680 Ga0068851_10151207
681 Ga0068870_10741529
682 Ga0068863_100009851
683 Ga0068858_100004959
684 Ga0068858_100016204
685 Ga0068858_100178654
686 Ga0068860_100020359
687 Ga0068860_100729189
688 Ga0068862_100061062
689 Ga0068862_100116974
690 Ga0068862_100794676
691 Ga0081455_10814854
692 Ga0081455_11059271
693 Ga0081540_1000746
694 Ga0081540_1008241
695 Ga0081540_1027584
696 Ga0070717_10464985
697 Ga0070717_11530684
698 Ga0075365_10004208
699 Ga0075368_10019389
700 Ga0075363_100003404
701 Ga0075364_10000622
702 Ga0070712_100169299
703 Ga0070712_100273346
704 Ga0070712_101142935
705 Ga0075362_10031885
706 Ga0075367_10006277
707 Ga0075367_10597833
708 Ga0075369_10297577
709 Ga0075366_10003457
710 Ga0097621_100207687
711 Ga0097621_100315348
712 Ga0097621_100359803
713 Ga0075370_10007057
714 Ga0075370_10252646
715 Ga0068871_100005789
716 Ga0068871_100215484
717 Ga0075428_102274706
718 Ga0075434_100002311
719 Ga0068865_100918423
720 Ga0068865_100995485
721 Ga0068865_101622674
722 Ga0097620_100007205
723 Ga0097620_100813885
724 Ga0099825_1048782
725 Ga0075435_100021613
726 Ga0075435_100059095
727 Ga0105251_10135599
728 Ga0111539_10334923
729 Ga0105245_10004489
730 Ga0105245_10068791
731 Ga0105245_11604191
732 Ga0105245_12992264
733 Ga0105247_10005396
734 Ga0105243_10014150
735 Ga0105243_11465342
736 Ga0105241_10002107
737 Ga0105241_10450865
738 Ga0105241_12203978
739 Ga0105242_10084620
740 Ga0105242_10379442
741 Ga0105248_10004484
742 Ga0105237_10007570
743 Ga0105237_10067707
744 Ga0105237_11371226
745 Ga0105237_11784864
746 Ga0105238_10005107
747 Ga0105238_11615349
748 Ga0105249_10056342
749 Ga0105239_10008731
750 Ga0105239_10020568
751 Ga0105239_10378883
752 Ga0105239_10468118
753 Ga0105239_10861993
754 Ga0105246_10018255
755 Ga0105246_10258609
756 Ga0105246_11748115
757 Ga0157374_10002234
758 Ga0157374_10261889
759 Ga0157374_10865309
760 Ga0157378_10003173
761 Ga0157378_12547324
762 Ga0163162_10014181
763 Ga0163162_10075494
764 Ga0163162_10104780
765 Ga0163162_11113515
766 Ga0163162_11801095
767 Ga0157372_12733377
768 Ga0157372_13299856
769 Ga0157375_10036826
770 Ga0157375_10405132
771 Ga0157375_10600169
772 Ga0157375_10679545
773 Ga0157375_10752621
774 Ga0163163_10015286
775 Ga0163163_10042873
776 Ga0163163_10045186
777 Ga0157380_10362198
778 Ga0157377_10139882
779 Ga0157379_10010554
780 Ga0157379_10206329
781 Ga0157376_10023821
782 Ga0157376_10421208
783 Ga0157376_10940183
784 Ga0157376_10978644
785 Ga0163161_10706588
786 Ga0213874_10143420
787 Ga0209148_1004505
788 Ga0209233_1001406
789 Ga0209455_1002672
790 Ga0209455_1009245
791 Ga0209758_1151877
792 Ga0207696_1107402
793 Ga0207692_10280327
794 Ga0207692_11005877
795 Ga0207710_10012671
796 Ga0207688_10001741
797 Ga0207647_10009616
798 Ga0207647_10210518
799 Ga0207699_11037891
800 Ga0207645_10307185
801 Ga0207643_10603090
802 Ga0207654_10009260
803 Ga0207707_10025826
804 Ga0207671_10019507
805 Ga0207671_10659583
806 Ga0207693_10047138
807 Ga0207657_10216967
808 Ga0207649_10382476
809 Ga0207681_10065392
810 Ga0207681_10228777
811 Ga0207681_11105080
812 Ga0207694_10011173
813 Ga0207687_10010933
814 Ga0207687_10043107
815 Ga0207700_10017738
816 Ga0207644_10114132
817 Ga0207644_10124261
818 Ga0207644_10509202
819 Ga0207644_10869640
820 Ga0207690_10015632
821 Ga0207706_10004339
822 Ga0207706_10734533
823 Ga0207686_10624104
824 Ga0207709_10040672
825 Ga0207670_10015452
826 Ga0207670_10435236
827 Ga0207704_10767135
828 Ga0207704_11162118
829 Ga0207711_10038303
830 Ga0207711_10187296
831 Ga0207689_10001834
832 Ga0207689_10150585
833 Ga0207689_10610101
834 Ga0207689_10772034
835 Ga0207661_11781649
836 Ga0207679_10097615
837 Ga0207667_10054945
838 Ga0207651_10968128
839 Ga0207712_10037527
840 Ga0207668_10010227
841 Ga0207668_10103897
842 Ga0207668_10147528
843 Ga0207668_11438815
844 Ga0207658_10686829
845 Ga0207677_10011764
846 Ga0207703_10016414
847 Ga0207703_10018378
848 Ga0207639_10291695
849 Ga0207678_10000784
850 Ga0207678_10253270
851 Ga0207678_10702597
852 Ga0207708_10092427
853 Ga0207702_10016276
854 Ga0207702_11339877
855 Ga0207702_11797467
856 Ga0207641_10018366
857 Ga0207641_10022441
858 Ga0207641_12141345
859 Ga0207648_10106325
860 Ga0207648_10223606
861 Ga0207676_10056029
862 Ga0207676_10491392
863 Ga0207674_10011141
864 Ga0207674_10316469
865 Ga0207674_10907985
866 Ga0207675_100001345
867 Ga0207675_100054166
868 Ga0207683_10087356
869 Ga0207683_10156594
870 Ga0207683_10445327
871 Ga0207698_10009228
872 Ga0207698_12480411
873 Ga0209389_1006498
874 Ga0209489_121784
875 Ga0209700_100483
876 Ga0207428_10100228
877 Ga0268266_10012303
878 Ga0268266_10139411
879 Ga0268265_10011302
880 Ga0268265_10057351
881 Ga0268265_10197053
882 Ga0268264_10034038
883 Ga0268264_10483151
884 Ga0268264_12418412
885 Ga0265328_10149610
886 Ga0307508_10139805
887 Ga0307508_10250262
888 Ga0307416_100137776
889 Ga0307411_11825133
890 Ga0307415_100175226
891 Ga0315911_1000035
892 Ga0373923_0004572
893 Ga0373953_0056347
894 Ga0373954_0006825
895 Ga0373954_0039075
896 Ga0373956_0006406
897 Ga0373957_0023574
898 Ga0373957_0119945
899 Ga0373943_0256565
900 Ga0373946_0454488
901 Ga0373955_0041101
902 Ga0373955_0099575
903 Ga0373924_0016044
904 Ga0373935_0944003
905 Ga0373927_0003199
906 Ga0373927_0314376
907 Ga0373933_0012676
908 Ga0373947_0095343
909 Ga0373947_0100012
910 Ga0373947_0231816
911 Ga0373937_0002720
912 Ga0373937_0087967
913 Ga0373937_0831697
914 Ga0373925_0092791
915 Ga0373925_0391905
916 Ga0395898_0145745
917 Ga0436364_0812179
918 Ga0395901_0695774
919 Ga0436363_1648725
920 Ga0451807_0995783
921 Ga0451833_0514708
922 Ga0466972_0563723
923 Ga0466968_0520302
924 Ga0466960_0010572
925 Ga0495592_0001866
926 Ga0495592_0156577
927 Ga0495592_0423250
928 Ga0495603_0121179
929 Ga0495590_0008137
930 Ga0495629_0025362
931 Ga0495638_0002524
932 Ga0495651_0001962
933 Ga0495651_0002719
934 Ga0495651_0583938
935 Ga0495651_0777090
936 Ga0495653_0002019
937 Ga0495653_0084983
938 Ga0495580_0289848
939 Ga0495582_0214315
940 Ga0495639_0244620
941 Ga0495662_0554684
942 Ga0495594_0243802
943 Ga0495583_0176838
944 Ga0495606_0108812
945 Ga0495608_0000371
946 Ga0495608_0039605
947 Ga0495610_0030602
948 Ga0495618_0134825
949 Ga0495618_0699415
950 Ga0495628_0009828
951 Ga0495628_0463168
952 Ga0495628_1180852
953 Ga0495630_0980787
954 Ga0495630_1486211
955 Ga0495643_0161472
956 Ga0495652_0000409
957 Ga0495652_0231813
958 Ga0495665_0137513
959 Ga0495665_0594068
960 Ga0495640_0026203
961 Ga0495587_0000416
962 Ga0495587_0053757
963 Ga0495587_0274452
964 Ga0495587_0592791
965 Ga0495587_0798696
966 Ga0495609_0073009
967 Ga0495597_0234441
968 Ga0495645_0123923
969 Ga0495645_0383430
970 Ga0495645_0420083
971 Ga0495622_0052745
972 Ga0495667_0000952
973 Ga0495667_0433736
974 Ga0495667_0587648
975 Ga0495668_0034663
976 Ga0495668_0076470
977 Ga0495668_0284621
978 Ga0495634_0034412
979 Ga0495625_0020714
980 Ga0495625_0191708
981 Ga0495635_0002491
982 Ga0495635_0148154
983 Ga0495635_0181599
984 Ga0495661_0502558
985 Ga0495588_0289043
986 Ga0495657_0003963
987 Ga0495657_0005216
988 Ga0495657_0295547
989 Ga0495599_0001695
990 Ga0495599_0048004
991 Ga0495623_0001152
992 Ga0495623_0160731
993 Ga0495623_0247208
994 Ga0495646_0033811
995 Ga0495647_0371274
996 Ga0495613_0761312
997 Ga0495671_0063438
998 Ga0495649_0204047
999 Ga0495649_0243982
1000 Ga0495589_0285282
1001 Ga0495600_0000161
1002 Ga0495600_0010070
1003 Ga0495600_0419824
1004 Ga0495581_0041179
1005 Ga0495581_0098943
1006 Ga0495581_0332689
1007 Ga0495604_0001291
1008 Ga0495604_0025153
1009 Ga0495604_0320007
1010 Ga0495674_0009006
1011 Ga0495674_0203863
1012 Ga0495680_0001102
1013 Ga0495680_0147049
1014 Ga0495683_0385201
1015 Ga0495675_0001265
1016 Ga0495675_0021626
1017 Ga0495673_0140989
1018 Ga0495684_0006155
1019 Ga0495686_0010217
1020 Ga0495686_0596591
1021 Ga0495593_0042150
1022 Ga0495593_0101748
1023 Ga0495593_0213036
1024 Ga0495593_0484221
1025 Ga0495602_0002351
1026 Ga0495602_0221755
1027 Ga0495602_0328291
1028 Ga0495614_0199485
1029 Ga0496100_0013918
1030 Ga0496100_0380241
1031 Ga0496100_0439182
1032 Ga0496101_0029125
1033 Ga0496101_0142855
1034 Ga0496101_0251010
1035 Ga0496101_1109331
1036 Ga0496102_0039985
1037 Ga0496102_0055346
1038 Ga0496102_1296478
1039 Ga0496102_1323357
1040 Ga0496103_0002244
1041 Ga0496103_0299040
1042 Ga0496104_0066817
1043 Ga0496104_0106408
1044 Ga0496104_0115562
1045 Ga0496104_0267108
1046 Ga0496104_0340857
1047 Ga0496104_0474732
1048 Ga0496104_0548292
1049 Ga0496104_0658128
1050 Ga0496105_0047482
1051 Ga0496105_0191092
1052 Ga0496106_0009482
1053 Ga0496106_0102475
1054 Ga0496106_0117531
1055 Ga0496106_0777099
1056 Ga0496106_1276992
1057 Ga0496107_0002914
1058 Ga0496107_0104776
1059 Ga0496107_0781648
1060 Ga0496108_0010908
1061 Ga0496108_0122576
1062 Ga0496109_0009657
1063 Ga0496109_1621915
1064 Ga0496110_0024795
1065 Ga0496110_0134507
1066 Ga0496110_0139521
1067 Ga0496110_0253365
1068 Ga0496110_0806368
1069 Ga0496110_1225314
1070 Ga0496111_0005750
1071 Ga0496111_0175227
1072 Ga0496111_0235251
1073 Ga0496112_0003234
1074 Ga0496112_0106241
1075 Ga0496112_0134395
1076 Ga0496112_0348001
1077 Ga0496113_0107414
1078 Ga0496113_0134549
1079 Ga0496113_0225249
1080 Ga0496114_0021094
1081 Ga0496114_0810606
1082 Ga0496114_1078601
1083 Ga0496114_1323537
1084 Ga0496115_0029761
1085 Ga0496115_0238477
1086 Ga0496115_0492477
1087 Ga0496115_0775862
1088 Ga0496115_0882903
1089 Ga0496117_0107188
1090 Ga0496118_0027252
1091 Ga0496118_0028063
1092 Ga0496118_0210876
1093 Ga0496119_0127053
1094 Ga0496120_0417457
1095 Ga0496121_0015237
1096 Ga0496121_0043657
1097 Ga0496121_0079043
1098 Ga0496121_0205310
1099 Ga0496121_0280622
1100 Ga0496121_0400060
1101 Ga0496121_0558374
1102 Ga0496124_0225764
1103 Ga0496124_0524603
1104 Ga0496125_0035713
1105 Ga0496125_0237398
1106 Ga0496126_0047484
1107 Ga0496126_0184931
1108 Ga0496126_0249634
1109 Ga0501047_1011582
1110 Ga0501073_1040560
1111 Ga0501044_0304203
1112 nmdc:mga03683_27846_c1
1113 nmdc:mga03n38_3192_c1
1114 nmdc:mga00v17_3438_c1
1115 nmdc:mga0yw44_12426_c1
1116 nmdc:mga0k408_8575_c1
1117 nmdc:mga06z11_1792_c1
1118 nmdc:mga06z11_556908_c1
1119 nmdc:mga04h51_100879_c1
1120 nmdc:mga07m45_423040_c1
1121 nmdc:mga07m45_6678_c1
1122 nmdc:mga08y16_408001_c1
1123 nmdc:mga0n895_301214_c1
1124 nmdc:mga0n895_9487_c1
1125 nmdc:mga0rr50_2778_c1
1126 nmdc:mga0rr50_47481_c1
1127 nmdc:mga0a205_665963_c1
1128 nmdc:mga0sz30_801_c1
1129 Ga0495601_0325293
1130 Ga0495595_0004899
1131 Ga0495595_0069265
1132 Ga0495619_0000939
1133 Ga0495619_0031033
1134 Ga0495619_0108080
1135 Ga0500578_0109626
1136 Ga0500646_0010439
1137 Ga0500651_0455751
1138 Ga0500555_008463
1139 Ga0500556_0004308
1140 Ga0500562_000293
1141 Ga0500594_0070984
1142 Ga0500642_0001884
1143 Ga0500655_054880
1144 Ga0500658_0136809
1145 Ga0500568_0045789
1146 Ga0500577_0032108
1147 Ga0500588_0020630
1148 Ga0500604_0083974
1149 Ga0500616_0005765
1150 Ga0500622_0000642
1151 Ga0500627_0053653
1152 Ga0500634_0289261
1153 Ga0500599_000131
1154 2513646364
1155 2513660698
1156 2513862534
1157 2513922494
1158 2517888433
1159 2528857860
1160 2793081374
1161 2818241308
1162 2824666209
1163 2879103829
1164 2904699275
1165 2906638823
1166 2906660914
1167 2908758873
1168 2932791966
1169 2932815724
1170 2932827753
1171 2932835912
1172 2935619966
1173 2935631314
1174 2935636618
1175 2935642208
1176 2935668488
1177 2935706348
1178 2935810299
1179 2935814663
1180 2935831801
1181 2935838842
1182 2935857719
1183 2935868940
1184 2935874355
1185 2935998901
1186 2936001250
1187 2936007754
1188 2936010465
1189 2936040220
1190 2941510055
1191 2941513254
1192 2941518858
1193 2941521217
1194 2941525454
1195 2941529071
1196 2941538560
1197 8016514356
1198 8017062067
1199 8019561974
1200 8019582449
1201 8019590232
1202 8019601115
1203 8019617430
1204 8056674724

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF11345

DUF3147

Protein of unknown function (DUF3147)

9

117

0.84

Map