F467948

General Info

Members Datasets Scaffolds Average Seq Length
600 272 1200 85

Family's Representative Sequence

Representative Sequence 3300005347|Ga0070668_100851647|Ga0070668_1008516472
Length 95
Sequence VVYDRGMCRNIHTLYNFEPAATQEEVRAAAHQYVRKISGFSKPSRANAEAFGEAVDAVAAASATLLDQLVTSAPPKDREVEAAKARARAAERFAA

Samples

Sample ID Description Type Environment
1 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
2 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
21 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
22 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
25 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
32 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
33 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
34 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
35 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
41 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
42 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
43 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
44 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
48 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
49 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
50 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
53 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
54 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
55 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
56 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
57 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
58 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
59 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
60 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
61 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
62 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
63 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
64 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
65 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
66 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
67 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
69 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
70 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
71 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
72 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
73 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
74 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
75 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
76 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
78 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
80 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
81 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
82 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
83 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
84 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
85 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
86 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
87 3300012494 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 Metagenome Rhizosphere
88 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
89 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
90 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
91 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
92 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
93 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
94 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
95 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
96 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
97 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
98 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
99 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
100 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
147 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
148 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
151 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
152 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
153 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
154 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
155 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
156 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
157 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
158 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
159 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
160 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
161 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
162 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
163 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
164 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
165 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
166 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
167 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
168 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
169 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
170 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
171 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
172 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
173 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
174 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
175 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
176 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
177 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
178 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
179 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
180 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
181 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
182 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
183 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
184 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
185 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
186 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
187 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
188 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
189 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
190 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
191 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
192 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
193 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
194 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
195 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
196 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
197 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
198 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
199 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
200 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
201 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
202 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
203 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
204 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
205 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
206 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
207 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
208 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
209 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
210 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
211 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
212 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
213 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
214 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
215 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
216 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
217 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
218 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
219 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
220 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
221 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
222 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
223 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
224 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
225 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
226 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
227 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
228 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
229 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
230 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
231 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
232 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
233 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
234 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
235 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
236 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
237 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
238 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
239 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
240 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
241 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
242 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
243 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
244 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
245 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
246 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
247 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
248 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
249 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
250 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
251 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
252 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
253 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
254 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
255 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
256 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
257 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
258 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
259 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
260 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
261 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
262 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
263 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
264 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
265 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
266 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
267 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
268 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
269 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
270 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
271 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
272 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.67
Nodule 0
Rhizoplane 7.83
Rhizosphere 90.17
Stem 0
Stem Tuber 0
Unclassified 3

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070668_100851647 3300005347 Bacteria 812
2 JGI24747J21853_1050799 3300001978 Bacteria 505
3 Ga0070690_100011734 3300005330 Bacteria 5135
4 Ga0070666_11239544 3300005335 Bacteria 556
5 Ga0070680_100029951 3300005336 Bacteria 4371
6 Ga0070682_100000862 3300005337 Bacteria 17774
7 Ga0068868_100238947 3300005338 Bacteria 1525
8 Ga0070660_100115812 3300005339 Bacteria 2137
9 Ga0070689_100026892 3300005340 Bacteria 4335
10 Ga0070691_10273436 3300005341 Bacteria 914
11 Ga0070692_10001906 3300005345 Bacteria 7874
12 Ga0070692_11070631 3300005345 Bacteria 568
13 Ga0070668_100082941 3300005347 Bacteria 2515
14 Ga0070675_100363073 3300005354 Bacteria 1286
15 Ga0070675_101222459 3300005354 Bacteria 692
16 Ga0070671_100024615 3300005355 Bacteria 4931
17 Ga0070671_100442805 3300005355 Bacteria 1114
18 Ga0070674_100001418 3300005356 Bacteria 12717
19 Ga0070674_100616216 3300005356 Bacteria 919
20 Ga0070674_101453694 3300005356 Bacteria 615
21 Ga0070688_100044181 3300005365 Bacteria 2749
22 Ga0070688_101703133 3300005365 Bacteria 516
23 Ga0070659_100055694 3300005366 Bacteria 3117
24 Ga0070709_10197269 3300005434 Bacteria 1423
25 Ga0070709_11224669 3300005434 Bacteria 604
26 Ga0070714_100026735 3300005435 Bacteria 4771
27 Ga0070714_100141691 3300005435 Bacteria 2159
28 Ga0070714_100474129 3300005435 Bacteria 1191
29 Ga0070714_100667579 3300005435 Bacteria 1001
30 Ga0070713_100032491 3300005436 Bacteria 4169
31 Ga0070713_100045693 3300005436 Bacteria 3590
32 Ga0070713_100434592 3300005436 Bacteria 1230
33 Ga0070710_10003622 3300005437 Bacteria 7306
34 Ga0070710_10603688 3300005437 Bacteria 764
35 Ga0070710_10614270 3300005437 Bacteria 758
36 Ga0070711_100001093 3300005439 Bacteria 14485
37 Ga0070711_100717182 3300005439 Bacteria 843
38 Ga0070705_100017362 3300005440 Bacteria 3756
39 Ga0070700_100002883 3300005441 Bacteria 8838
40 Ga0070700_100068794 3300005441 Bacteria 2253
41 Ga0070700_101349477 3300005441 Bacteria 601
42 Ga0070694_100109808 3300005444 Bacteria 1963
43 Ga0070708_100173959 3300005445 Bacteria 2011
44 Ga0070708_100589053 3300005445 Bacteria 1048
45 Ga0070663_100395802 3300005455 Bacteria 1128
46 Ga0070678_100002601 3300005456 Bacteria 9922
47 Ga0070678_101471906 3300005456 Bacteria 637
48 Ga0070662_100185977 3300005457 Bacteria 1640
49 Ga0070681_11717511 3300005458 Bacteria 554
50 Ga0068867_100001036 3300005459 Bacteria 18959
51 Ga0070685_10131603 3300005466 Bacteria 1565
52 Ga0070706_100020344 3300005467 Bacteria 6115
53 Ga0070706_100041712 3300005467 Bacteria 4237
54 Ga0070706_100052262 3300005467 Bacteria 3772
55 Ga0070706_100376447 3300005467 Bacteria 1322
56 Ga0070706_100662290 3300005467 Unclassified 969
57 Ga0070707_100028859 3300005468 Bacteria 5280
58 Ga0070707_100128398 3300005468 Bacteria 2464
59 Ga0070707_100136353 3300005468 Bacteria 2387
60 Ga0070707_100151687 3300005468 Unclassified 2257
61 Ga0070707_100377072 3300005468 Unclassified 1378
62 Ga0070698_100009783 3300005471 Bacteria 10251
63 Ga0070698_100016241 3300005471 Bacteria 7858
64 Ga0070698_100602273 3300005471 Bacteria 1039
65 Ga0070698_100667941 3300005471 Bacteria 981
66 Ga0070698_100967962 3300005471 Unclassified 798
67 Ga0070698_101071380 3300005471 Bacteria 754
68 Ga0070699_100007608 3300005518 Bacteria 9417
69 Ga0070699_100165916 3300005518 Bacteria 1956
70 Ga0070699_100171157 3300005518 Bacteria 1924
71 Ga0070699_101181535 3300005518 Bacteria 702
72 Ga0070699_101586312 3300005518 Bacteria 600
73 Ga0070699_101672761 3300005518 Bacteria 583
74 Ga0070679_102012006 3300005530 Unclassified 527
75 Ga0070697_100267573 3300005536 Bacteria 1464
76 Ga0070697_100572120 3300005536 Unclassified 992
77 Ga0068853_100021208 3300005539 Bacteria 5412
78 Ga0070672_100008274 3300005543 Bacteria 7108
79 Ga0070672_100607667 3300005543 Bacteria 953
80 Ga0070686_100007337 3300005544 Bacteria 6146
81 Ga0070686_101483662 3300005544 Bacteria 571
82 Ga0070695_100648011 3300005545 Bacteria 834
83 Ga0070696_100075490 3300005546 Bacteria 2378
84 Ga0070696_100347638 3300005546 Bacteria 1148
85 Ga0070693_100271684 3300005547 Bacteria 1132
86 Ga0070693_100276688 3300005547 Bacteria 1122
87 Ga0070704_100001173 3300005549 Bacteria 13680
88 Ga0068855_100302569 3300005563 Bacteria 1771
89 Ga0068857_101983431 3300005577 Bacteria 571
90 Ga0068854_100056087 3300005578 Bacteria 2839
91 Ga0068854_102248188 3300005578 Bacteria 505
92 Ga0068856_100007480 3300005614 Bacteria 10662
93 Ga0068856_100182679 3300005614 Bacteria 2111
94 Ga0070702_100001715 3300005615 Bacteria 9101
95 Ga0070702_100237353 3300005615 Bacteria 1228
96 Ga0068852_100279492 3300005616 Bacteria 1609
97 Ga0068864_100359976 3300005618 Bacteria 1375
98 Ga0068866_10000431 3300005718 Bacteria 19425
99 Ga0068861_100950801 3300005719 Bacteria 817
100 Ga0068863_100359612 3300005841 Bacteria 1419
101 Ga0068858_100629214 3300005842 Bacteria 1042
102 Ga0068858_101050151 3300005842 Bacteria 799
103 Ga0068860_100098060 3300005843 Bacteria 2795
104 Ga0068862_100195343 3300005844 Bacteria 1823
105 Ga0068862_101135312 3300005844 Bacteria 778
106 Ga0081455_10095407 3300005937 Bacteria 2401
107 Ga0081538_10000017 3300005981 Bacteria 145769
108 Ga0081538_10000129 3300005981 Bacteria 77457
109 Ga0081538_10000340 3300005981 Bacteria 53140
110 Ga0081538_10015202 3300005981 Bacteria 5973
111 Ga0081538_10246635 3300005981 Bacteria 684
112 Ga0070717_10001105 3300006028 Bacteria 18179
113 Ga0075365_10103857 3300006038 Bacteria 1948
114 Ga0075364_10422382 3300006051 Bacteria 910
115 Ga0075432_10063124 3300006058 Bacteria 1322
116 Ga0070715_10024810 3300006163 Bacteria 2367
117 Ga0070716_100188491 3300006173 Bacteria 1361
118 Ga0070712_100018173 3300006175 Bacteria 4563
119 Ga0070712_100041697 3300006175 Bacteria 3152
120 Ga0070712_100121605 3300006175 Bacteria 1965
121 Ga0097621_100502029 3300006237 Bacteria 1099
122 Ga0068871_100001063 3300006358 Bacteria 18424
123 Ga0068871_101350948 3300006358 Bacteria 671
124 Ga0075428_100030573 3300006844 Bacteria 5956
125 Ga0075431_100108149 3300006847 Bacteria 2869
126 Ga0075431_100434189 3300006847 Bacteria 1311
127 Ga0075433_10119997 3300006852 Bacteria 2334
128 Ga0075434_100083322 3300006871 Bacteria 3195
129 Ga0075434_100094778 3300006871 Bacteria 2990
130 Ga0068865_100002648 3300006881 Bacteria 10636
131 Ga0068865_100203489 3300006881 Bacteria 1538
132 Ga0075436_101046190 3300006914 Bacteria 613
133 Ga0075435_100138920 3300007076 Bacteria 2037
134 Ga0075435_100162446 3300007076 Bacteria 1882
135 Ga0111539_10027013 3300009094 Bacteria 7011
136 Ga0111539_12790607 3300009094 Bacteria 566
137 Ga0105245_10053548 3300009098 Bacteria 3622
138 Ga0105245_11199081 3300009098 Bacteria 807
139 Ga0105245_11211452 3300009098 Bacteria 803
140 Ga0114129_10801950 3300009147 Bacteria 1201
141 Ga0114129_11149768 3300009147 Bacteria 969
142 Ga0105243_10294610 3300009148 Bacteria 1468
143 Ga0105243_10522426 3300009148 Bacteria 1129
144 Ga0105241_10258144 3300009174 Bacteria 1480
145 Ga0105242_10040431 3300009176 Bacteria 3758
146 Ga0105242_10962141 3300009176 Bacteria 859
147 Ga0105242_11210432 3300009176 Bacteria 775
148 Ga0105248_10005578 3300009177 Bacteria 13829
149 Ga0105237_10049175 3300009545 Bacteria 4239
150 Ga0105249_10001961 3300009553 Bacteria 17846
151 Ga0105239_10011363 3300010375 Bacteria 9935
152 Ga0105239_11856095 3300010375 Bacteria 699
153 Ga0105246_10046708 3300011119 Bacteria 2955
154 Ga0157341_1028006 3300012494 Bacteria 594
155 Ga0157371_10174187 3300013102 Bacteria 1538
156 Ga0157369_10418031 3300013105 Bacteria 1390
157 Ga0157369_11956581 3300013105 Bacteria 595
158 Ga0157374_10333490 3300013296 Bacteria 1505
159 Ga0157378_10003883 3300013297 Bacteria 13235
160 Ga0163162_10012286 3300013306 Bacteria 8361
161 Ga0163162_10330431 3300013306 Bacteria 1657
162 Ga0157372_13278926 3300013307 Unclassified 516
163 Ga0157375_10009351 3300013308 Bacteria 8604
164 Ga0157380_10841148 3300014326 Bacteria 939
165 Ga0182008_10392569 3300014497 Bacteria 744
166 Ga0182008_10457089 3300014497 Bacteria 695
167 Ga0157377_10086268 3300014745 Bacteria 1844
168 Ga0157377_11075956 3300014745 Bacteria 614
169 Ga0157376_10003613 3300014969 Bacteria 10674
170 Ga0163161_10041797 3300017792 Bacteria 3295
171 Ga0163161_10335535 3300017792 Bacteria 1198
172 Ga0163161_11345963 3300017792 Bacteria 622
173 Ga0207653_10058776 3300025885 Bacteria 1293
174 Ga0207692_10209123 3300025898 Bacteria 1151
175 Ga0207692_11184657 3300025898 Bacteria 507
176 Ga0207688_10119009 3300025901 Bacteria 1540
177 Ga0207680_10475706 3300025903 Bacteria 888
178 Ga0207685_10019008 3300025905 Bacteria 2256
179 Ga0207699_10209019 3300025906 Bacteria 1326
180 Ga0207684_10024864 3300025910 Bacteria 5103
181 Ga0207684_10037031 3300025910 Bacteria 4141
182 Ga0207684_11188919 3300025910 Bacteria 632
183 Ga0207654_10670993 3300025911 Bacteria 743
184 Ga0207707_10883614 3300025912 Bacteria 740
185 Ga0207693_10007333 3300025915 Bacteria 9071
186 Ga0207663_10089328 3300025916 Bacteria 2040
187 Ga0207663_10156617 3300025916 Bacteria 1603
188 Ga0207660_10207189 3300025917 Bacteria 1534
189 Ga0207660_10553913 3300025917 Bacteria 935
190 Ga0207662_10007150 3300025918 Bacteria 6071
191 Ga0207662_10327997 3300025918 Bacteria 1023
192 Ga0207657_10011671 3300025919 Bacteria 8708
193 Ga0207649_11077786 3300025920 Bacteria 633
194 Ga0207646_10013663 3300025922 Bacteria 7754
195 Ga0207646_10110151 3300025922 Bacteria 2471
196 Ga0207646_10148584 3300025922 Unclassified 2113
197 Ga0207681_11571819 3300025923 Bacteria 551
198 Ga0207681_11745330 3300025923 Bacteria 520
199 Ga0207659_10009602 3300025926 Bacteria 6052
200 Ga0207659_10470998 3300025926 Bacteria 1060
201 Ga0207659_10798336 3300025926 Bacteria 811
202 Ga0207687_11460709 3300025927 Bacteria 587
203 Ga0207700_10027179 3300025928 Bacteria 4003
204 Ga0207700_10470870 3300025928 Bacteria 1109
205 Ga0207700_10676990 3300025928 Bacteria 920
206 Ga0207664_10067225 3300025929 Bacteria 2875
207 Ga0207664_10463605 3300025929 Bacteria 1132
208 Ga0207644_10121994 3300025931 Bacteria 1985
209 Ga0207690_10035262 3300025932 Bacteria 3230
210 Ga0207706_10171638 3300025933 Bacteria 1905
211 Ga0207686_10011112 3300025934 Bacteria 4920
212 Ga0207686_10911905 3300025934 Bacteria 709
213 Ga0207709_10043947 3300025935 Bacteria 2697
214 Ga0207669_10017087 3300025937 Bacteria 3710
215 Ga0207669_10454245 3300025937 Bacteria 1016
216 Ga0207704_10009364 3300025938 Bacteria 4724
217 Ga0207704_10148680 3300025938 Bacteria 1650
218 Ga0207665_10799041 3300025939 Unclassified 745
219 Ga0207711_10052591 3300025941 Bacteria 3491
220 Ga0207689_11141765 3300025942 Bacteria 656
221 Ga0207667_12244696 3300025949 Bacteria 502
222 Ga0207651_10148772 3300025960 Bacteria 1820
223 Ga0207712_10003902 3300025961 Bacteria 9419
224 Ga0207668_10154418 3300025972 Bacteria 1781
225 Ga0207668_10983507 3300025972 Bacteria 754
226 Ga0207677_11520246 3300026023 Bacteria 619
227 Ga0207677_11574455 3300026023 Bacteria 608
228 Ga0207677_11698230 3300026023 Bacteria 585
229 Ga0207703_10510034 3300026035 Bacteria 1130
230 Ga0207639_10035938 3300026041 Bacteria 3669
231 Ga0207678_10006862 3300026067 Bacteria 10098
232 Ga0207708_10000220 3300026075 Bacteria 45476
233 Ga0207708_11249705 3300026075 Bacteria 650
234 Ga0207702_10073419 3300026078 Bacteria 2949
235 Ga0207648_10002129 3300026089 Bacteria 21539
236 Ga0207648_10627678 3300026089 Bacteria 992
237 Ga0207648_11602238 3300026089 Bacteria 612
238 Ga0207674_11887230 3300026116 Bacteria 564
239 Ga0207675_100013476 3300026118 Bacteria 7629
240 Ga0207675_100504209 3300026118 Bacteria 1205
241 Ga0207683_10006814 3300026121 Bacteria 9781
242 Ga0207698_10097467 3300026142 Bacteria 2427
243 Ga0209998_10162709 3300027717 Bacteria 576
244 Ga0207428_10052443 3300027907 Bacteria 3257
245 Ga0268265_11033563 3300028380 Bacteria 813
246 Ga0268265_11108974 3300028380 Bacteria 786
247 Ga0268264_10285982 3300028381 Bacteria 1547
248 Ga0307416_101202337 3300032002 Bacteria 863
249 Ga0373944_0308845 3300035089 Bacteria 595
250 Ga0373927_0691328 3300035695 Bacteria 674
251 Ga0373947_0212188 3300035725 Bacteria 1270
252 Ga0395899_0034507 3300037312 Bacteria 3800
253 Ga0395899_0141210 3300037312 Bacteria 1713
254 Ga0395899_0538262 3300037312 Bacteria 752
255 Ga0395899_0625091 3300037312 Bacteria 683
256 Ga0395900_0001291 3300037418 Bacteria 30553
257 Ga0395900_0001589 3300037418 Bacteria 26870
258 Ga0395900_0001855 3300037418 Bacteria 24086
259 Ga0395900_0004208 3300037418 Bacteria 15271
260 Ga0395900_0045211 3300037418 Bacteria 4535
261 Ga0395900_0296827 3300037418 Bacteria 1603
262 Ga0395900_0579037 3300037418 Bacteria 1064
263 Ga0395898_0001958 3300037466 Bacteria 26038
264 Ga0395898_0007590 3300037466 Bacteria 11515
265 Ga0395898_0015020 3300037466 Bacteria 7948
266 Ga0395898_0023647 3300037466 Bacteria 6205
267 Ga0395898_0025561 3300037466 Bacteria 5948
268 Ga0395898_0065368 3300037466 Bacteria 3526
269 Ga0395898_0323521 3300037466 Bacteria 1471
270 Ga0395898_0622530 3300037466 Bacteria 1022
271 Ga0395898_1118762 3300037466 Bacteria 720
272 Ga0395905_0003055 3300037471 Bacteria 18136
273 Ga0395905_0003743 3300037471 Bacteria 16123
274 Ga0395905_0004895 3300037471 Bacteria 13800
275 Ga0395905_0044514 3300037471 Bacteria 4166
276 Ga0395905_0092119 3300037471 Bacteria 2842
277 Ga0395905_0288321 3300037471 Bacteria 1528
278 Ga0395905_0344019 3300037471 Bacteria 1383
279 Ga0395905_0411151 3300037471 Bacteria 1248
280 Ga0395905_1363767 3300037471 Bacteria 613
281 Ga0395901_0000365 3300038443 Bacteria 54535
282 Ga0395901_0000733 3300038443 Bacteria 37083
283 Ga0395901_0002616 3300038443 Bacteria 18216
284 Ga0395901_0036901 3300038443 Bacteria 5053
285 Ga0395901_0046325 3300038443 Bacteria 4516
286 Ga0395901_0210136 3300038443 Bacteria 2037
287 Ga0395901_0626742 3300038443 Bacteria 1081
288 Ga0395901_0669303 3300038443 Bacteria 1039
289 Ga0395901_0792486 3300038443 Bacteria 937
290 Ga0395901_1775860 3300038443 Bacteria 566
291 Ga0451789_0343320 3300041443 Bacteria 2548
292 Ga0451800_0468593 3300041459 Bacteria 1816
293 Ga0451802_2128326 3300041460 Bacteria 937
294 Ga0451806_551924 3300041462 Bacteria 654
295 Ga0451804_0641610 3300041463 Bacteria 1317
296 Ga0451807_1894418 3300041486 Bacteria 1238
297 Ga0451833_0310772 3300041491 Bacteria 1082
298 Ga0451835_1167386 3300041492 Bacteria 518
299 Ga0451839_0139508 3300041496 Bacteria 2893
300 Ga0451847_0939586 3300041503 Bacteria 1183
301 Ga0451849_0744416 3300041505 Bacteria 1462
302 Ga0451851_0243833 3300041507 Bacteria 2128
303 Ga0451843_1230422 3300041509 Bacteria 808
304 Ga0451855_1029199 3300041511 Bacteria 1675
305 Ga0439442_100688 3300042002 Bacteria 625
306 Ga0439460_0099018 3300042461 Bacteria 935
307 Ga0439440_0231774 3300042993 Bacteria 557
308 Ga0466964_0002357 3300044706 Bacteria 6712
309 Ga0466968_0064940 3300044735 Bacteria 1579
310 Ga0466968_0116108 3300044735 Bacteria 1208
311 Ga0466960_0006206 3300044901 Bacteria 4787
312 Ga0466960_0145300 3300044901 Bacteria 1263
313 Ga0466960_0283620 3300044901 Bacteria 929
314 Ga0466967_0018556 3300045976 Bacteria 5564
315 Ga0466967_0035681 3300045976 Bacteria 4236
316 Ga0466967_1099206 3300045976 Bacteria 792
317 Ga0495603_0098413 3300046455 Bacteria 1708
318 Ga0495641_0013782 3300046461 Bacteria 4416
319 Ga0495641_0049170 3300046461 Bacteria 1932
320 Ga0495582_0044879 3300046473 Bacteria 2434
321 Ga0495582_0171704 3300046473 Bacteria 1234
322 Ga0495605_0089042 3300046474 Bacteria 1433
323 Ga0495605_0091497 3300046474 Unclassified 1409
324 Ga0495605_0367849 3300046474 Unclassified 601
325 Ga0495662_0045317 3300046476 Bacteria 2123
326 Ga0495584_0030721 3300046491 Bacteria 2721
327 Ga0495584_0167420 3300046491 Unclassified 1117
328 Ga0495585_0394420 3300046492 Bacteria 667
329 Ga0495594_0090072 3300046499 Bacteria 1718
330 Ga0495596_0149353 3300046500 Unclassified 908
331 Ga0495630_0208475 3300046517 Bacteria 1492
332 Ga0495631_0339772 3300046518 Bacteria 639
333 Ga0495631_0484591 3300046518 Bacteria 527
334 Ga0495644_0459185 3300046523 Bacteria 507
335 Ga0495663_0013322 3300046525 Bacteria 2299
336 Ga0495666_0036900 3300046526 Bacteria 2379
337 Ga0495642_0023739 3300046528 Bacteria 2423
338 Ga0495642_0209772 3300046528 Bacteria 850
339 Ga0495642_0215266 3300046528 Unclassified 838
340 Ga0495665_0038856 3300046531 Bacteria 2537
341 Ga0495656_0019998 3300046615 Bacteria 2592
342 Ga0495656_0091084 3300046615 Bacteria 1394
343 Ga0495656_0333254 3300046615 Bacteria 784
344 Ga0495659_0121508 3300046664 Bacteria 1029
345 Ga0495588_0047276 3300046674 Bacteria 2209
346 Ga0495588_0716027 3300046674 Bacteria 523
347 Ga0495647_0018763 3300046681 Bacteria 2467
348 Ga0495647_0111437 3300046681 Bacteria 1142
349 Ga0495658_0377981 3300046683 Bacteria 902
350 Ga0495624_0000007 3300046690 Bacteria 146202
351 Ga0495624_0206842 3300046690 Bacteria 1191
352 Ga0495589_0083056 3300046794 Bacteria 1557
353 Ga0495581_0014131 3300047315 Bacteria 4627
354 Ga0495581_0141492 3300047315 Bacteria 1403
355 Ga0495636_0079672 3300047318 Unclassified 1409
356 Ga0495676_0088363 3300047321 Bacteria 2325
357 Ga0495677_0013266 3300047445 Bacteria 2998
358 Ga0495677_0036171 3300047445 Bacteria 1803
359 Ga0495677_0211274 3300047445 Bacteria 755
360 Ga0495679_186417 3300047446 Unclassified 549
361 Ga0495685_097288 3300047447 Unclassified 973
362 Ga0495593_0347134 3300047673 Bacteria 742
363 Ga0495614_0394383 3300048089 Bacteria 649
364 Ga0495615_0327374 3300048090 Bacteria 502
365 Ga0496100_0185670 3300048903 Bacteria 1506
366 Ga0496100_0302907 3300048903 Bacteria 1196
367 Ga0496101_0424110 3300048904 Bacteria 1048
368 Ga0496101_0576627 3300048904 Bacteria 890
369 Ga0496102_0007816 3300048905 Bacteria 9143
370 Ga0496102_0046481 3300048905 Bacteria 3943
371 Ga0496102_0231480 3300048905 Bacteria 1742
372 Ga0496103_0005078 3300048906 Bacteria 7930
373 Ga0496103_0056321 3300048906 Bacteria 2440
374 Ga0496104_0028130 3300048907 Bacteria 5209
375 Ga0496104_0326038 3300048907 Bacteria 1449
376 Ga0496104_0766326 3300048907 Bacteria 871
377 Ga0496105_0010350 3300048908 Bacteria 7333
378 Ga0496105_0010526 3300048908 Bacteria 7275
379 Ga0496106_0030291 3300048909 Bacteria 4035
380 Ga0496106_0236630 3300048909 Bacteria 1459
381 Ga0496107_0042792 3300048910 Bacteria 3253
382 Ga0496107_0106785 3300048910 Bacteria 2056
383 Ga0496107_0300855 3300048910 Bacteria 1194
384 Ga0496107_1169236 3300048910 Bacteria 554
385 Ga0496108_0006656 3300048911 Bacteria 9358
386 Ga0496108_0526689 3300048911 Bacteria 1032
387 Ga0496108_1556921 3300048911 Bacteria 548
388 Ga0496109_0006589 3300048912 Bacteria 9777
389 Ga0496109_0208060 3300048912 Bacteria 1840
390 Ga0496109_0251655 3300048912 Bacteria 1664
391 Ga0496110_0018203 3300048913 Bacteria 5887
392 Ga0496110_0207575 3300048913 Bacteria 1780
393 Ga0496111_0026838 3300048914 Bacteria 4069
394 Ga0496111_0083664 3300048914 Bacteria 2332
395 Ga0496111_0378218 3300048914 Bacteria 1047
396 Ga0496111_0891841 3300048914 Bacteria 641
397 Ga0496112_0176337 3300048915 Bacteria 2102
398 Ga0496112_1029900 3300048915 Bacteria 742
399 Ga0496113_0070893 3300048916 Bacteria 2650
400 Ga0496113_0518290 3300048916 Bacteria 957
401 Ga0496114_0000589 3300048917 Bacteria 26801
402 Ga0496114_0030233 3300048917 Bacteria 4456
403 Ga0496114_0097562 3300048917 Bacteria 2504
404 Ga0496115_0025386 3300048918 Bacteria 4613
405 Ga0496115_0119730 3300048918 Bacteria 2165
406 Ga0501031_0000532 3300049568 Bacteria 22249
407 Ga0501031_0018146 3300049568 Bacteria 4578
408 Ga0501031_0054370 3300049568 Bacteria 2609
409 Ga0501031_0142823 3300049568 Bacteria 1564
410 Ga0501031_0660995 3300049568 Bacteria 671
411 Ga0501031_0827272 3300049568 Bacteria 593
412 Ga0501031_1058413 3300049568 Bacteria 518
413 Ga0501032_0000714 3300049569 Bacteria 27059
414 Ga0501032_0282067 3300049569 Bacteria 1075
415 Ga0501032_0301647 3300049569 Bacteria 1035
416 Ga0501032_0469772 3300049569 Bacteria 805
417 Ga0501033_0000987 3300049570 Bacteria 25891
418 Ga0501033_0020846 3300049570 Bacteria 4948
419 Ga0501033_0287281 3300049570 Bacteria 1160
420 Ga0501033_0648709 3300049570 Bacteria 721
421 Ga0501033_0760920 3300049570 Bacteria 656
422 Ga0501034_0009386 3300049571 Bacteria 10248
423 Ga0501036_0000681 3300049572 Bacteria 25022
424 Ga0501036_0002396 3300049572 Bacteria 14666
425 Ga0501036_0115333 3300049572 Bacteria 2269
426 Ga0501036_0440690 3300049572 Bacteria 1085
427 Ga0501036_1406692 3300049572 Bacteria 565
428 Ga0501037_0001001 3300049573 Bacteria 20939
429 Ga0501037_0203177 3300049573 Bacteria 1399
430 Ga0501037_0364436 3300049573 Bacteria 995
431 Ga0501037_1059183 3300049573 Bacteria 526
432 Ga0501038_0001029 3300049574 Bacteria 25172
433 Ga0501038_0011566 3300049574 Bacteria 8051
434 Ga0501038_0302666 3300049574 Bacteria 1254
435 Ga0501038_0305551 3300049574 Bacteria 1247
436 Ga0501038_1312311 3300049574 Bacteria 522
437 Ga0501039_0003396 3300049575 Bacteria 11900
438 Ga0501039_0010203 3300049575 Bacteria 7159
439 Ga0501039_0023512 3300049575 Bacteria 4728
440 Ga0501039_0088909 3300049575 Bacteria 2406
441 Ga0501039_0099232 3300049575 Bacteria 2272
442 Ga0501039_1305374 3300049575 Bacteria 560
443 Ga0501040_0000515 3300049576 Bacteria 23152
444 Ga0501040_0007111 3300049576 Bacteria 7247
445 Ga0501040_0025467 3300049576 Bacteria 3977
446 Ga0501040_0103003 3300049576 Bacteria 1992
447 Ga0501040_0272928 3300049576 Bacteria 1207
448 Ga0501040_0991066 3300049576 Bacteria 609
449 Ga0501041_0003328 3300049577 Bacteria 9246
450 Ga0501041_0004471 3300049577 Bacteria 8099
451 Ga0501041_0061939 3300049577 Bacteria 2290
452 Ga0501041_0231464 3300049577 Bacteria 1160
453 Ga0501041_0463625 3300049577 Bacteria 805
454 Ga0501042_0001023 3300049578 Bacteria 15907
455 Ga0501042_0001268 3300049578 Bacteria 14704
456 Ga0501042_0051392 3300049578 Bacteria 2939
457 Ga0501042_0109961 3300049578 Bacteria 1984
458 Ga0501042_0125837 3300049578 Bacteria 1845
459 Ga0501042_0360049 3300049578 Bacteria 1053
460 Ga0501042_1272689 3300049578 Bacteria 536
461 Ga0501043_0000750 3300049579 Bacteria 28826
462 Ga0501043_0067804 3300049579 Bacteria 2802
463 Ga0501043_0106275 3300049579 Bacteria 2205
464 Ga0501043_0317298 3300049579 Bacteria 1188
465 Ga0501043_1248856 3300049579 Unclassified 520
466 Ga0501046_0000475 3300049580 Bacteria 40215
467 Ga0501046_0027390 3300049580 Bacteria 4649
468 Ga0501046_0029178 3300049580 Bacteria 4486
469 Ga0501046_0084983 3300049580 Bacteria 2440
470 Ga0501046_0153944 3300049580 Bacteria 1733
471 Ga0501046_0897144 3300049580 Bacteria 618
472 Ga0501047_0001366 3300049581 Bacteria 23962
473 Ga0501047_0028856 3300049581 Bacteria 5352
474 Ga0501047_0187816 3300049581 Bacteria 1931
475 Ga0501047_0346948 3300049581 Bacteria 1321
476 Ga0501048_0000881 3300049582 Bacteria 22170
477 Ga0501048_0009725 3300049582 Bacteria 7211
478 Ga0501048_0018476 3300049582 Bacteria 5126
479 Ga0501048_0085857 3300049582 Bacteria 2219
480 Ga0501048_0405582 3300049582 Bacteria 974
481 Ga0501067_0000531 3300049583 Bacteria 20772
482 Ga0501068_0000481 3300049584 Bacteria 20160
483 Ga0501068_0266837 3300049584 Bacteria 1092
484 Ga0501068_0485604 3300049584 Bacteria 800
485 Ga0501068_0500110 3300049584 Bacteria 788
486 Ga0501068_0817310 3300049584 Bacteria 611
487 Ga0501069_0003511 3300049585 Bacteria 8073
488 Ga0501069_0114827 3300049585 Bacteria 1535
489 Ga0501069_0284628 3300049585 Bacteria 968
490 Ga0501069_0323109 3300049585 Bacteria 907
491 Ga0501069_0363001 3300049585 Bacteria 854
492 Ga0501069_0728160 3300049585 Bacteria 599
493 Ga0501070_0004094 3300049586 Bacteria 12538
494 Ga0501070_0093981 3300049586 Bacteria 2481
495 Ga0501070_0549599 3300049586 Bacteria 924
496 Ga0501070_0724665 3300049586 Bacteria 785
497 Ga0501070_1055739 3300049586 Bacteria 628
498 Ga0501070_1320868 3300049586 Bacteria 550
499 Ga0501071_0005459 3300049587 Bacteria 8175
500 Ga0501071_0007333 3300049587 Bacteria 7228
501 Ga0501071_0021049 3300049587 Bacteria 4540
502 Ga0501071_0115683 3300049587 Bacteria 1984
503 Ga0501071_0544339 3300049587 Bacteria 891
504 Ga0501071_1234482 3300049587 Bacteria 577
505 Ga0501072_0000365 3300049588 Bacteria 32224
506 Ga0501072_0000894 3300049588 Bacteria 21861
507 Ga0501072_0009778 3300049588 Bacteria 7290
508 Ga0501072_0058225 3300049588 Bacteria 3045
509 Ga0501072_0446941 3300049588 Bacteria 1024
510 Ga0501072_0737617 3300049588 Bacteria 773
511 Ga0501072_1449424 3300049588 Bacteria 530
512 Ga0501073_0002069 3300049589 Bacteria 15002
513 Ga0501073_0030631 3300049589 Bacteria 3840
514 Ga0501073_0201156 3300049589 Bacteria 1378
515 Ga0501073_0445171 3300049589 Bacteria 895
516 Ga0501074_0000505 3300049590 Bacteria 23892
517 Ga0501074_0144163 3300049590 Bacteria 1703
518 Ga0501074_0287277 3300049590 Bacteria 1169
519 Ga0501075_0000445 3300049591 Bacteria 24506
520 Ga0501075_0004010 3300049591 Bacteria 9929
521 Ga0501075_0075738 3300049591 Bacteria 2544
522 Ga0501075_0310516 3300049591 Bacteria 1201
523 Ga0501075_1240801 3300049591 Bacteria 565
524 Ga0501076_0000349 3300049592 Bacteria 28511
525 Ga0501076_0003103 3300049592 Bacteria 11568
526 Ga0501076_0012781 3300049592 Bacteria 6286
527 Ga0501076_0024337 3300049592 Bacteria 4679
528 Ga0501076_0026194 3300049592 Bacteria 4513
529 Ga0501076_0253829 3300049592 Bacteria 1439
530 Ga0501076_0711314 3300049592 Bacteria 829
531 Ga0501077_0000802 3300049593 Bacteria 19026
532 Ga0501077_0003685 3300049593 Bacteria 9222
533 Ga0501077_0016860 3300049593 Bacteria 4607
534 Ga0501077_0024724 3300049593 Bacteria 3813
535 Ga0501077_0172257 3300049593 Bacteria 1375
536 Ga0501079_0000646 3300049741 Bacteria 23202
537 Ga0501079_0003446 3300049741 Bacteria 11622
538 Ga0501079_0050586 3300049741 Bacteria 3208
539 Ga0501079_0082892 3300049741 Bacteria 2480
540 Ga0501080_0001159 3300049742 Bacteria 21759
541 Ga0501080_0165038 3300049742 Bacteria 2044
542 Ga0501080_0169613 3300049742 Bacteria 2013
543 Ga0501080_0443687 3300049742 Bacteria 1164
544 Ga0501080_0543202 3300049742 Bacteria 1035
545 Ga0501081_0000511 3300049743 Bacteria 21798
546 Ga0501081_0033606 3300049743 Bacteria 3485
547 Ga0501081_0034735 3300049743 Bacteria 3431
548 Ga0501081_0048188 3300049743 Bacteria 2932
549 Ga0501081_0427379 3300049743 Bacteria 982
550 Ga0501081_0788179 3300049743 Bacteria 715
551 Ga0501083_0008506 3300049744 Bacteria 7247
552 Ga0501083_0029847 3300049744 Bacteria 3747
553 Ga0501083_0090576 3300049744 Bacteria 2020
554 Ga0501083_0462688 3300049744 Bacteria 825
555 Ga0501035_0000561 3300049822 Bacteria 41148
556 Ga0501035_0037226 3300049822 Bacteria 4407
557 Ga0501035_0119000 3300049822 Bacteria 2310
558 Ga0501035_0151034 3300049822 Bacteria 2016
559 Ga0501035_1100086 3300049822 Bacteria 621
560 Ga0501044_0016801 3300049823 Bacteria 7854
561 Ga0501044_0563203 3300049823 Bacteria 1035
562 Ga0501044_0787609 3300049823 Bacteria 831
563 Ga0501045_0000699 3300049824 Bacteria 21322
564 Ga0501045_0007364 3300049824 Bacteria 7653
565 Ga0501045_0009092 3300049824 Bacteria 6941
566 Ga0501045_0048868 3300049824 Bacteria 3083
567 Ga0501045_0142310 3300049824 Bacteria 1783
568 Ga0501045_0255212 3300049824 Bacteria 1305
569 nmdc:mga00v17_359179_c1 3300050491 Bacteria 947
570 nmdc:mga0yw44_19637_c1 3300050492 Bacteria 3731
571 nmdc:mga05p37_1349302_c1 3300050507 Bacteria 723
572 nmdc:mga05p37_370737_c1 3300050507 Bacteria 1680
573 nmdc:mga06r32_399164_c1 3300050510 Bacteria 1357
574 nmdc:mga08y16_135719_c1 3300050511 Bacteria 2557
575 nmdc:mga0n895_315739_c1 3300050512 Bacteria 1584
576 nmdc:mga0rr50_316527_c1 3300050513 Bacteria 1308
577 nmdc:mga08x19_21396_c1 3300050514 Bacteria 3992
578 nmdc:mga0a205_1413672_c1 3300050515 Bacteria 543
579 nmdc:mga0a205_549031_c1 3300050515 Bacteria 1011
580 Ga0501084_0000493 3300054114 Bacteria 30265
581 Ga0501084_0000557 3300054114 Bacteria 28483
582 Ga0501084_0004385 3300054114 Bacteria 11502
583 Ga0501084_0012868 3300054114 Bacteria 6931
584 Ga0501084_0023909 3300054114 Bacteria 5098
585 Ga0501084_0548665 3300054114 Bacteria 977
586 Ga0501084_1538739 3300054114 Bacteria 556
587 Ga0501082_0001850 3300060353 Bacteria 18632
588 Ga0501082_0010582 3300060353 Bacteria 7939
589 Ga0501082_0012669 3300060353 Bacteria 7247
590 Ga0501082_0016153 3300060353 Bacteria 6423
591 Ga0501082_0057103 3300060353 Bacteria 3363
592 Ga0501082_0786615 3300060353 Bacteria 832
593 Ga0530510_0000499 3300061734 Bacteria 24903
594 Ga0530510_0003118 3300061734 Bacteria 11378
595 Ga0530510_0007937 3300061734 Bacteria 7405
596 Ga0530510_0019491 3300061734 Bacteria 4815
597 Ga0530510_0045327 3300061734 Bacteria 3176
598 Ga0530510_0173300 3300061734 Bacteria 1598
599 Ga0530510_0666900 3300061734 Bacteria 792
600 Ga0530510_0747512 3300061734 Bacteria 746
601 Ga0070668_100851647
602 JGI24747J21853_1050799
603 Ga0070690_100011734
604 Ga0070666_11239544
605 Ga0070680_100029951
606 Ga0070682_100000862
607 Ga0068868_100238947
608 Ga0070660_100115812
609 Ga0070689_100026892
610 Ga0070691_10273436
611 Ga0070692_10001906
612 Ga0070692_11070631
613 Ga0070668_100082941
614 Ga0070675_100363073
615 Ga0070675_101222459
616 Ga0070671_100024615
617 Ga0070671_100442805
618 Ga0070674_100001418
619 Ga0070674_100616216
620 Ga0070674_101453694
621 Ga0070688_100044181
622 Ga0070688_101703133
623 Ga0070659_100055694
624 Ga0070709_10197269
625 Ga0070709_11224669
626 Ga0070714_100026735
627 Ga0070714_100141691
628 Ga0070714_100474129
629 Ga0070714_100667579
630 Ga0070713_100032491
631 Ga0070713_100045693
632 Ga0070713_100434592
633 Ga0070710_10003622
634 Ga0070710_10603688
635 Ga0070710_10614270
636 Ga0070711_100001093
637 Ga0070711_100717182
638 Ga0070705_100017362
639 Ga0070700_100002883
640 Ga0070700_100068794
641 Ga0070700_101349477
642 Ga0070694_100109808
643 Ga0070708_100173959
644 Ga0070708_100589053
645 Ga0070663_100395802
646 Ga0070678_100002601
647 Ga0070678_101471906
648 Ga0070662_100185977
649 Ga0070681_11717511
650 Ga0068867_100001036
651 Ga0070685_10131603
652 Ga0070706_100020344
653 Ga0070706_100041712
654 Ga0070706_100052262
655 Ga0070706_100376447
656 Ga0070706_100662290
657 Ga0070707_100028859
658 Ga0070707_100128398
659 Ga0070707_100136353
660 Ga0070707_100151687
661 Ga0070707_100377072
662 Ga0070698_100009783
663 Ga0070698_100016241
664 Ga0070698_100602273
665 Ga0070698_100667941
666 Ga0070698_100967962
667 Ga0070698_101071380
668 Ga0070699_100007608
669 Ga0070699_100165916
670 Ga0070699_100171157
671 Ga0070699_101181535
672 Ga0070699_101586312
673 Ga0070699_101672761
674 Ga0070679_102012006
675 Ga0070697_100267573
676 Ga0070697_100572120
677 Ga0068853_100021208
678 Ga0070672_100008274
679 Ga0070672_100607667
680 Ga0070686_100007337
681 Ga0070686_101483662
682 Ga0070695_100648011
683 Ga0070696_100075490
684 Ga0070696_100347638
685 Ga0070693_100271684
686 Ga0070693_100276688
687 Ga0070704_100001173
688 Ga0068855_100302569
689 Ga0068857_101983431
690 Ga0068854_100056087
691 Ga0068854_102248188
692 Ga0068856_100007480
693 Ga0068856_100182679
694 Ga0070702_100001715
695 Ga0070702_100237353
696 Ga0068852_100279492
697 Ga0068864_100359976
698 Ga0068866_10000431
699 Ga0068861_100950801
700 Ga0068863_100359612
701 Ga0068858_100629214
702 Ga0068858_101050151
703 Ga0068860_100098060
704 Ga0068862_100195343
705 Ga0068862_101135312
706 Ga0081455_10095407
707 Ga0081538_10000017
708 Ga0081538_10000129
709 Ga0081538_10000340
710 Ga0081538_10015202
711 Ga0081538_10246635
712 Ga0070717_10001105
713 Ga0075365_10103857
714 Ga0075364_10422382
715 Ga0075432_10063124
716 Ga0070715_10024810
717 Ga0070716_100188491
718 Ga0070712_100018173
719 Ga0070712_100041697
720 Ga0070712_100121605
721 Ga0097621_100502029
722 Ga0068871_100001063
723 Ga0068871_101350948
724 Ga0075428_100030573
725 Ga0075431_100108149
726 Ga0075431_100434189
727 Ga0075433_10119997
728 Ga0075434_100083322
729 Ga0075434_100094778
730 Ga0068865_100002648
731 Ga0068865_100203489
732 Ga0075436_101046190
733 Ga0075435_100138920
734 Ga0075435_100162446
735 Ga0111539_10027013
736 Ga0111539_12790607
737 Ga0105245_10053548
738 Ga0105245_11199081
739 Ga0105245_11211452
740 Ga0114129_10801950
741 Ga0114129_11149768
742 Ga0105243_10294610
743 Ga0105243_10522426
744 Ga0105241_10258144
745 Ga0105242_10040431
746 Ga0105242_10962141
747 Ga0105242_11210432
748 Ga0105248_10005578
749 Ga0105237_10049175
750 Ga0105249_10001961
751 Ga0105239_10011363
752 Ga0105239_11856095
753 Ga0105246_10046708
754 Ga0157341_1028006
755 Ga0157371_10174187
756 Ga0157369_10418031
757 Ga0157369_11956581
758 Ga0157374_10333490
759 Ga0157378_10003883
760 Ga0163162_10012286
761 Ga0163162_10330431
762 Ga0157372_13278926
763 Ga0157375_10009351
764 Ga0157380_10841148
765 Ga0182008_10392569
766 Ga0182008_10457089
767 Ga0157377_10086268
768 Ga0157377_11075956
769 Ga0157376_10003613
770 Ga0163161_10041797
771 Ga0163161_10335535
772 Ga0163161_11345963
773 Ga0207653_10058776
774 Ga0207692_10209123
775 Ga0207692_11184657
776 Ga0207688_10119009
777 Ga0207680_10475706
778 Ga0207685_10019008
779 Ga0207699_10209019
780 Ga0207684_10024864
781 Ga0207684_10037031
782 Ga0207684_11188919
783 Ga0207654_10670993
784 Ga0207707_10883614
785 Ga0207693_10007333
786 Ga0207663_10089328
787 Ga0207663_10156617
788 Ga0207660_10207189
789 Ga0207660_10553913
790 Ga0207662_10007150
791 Ga0207662_10327997
792 Ga0207657_10011671
793 Ga0207649_11077786
794 Ga0207646_10013663
795 Ga0207646_10110151
796 Ga0207646_10148584
797 Ga0207681_11571819
798 Ga0207681_11745330
799 Ga0207659_10009602
800 Ga0207659_10470998
801 Ga0207659_10798336
802 Ga0207687_11460709
803 Ga0207700_10027179
804 Ga0207700_10470870
805 Ga0207700_10676990
806 Ga0207664_10067225
807 Ga0207664_10463605
808 Ga0207644_10121994
809 Ga0207690_10035262
810 Ga0207706_10171638
811 Ga0207686_10011112
812 Ga0207686_10911905
813 Ga0207709_10043947
814 Ga0207669_10017087
815 Ga0207669_10454245
816 Ga0207704_10009364
817 Ga0207704_10148680
818 Ga0207665_10799041
819 Ga0207711_10052591
820 Ga0207689_11141765
821 Ga0207667_12244696
822 Ga0207651_10148772
823 Ga0207712_10003902
824 Ga0207668_10154418
825 Ga0207668_10983507
826 Ga0207677_11520246
827 Ga0207677_11574455
828 Ga0207677_11698230
829 Ga0207703_10510034
830 Ga0207639_10035938
831 Ga0207678_10006862
832 Ga0207708_10000220
833 Ga0207708_11249705
834 Ga0207702_10073419
835 Ga0207648_10002129
836 Ga0207648_10627678
837 Ga0207648_11602238
838 Ga0207674_11887230
839 Ga0207675_100013476
840 Ga0207675_100504209
841 Ga0207683_10006814
842 Ga0207698_10097467
843 Ga0209998_10162709
844 Ga0207428_10052443
845 Ga0268265_11033563
846 Ga0268265_11108974
847 Ga0268264_10285982
848 Ga0307416_101202337
849 Ga0373944_0308845
850 Ga0373927_0691328
851 Ga0373947_0212188
852 Ga0395899_0034507
853 Ga0395899_0141210
854 Ga0395899_0538262
855 Ga0395899_0625091
856 Ga0395900_0001291
857 Ga0395900_0001589
858 Ga0395900_0001855
859 Ga0395900_0004208
860 Ga0395900_0045211
861 Ga0395900_0296827
862 Ga0395900_0579037
863 Ga0395898_0001958
864 Ga0395898_0007590
865 Ga0395898_0015020
866 Ga0395898_0023647
867 Ga0395898_0025561
868 Ga0395898_0065368
869 Ga0395898_0323521
870 Ga0395898_0622530
871 Ga0395898_1118762
872 Ga0395905_0003055
873 Ga0395905_0003743
874 Ga0395905_0004895
875 Ga0395905_0044514
876 Ga0395905_0092119
877 Ga0395905_0288321
878 Ga0395905_0344019
879 Ga0395905_0411151
880 Ga0395905_1363767
881 Ga0395901_0000365
882 Ga0395901_0000733
883 Ga0395901_0002616
884 Ga0395901_0036901
885 Ga0395901_0046325
886 Ga0395901_0210136
887 Ga0395901_0626742
888 Ga0395901_0669303
889 Ga0395901_0792486
890 Ga0395901_1775860
891 Ga0451789_0343320
892 Ga0451800_0468593
893 Ga0451802_2128326
894 Ga0451806_551924
895 Ga0451804_0641610
896 Ga0451807_1894418
897 Ga0451833_0310772
898 Ga0451835_1167386
899 Ga0451839_0139508
900 Ga0451847_0939586
901 Ga0451849_0744416
902 Ga0451851_0243833
903 Ga0451843_1230422
904 Ga0451855_1029199
905 Ga0439442_100688
906 Ga0439460_0099018
907 Ga0439440_0231774
908 Ga0466964_0002357
909 Ga0466968_0064940
910 Ga0466968_0116108
911 Ga0466960_0006206
912 Ga0466960_0145300
913 Ga0466960_0283620
914 Ga0466967_0018556
915 Ga0466967_0035681
916 Ga0466967_1099206
917 Ga0495603_0098413
918 Ga0495641_0013782
919 Ga0495641_0049170
920 Ga0495582_0044879
921 Ga0495582_0171704
922 Ga0495605_0089042
923 Ga0495605_0091497
924 Ga0495605_0367849
925 Ga0495662_0045317
926 Ga0495584_0030721
927 Ga0495584_0167420
928 Ga0495585_0394420
929 Ga0495594_0090072
930 Ga0495596_0149353
931 Ga0495630_0208475
932 Ga0495631_0339772
933 Ga0495631_0484591
934 Ga0495644_0459185
935 Ga0495663_0013322
936 Ga0495666_0036900
937 Ga0495642_0023739
938 Ga0495642_0209772
939 Ga0495642_0215266
940 Ga0495665_0038856
941 Ga0495656_0019998
942 Ga0495656_0091084
943 Ga0495656_0333254
944 Ga0495659_0121508
945 Ga0495588_0047276
946 Ga0495588_0716027
947 Ga0495647_0018763
948 Ga0495647_0111437
949 Ga0495658_0377981
950 Ga0495624_0000007
951 Ga0495624_0206842
952 Ga0495589_0083056
953 Ga0495581_0014131
954 Ga0495581_0141492
955 Ga0495636_0079672
956 Ga0495676_0088363
957 Ga0495677_0013266
958 Ga0495677_0036171
959 Ga0495677_0211274
960 Ga0495679_186417
961 Ga0495685_097288
962 Ga0495593_0347134
963 Ga0495614_0394383
964 Ga0495615_0327374
965 Ga0496100_0185670
966 Ga0496100_0302907
967 Ga0496101_0424110
968 Ga0496101_0576627
969 Ga0496102_0007816
970 Ga0496102_0046481
971 Ga0496102_0231480
972 Ga0496103_0005078
973 Ga0496103_0056321
974 Ga0496104_0028130
975 Ga0496104_0326038
976 Ga0496104_0766326
977 Ga0496105_0010350
978 Ga0496105_0010526
979 Ga0496106_0030291
980 Ga0496106_0236630
981 Ga0496107_0042792
982 Ga0496107_0106785
983 Ga0496107_0300855
984 Ga0496107_1169236
985 Ga0496108_0006656
986 Ga0496108_0526689
987 Ga0496108_1556921
988 Ga0496109_0006589
989 Ga0496109_0208060
990 Ga0496109_0251655
991 Ga0496110_0018203
992 Ga0496110_0207575
993 Ga0496111_0026838
994 Ga0496111_0083664
995 Ga0496111_0378218
996 Ga0496111_0891841
997 Ga0496112_0176337
998 Ga0496112_1029900
999 Ga0496113_0070893
1000 Ga0496113_0518290
1001 Ga0496114_0000589
1002 Ga0496114_0030233
1003 Ga0496114_0097562
1004 Ga0496115_0025386
1005 Ga0496115_0119730
1006 Ga0501031_0000532
1007 Ga0501031_0018146
1008 Ga0501031_0054370
1009 Ga0501031_0142823
1010 Ga0501031_0660995
1011 Ga0501031_0827272
1012 Ga0501031_1058413
1013 Ga0501032_0000714
1014 Ga0501032_0282067
1015 Ga0501032_0301647
1016 Ga0501032_0469772
1017 Ga0501033_0000987
1018 Ga0501033_0020846
1019 Ga0501033_0287281
1020 Ga0501033_0648709
1021 Ga0501033_0760920
1022 Ga0501034_0009386
1023 Ga0501036_0000681
1024 Ga0501036_0002396
1025 Ga0501036_0115333
1026 Ga0501036_0440690
1027 Ga0501036_1406692
1028 Ga0501037_0001001
1029 Ga0501037_0203177
1030 Ga0501037_0364436
1031 Ga0501037_1059183
1032 Ga0501038_0001029
1033 Ga0501038_0011566
1034 Ga0501038_0302666
1035 Ga0501038_0305551
1036 Ga0501038_1312311
1037 Ga0501039_0003396
1038 Ga0501039_0010203
1039 Ga0501039_0023512
1040 Ga0501039_0088909
1041 Ga0501039_0099232
1042 Ga0501039_1305374
1043 Ga0501040_0000515
1044 Ga0501040_0007111
1045 Ga0501040_0025467
1046 Ga0501040_0103003
1047 Ga0501040_0272928
1048 Ga0501040_0991066
1049 Ga0501041_0003328
1050 Ga0501041_0004471
1051 Ga0501041_0061939
1052 Ga0501041_0231464
1053 Ga0501041_0463625
1054 Ga0501042_0001023
1055 Ga0501042_0001268
1056 Ga0501042_0051392
1057 Ga0501042_0109961
1058 Ga0501042_0125837
1059 Ga0501042_0360049
1060 Ga0501042_1272689
1061 Ga0501043_0000750
1062 Ga0501043_0067804
1063 Ga0501043_0106275
1064 Ga0501043_0317298
1065 Ga0501043_1248856
1066 Ga0501046_0000475
1067 Ga0501046_0027390
1068 Ga0501046_0029178
1069 Ga0501046_0084983
1070 Ga0501046_0153944
1071 Ga0501046_0897144
1072 Ga0501047_0001366
1073 Ga0501047_0028856
1074 Ga0501047_0187816
1075 Ga0501047_0346948
1076 Ga0501048_0000881
1077 Ga0501048_0009725
1078 Ga0501048_0018476
1079 Ga0501048_0085857
1080 Ga0501048_0405582
1081 Ga0501067_0000531
1082 Ga0501068_0000481
1083 Ga0501068_0266837
1084 Ga0501068_0485604
1085 Ga0501068_0500110
1086 Ga0501068_0817310
1087 Ga0501069_0003511
1088 Ga0501069_0114827
1089 Ga0501069_0284628
1090 Ga0501069_0323109
1091 Ga0501069_0363001
1092 Ga0501069_0728160
1093 Ga0501070_0004094
1094 Ga0501070_0093981
1095 Ga0501070_0549599
1096 Ga0501070_0724665
1097 Ga0501070_1055739
1098 Ga0501070_1320868
1099 Ga0501071_0005459
1100 Ga0501071_0007333
1101 Ga0501071_0021049
1102 Ga0501071_0115683
1103 Ga0501071_0544339
1104 Ga0501071_1234482
1105 Ga0501072_0000365
1106 Ga0501072_0000894
1107 Ga0501072_0009778
1108 Ga0501072_0058225
1109 Ga0501072_0446941
1110 Ga0501072_0737617
1111 Ga0501072_1449424
1112 Ga0501073_0002069
1113 Ga0501073_0030631
1114 Ga0501073_0201156
1115 Ga0501073_0445171
1116 Ga0501074_0000505
1117 Ga0501074_0144163
1118 Ga0501074_0287277
1119 Ga0501075_0000445
1120 Ga0501075_0004010
1121 Ga0501075_0075738
1122 Ga0501075_0310516
1123 Ga0501075_1240801
1124 Ga0501076_0000349
1125 Ga0501076_0003103
1126 Ga0501076_0012781
1127 Ga0501076_0024337
1128 Ga0501076_0026194
1129 Ga0501076_0253829
1130 Ga0501076_0711314
1131 Ga0501077_0000802
1132 Ga0501077_0003685
1133 Ga0501077_0016860
1134 Ga0501077_0024724
1135 Ga0501077_0172257
1136 Ga0501079_0000646
1137 Ga0501079_0003446
1138 Ga0501079_0050586
1139 Ga0501079_0082892
1140 Ga0501080_0001159
1141 Ga0501080_0165038
1142 Ga0501080_0169613
1143 Ga0501080_0443687
1144 Ga0501080_0543202
1145 Ga0501081_0000511
1146 Ga0501081_0033606
1147 Ga0501081_0034735
1148 Ga0501081_0048188
1149 Ga0501081_0427379
1150 Ga0501081_0788179
1151 Ga0501083_0008506
1152 Ga0501083_0029847
1153 Ga0501083_0090576
1154 Ga0501083_0462688
1155 Ga0501035_0000561
1156 Ga0501035_0037226
1157 Ga0501035_0119000
1158 Ga0501035_0151034
1159 Ga0501035_1100086
1160 Ga0501044_0016801
1161 Ga0501044_0563203
1162 Ga0501044_0787609
1163 Ga0501045_0000699
1164 Ga0501045_0007364
1165 Ga0501045_0009092
1166 Ga0501045_0048868
1167 Ga0501045_0142310
1168 Ga0501045_0255212
1169 nmdc:mga00v17_359179_c1
1170 nmdc:mga0yw44_19637_c1
1171 nmdc:mga05p37_1349302_c1
1172 nmdc:mga05p37_370737_c1
1173 nmdc:mga06r32_399164_c1
1174 nmdc:mga08y16_135719_c1
1175 nmdc:mga0n895_315739_c1
1176 nmdc:mga0rr50_316527_c1
1177 nmdc:mga08x19_21396_c1
1178 nmdc:mga0a205_1413672_c1
1179 nmdc:mga0a205_549031_c1
1180 Ga0501084_0000493
1181 Ga0501084_0000557
1182 Ga0501084_0004385
1183 Ga0501084_0012868
1184 Ga0501084_0023909
1185 Ga0501084_0548665
1186 Ga0501084_1538739
1187 Ga0501082_0001850
1188 Ga0501082_0010582
1189 Ga0501082_0012669
1190 Ga0501082_0016153
1191 Ga0501082_0057103
1192 Ga0501082_0786615
1193 Ga0530510_0000499
1194 Ga0530510_0003118
1195 Ga0530510_0007937
1196 Ga0530510_0019491
1197 Ga0530510_0045327
1198 Ga0530510_0173300
1199 Ga0530510_0666900
1200 Ga0530510_0747512

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF10041

DUF2277

Uncharacterized conserved protein (DUF2277)

7

84

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
8j7a-assembly1.cif.gz_K coordinates of cryo-em structure of the arabidopsis thaliana psi in state 1 (psi-st1) 0.6859 15 63
8j7a-assembly1.cif.gz_K coordinates of cryo-em structure of the arabidopsis thaliana psi in state 1 (psi-st1) 0.611 15 63
8glv-assembly1.cif.gz_AR 96-nm repeat unit of doublet microtubules from chlamydomonas reinhardtii flagella 0.5905 5 61
2gsc-assembly1.cif.gz_D crystal structure of the conserved hypothetical cytosolic protein xcc0516 from xanthomonas campestris 0.5548 18 64
5knl-assembly1.cif.gz_A crystal structure of s. pombe ubiquitin e1 (uba1) in complex with ubc15 and ubiquitin 0.5517 17 57
ID Description Score Start End Superfamily
af_A0A0R0KYZ5_112_200_1.10.287.110 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;DnaJ domain 0.6091 15 62 1.10.287.110
2c0kA00 Mainly Alpha;Orthogonal Bundle;Globin-like;Globins 0.5819 12 63 1.10.490.10
af_Q9TY07_4_118_1.10.287.110 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;DnaJ domain 0.5768 15 62 1.10.287.110
2nrlA00 Mainly Alpha;Orthogonal Bundle;Globin-like;Globins 0.5655 15 58 1.10.490.10
af_Q59VY8_255_427_1.20.1440.340 Mainly Alpha;Up-down Bundle;de novo design (two linked rop proteins); 0.5644 17 63 1.20.1440.340
ID Description Score Start End GO Terms
AF-A0A536ASV9-F1-model_v4 DUF2277 domain-containing protein 0.9961 15 61
AF-A0A1C4TVR7-F1-model_v4 DUF2277 domain-containing protein 0.9824 7 80
AF-A0A8A3K567-F1-model_v4 deleted 0.9748 8 80
AF-A0A1Q7ASV3-F1-model_v4 DUF2277 domain-containing protein 0.97 14 67
AF-A0A561UPG7-F1-model_v4 Uncharacterized protein DUF2277 0.9699 15 67

Map