F467940

General Info

Members Datasets Scaffolds Average Seq Length
600 389 424 261

Family's Representative Sequence

Representative Sequence 3300005289|Ga0065704_10160409|Ga0065704_101604092
Length 298
Sequence MTSGLTPNTAFHPVWPIKRRVFALNPYHCSRVRDKPMNNRPTVLITGASTGIGAVYAERFAQRGHDLVLVARDHVRLQTLATKLRSEHSVAIDVLQADLTQLSDLVKVEARLRDDASIGILVNNAGAAQSGTFIEQSTDSVAHLVALNTTALVRLASAVAPRLAKAGNGAIINIGSVVGLAPELGMSVYGATKAFVLFLSQGLSLELSPQGVYVQAVLPAATRTEIWDRAGIDINTLNEIMEVGDLVDAALVGFDRREPVTIPPLQEAERWDVLQTARQGLLSQLKQSVVAQRYQTKA

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2501025501 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
3 2501025504 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
4 2508501127 Mesorhizobium sp. WSM2561 Isolate Nodule
5 2510461069 Rhizobium sp. PDO1-076 Isolate Rhizosphere
6 2510917014 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
7 2510917015 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
8 2511231004 Pseudomonas sp. GM102 Isolate Nodule
9 2511231010 Pseudomonas sp. GM25 Isolate Nodule
10 2511231016 Pseudomonas sp. GM50 Isolate Nodule
11 2511231018 Pseudomonas sp. GM60 Isolate Nodule
12 2511231022 Pseudomonas sp. GM79 Isolate Nodule
13 2511231023 Pseudomonas sp. GM80 Isolate Nodule
14 2511231156 Pseudomonas ogarae F113 Isolate Rhizosphere
15 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
16 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
17 2554235341 Pseudomonas protegens CHA0 Isolate Rhizosphere
18 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
19 2597489887 Pseudomonas chlororaphis aureofaciens 30-84 Isolate Rhizosphere
20 2597489888 Pseudomonas fluorescens SS101 Isolate Rhizosphere
21 2597489889 Pseudomonas synxantha BG33R Isolate Rhizosphere
22 2599185160 Pseudomonas sp. NFPP25 Isolate Rhizoplane
23 2599185164 Pseudomonas sp. NFPP13 Isolate Rhizoplane
24 2599185165 Pseudomonas sp. NFPP18 Isolate Rhizoplane
25 2599185181 Pseudomonas sp. NFPP17 Isolate Rhizoplane
26 2599185185 Pseudomonas sp. NFPP07 Isolate Rhizoplane
27 2599185186 Pseudomonas sp. NFPP15 Isolate Rhizoplane
28 2599185188 Pseudomonas sp. NFACC45 Isolate Rhizoplane
29 2599185189 Pseudomonas sp. NFPP02 Isolate Rhizoplane
30 2599185212 Pseudomonas sp. NFACC15-1 Isolate Rhizoplane
31 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
32 2599185248 Pseudomonas sp. NFACC08-1 Isolate Rhizoplane
33 2599185257 Pseudomonas sp. NFACC41-3 Isolate Rhizoplane
34 2599185288 Pseudomonas sp. NFACC25 Isolate Rhizoplane
35 2599185289 Pseudomonas sp. NFACC51 Isolate Rhizoplane
36 2599185291 Pseudomonas sp. NFACC48-1 Isolate Rhizoplane
37 2599185300 Pseudomonas sp. NFACC39-1 Isolate Rhizoplane
38 2599185303 Pseudomonas sp. NFACC42-2 Isolate Rhizoplane
39 2599185305 Pseudomonas sp. NFACC07-1 Isolate Rhizoplane
40 2599185306 Pseudomonas sp. NFACC16-2 Isolate Rhizoplane
41 2599185308 Pseudomonas sp. NFACC17-2 Isolate Rhizoplane
42 2599185311 Pseudomonas sp. NFACC04-2 Isolate Rhizoplane
43 2599185313 Pseudomonas sp. NFACC05-1 Isolate Rhizoplane
44 2599185314 Pseudomonas sp. NFACC23-1 Isolate Rhizoplane
45 2599185315 Pseudomonas sp. NFACC44-2 Isolate Rhizoplane
46 2599185316 Pseudomonas sp. NFACC52 Isolate Rhizoplane
47 2599185317 Pseudomonas sp. NFACC06-1 Isolate Rhizoplane
48 2599185318 Pseudomonas sp. NFACC13-1 Isolate Rhizoplane
49 2599185319 Pseudomonas sp. NFACC24-1 Isolate Rhizoplane
50 2599185321 Pseudomonas sp. NFACC54 Isolate Rhizoplane
51 2599185322 Pseudomonas sp. NFACC14 Isolate Rhizoplane
52 2599185323 Pseudomonas sp. NFACC37-1 Isolate Rhizoplane
53 2599185324 Pseudomonas sp. NFACC46-3 Isolate Rhizoplane
54 2599185325 Pseudomonas sp. NFACC56-3 Isolate Rhizoplane
55 2599185356 Pseudomonas sp. NFPP14 Isolate Rhizoplane
56 2600254930 Pseudomonas sp. NFIX10 Isolate Rhizoplane
57 2600255296 Pseudomonas sp. NFR02 Isolate Rhizoplane
58 2600255313 Pseudomonas sp. NFPP16 Isolate Rhizoplane
59 2600255318 Pseudomonas putida NFIX47 Isolate Rhizoplane
60 2603880185 Pseudomonas sp. NFIX46 Isolate Rhizoplane
61 2603880199 Pseudomonas sp. NFIX49 Isolate Rhizoplane
62 2619619299 Pseudomonas veronii R4 Genome sequencing Isolate Unclassified
63 2623620443 Pseudomonas sp. DR 5-09 Isolate Unclassified
64 2623620446 Pseudomonas sp. GR 6-02 Isolate Unclassified
65 2643221571 Pseudomonas sp. Root569 Isolate Unclassified
66 2643221610 Ensifer sp. Root74 Isolate Unclassified
67 2643221650 Pseudomonas sp. Root401 Isolate Unclassified
68 2643221675 Ensifer sp. Root1298 Isolate Unclassified
69 2643221680 Ensifer sp. Root1312 Isolate Unclassified
70 2643221713 Pseudomonas sp. Root9 Isolate Unclassified
71 2643221726 Ensifer sp. Root954 Isolate Unclassified
72 2667528170 Pseudomonas sp. NFACC50-1 Isolate Rhizoplane
73 2667528176 Pseudomonas sp. NFACC11-2 Isolate Rhizoplane
74 2671180172 Pseudomonas sp. NFIX51 Isolate Rhizoplane
75 2675903420 Pseudomonas fluorescens Ps006 Isolate Unclassified
76 2675903515 Pseudomonas thivervalensis DSM 13194 Isolate Unclassified
77 2713897148 Pseudomonas fluorescens SF39a Isolate Rhizosphere
78 2713897149 Pseudomonas fluorescens SF4c Isolate Rhizosphere
79 2721755607 Pseudomonas fluorescens Pt14 Isolate Rhizosphere
80 2738541265 Pseudomonas sp. GV077 Isolate Unclassified
81 2738541282 Pseudomonas sp. GV058 Isolate Unclassified
82 2738541294 Pseudomonas sp. GV087 Isolate Unclassified
83 2738541303 Pseudomonas sp. GV105 Isolate Unclassified
84 2738541309 Pseudomonas sp. GV047 Isolate Unclassified
85 2738543015 Pseudomonas sp. GV041 Isolate Unclassified
86 2738543025 Pseudomonas sp. GV091 Isolate Unclassified
87 2738543031 Pleomorphomonas sp. CF100 Isolate Unclassified
88 2744054620 Pseudomonas thivervalensis LMG 21626 Isolate Unclassified
89 2758568016 [Ochrobactrum] quorumnocens A44 Isolate Rhizosphere
90 2773857673 Pseudomonas sp. 443 Isolate Unclassified
91 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
92 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
93 2784132063 Pseudomonas sp. 424 Isolate Unclassified
94 2791355520 Pseudomonas sp. s211(2017) Isolate Unclassified
95 2808606385 Pseudomonas sp. SJZ103 Isolate Rhizosphere
96 2808606388 Pseudomonas sp. SJZ094 Isolate Rhizosphere
97 2816332298 Pseudomonas veronii R02 Isolate Rhizosphere
98 2818991467 Bosea vestrisii 3192 Isolate Unclassified
99 2825651385 Pseudomonas brassicacearum L13-6-12 Isolate Rhizosphere
100 2834028612 Pseudomonas fluorescens 513 Isolate Unclassified
101 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
102 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
103 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
104 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
105 2842826826 Pseudomonas sp. R-72172 Isolate Unclassified
106 2842832357 Pseudomonas sp. R-72164 Isolate Unclassified
107 2842837860 Pseudomonas sp. R-72102 Isolate Unclassified
108 2842843487 Pseudomonas sp. R-72074 Isolate Unclassified
109 2842854478 Pseudomonas sp. R-71998 Isolate Unclassified
110 2844665904 Pseudomonas protegens H1F10C Isolate Unclassified
111 2852612431 Pseudomonas sp. SJZ073 Isolate Rhizosphere
112 2852657418 Pseudomonas sp. JAI115 Isolate Rhizosphere
113 2852667396 Pseudomonas sp. JAI120 Isolate Rhizosphere
114 2860339153 Pseudomonas sp. JAI111 Isolate Rhizosphere
115 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
116 2878029506 Pseudomonas fluorescens DR397 Isolate Rhizosphere
117 2878788777 Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 Isolate Nodule
118 2880230671 Pseudomonas fluorescens LBUM677 Isolate Unclassified
119 2889306138 Methylobacterium sp. PvR107 Isolate Rhizosphere
120 2904483920 Paraburkholderia caledonica 575 Isolate Unclassified
121 2904518522 Pseudomonas fluorescens 4488 Isolate Rhizosphere
122 2913036834 Pseudomonas viciae 11K1 Isolate Rhizosphere
123 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
124 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
125 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
126 2917070673 Pseudomonas protegens CHA0 Isolate Rhizosphere
127 2919063839 Pseudomonas pharyngis 1098 Isolate Rhizosphere
128 2919385768 Pseudomonas sp. 2957 Isolate Unclassified
129 2919487758 Pseudomonas koreensis 3441 Isolate Unclassified
130 2919527303 Paraburkholderia strydomiana 3827 Isolate Unclassified
131 2919697872 Pseudomonas frederiksbergensis 4169 Isolate Unclassified
132 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
133 2923586266 Pseudomonas fluorescens 1550 Isolate Rhizosphere
134 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
135 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
136 2929144301 Pseudomonas sp. R-71838 Hybrid assembly Isolate Unclassified
137 2931369376 Pseudomonas fluorescens DR133 Isolate Rhizosphere
138 2931396565 Pseudomonas sp. DR48 Isolate Rhizosphere
139 2935353572 Pseudomonas protegens TECH19 Isolate Unclassified
140 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
141 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
142 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
143 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
144 2946006987 Pseudomonas sp. W3I7 Isolate Rhizosphere
145 2946027586 Pseudomonas sp. W4I3 Isolate Rhizosphere
146 2947233263 Pseudomonas synxantha W2I4 Isolate Rhizosphere
147 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
148 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
149 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
150 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
151 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
152 2969304461 Pseudomonas sp. R84 Isolate Rhizosphere
153 2974289157 Pseudomonas fluorescens SORGH_AS 191 Isolate Unclassified
154 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
155 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
156 2998139840 Pseudomonas iranensis SWRI54 Isolate Rhizosphere
157 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
158 3007855910 Pseudomonas khorasanensis SWRI153 Isolate Rhizosphere
159 3007861166 Pseudomonas hamedanensis SWRI65 Isolate Rhizosphere
160 3007866637 Pseudomonas marvdashtae SWRI102 Isolate Rhizosphere
161 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
162 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
163 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
164 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
165 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
166 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
167 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
168 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
169 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
170 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
171 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
172 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
173 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
174 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
175 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
176 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
177 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
178 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
179 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
180 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
181 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
182 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
183 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
184 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
185 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
186 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
187 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
188 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
189 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
190 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
191 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
192 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
193 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
194 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
195 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
196 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
197 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
198 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
199 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
200 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
201 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
202 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
203 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
204 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
205 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
206 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
207 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
208 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
209 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
210 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
211 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
212 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
213 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
214 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
215 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
216 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
217 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
218 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
219 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
220 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
221 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
222 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
223 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
224 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
225 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
226 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
227 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
228 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
229 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
230 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
235 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
237 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
238 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
239 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
240 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
241 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
242 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
243 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
244 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
245 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
246 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
247 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
248 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
249 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
250 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
251 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
252 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
253 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
254 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
255 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
256 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
257 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
258 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
259 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
260 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
261 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
262 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
263 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
264 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
265 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
266 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
267 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
268 3300042124 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 Metagenome Rhizosphere
269 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
270 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
271 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
272 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
273 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
274 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
275 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
276 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
277 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
278 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
279 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
280 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
281 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
282 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
283 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
284 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
285 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
286 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
287 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
288 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
289 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
290 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
291 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
292 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
293 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
294 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
295 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
296 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
297 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
298 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
299 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
300 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
301 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
302 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
303 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
304 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
305 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
306 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
307 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
308 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
309 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
310 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
311 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
312 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
313 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
314 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
315 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
316 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
317 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
318 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
319 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
320 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
321 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
322 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
323 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
324 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
325 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
326 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
327 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
328 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
329 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
330 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
331 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
332 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
333 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
334 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
335 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
336 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
337 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
338 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
339 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
340 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
341 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
342 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
343 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
344 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
345 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
346 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
347 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
348 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
349 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
350 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
351 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
352 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
353 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
354 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
355 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
356 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
357 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
358 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
359 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
360 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
361 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
362 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
363 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
364 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
365 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
366 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
367 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
368 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
369 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
370 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
371 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
372 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
373 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
374 637000220 Pseudomonas protegens Pf-5 Isolate Rhizoplane
375 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
376 8001845381 Ancylobacter sonchi VKM B-3145 Isolate Unclassified
377 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
378 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
379 8019775933 Pseudomonas sp. PvR083 Isolate Rhizosphere
380 8029995093 Pseudomonas atacamensis SM1 Isolate Rhizosphere
381 8054285046 Pseudomonas petroselini MAFF 311096 Isolate Nodule
382 8054347763 Pseudomonas carnis NWU Be30 Isolate Unclassified
383 8055770955 Pseudomonas chlororaphis qlu-1 Isolate Rhizosphere
384 8056125926 Pseudomonas azerbaijanorientalis SWRI123 Isolate Rhizosphere
385 8056131705 Pseudomonas asgharzadehiana SWRI132 Isolate Rhizosphere
386 8056143049 Pseudomonas alvandae SWRI17 Isolate Rhizosphere
387 8056148874 Pseudomonas khavaziana SWRI124 Isolate Rhizosphere
388 8056166840 Pseudomonas triticicola SWRI88 Isolate Rhizosphere
389 8056569372 Pseudomonas serboccidentalis IT-P374 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 70.67
Metatranscriptomes 0
Isolates 29.33

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.17
Nodule 5.83
Rhizoplane 7.5
Rhizosphere 56.17
Stem 0
Stem Tuber 0
Unclassified 19.33

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1366508 2162886007 Bacteria 5332
2 JGI25162J39368_1000004 3300002737 Bacteria 441040
3 JGI25164J39214_1000026 3300002772 Bacteria 156863
4 JGI25165J46597_1000011 3300003214 Bacteria 441040
5 JGI25153J46596_10036842 3300003215 Bacteria 1562
6 Ga0055539_1000036 3300003752 Bacteria 216576
7 Ga0055533_1000046 3300003756 Bacteria 216576
8 Ga0055533_1000353 3300003756 Bacteria 19714
9 Ga0055532_1000032 3300003758 Bacteria 216568
10 Ga0055525_1000217 3300003759 Bacteria 62978
11 Ga0055525_1002000 3300003759 Bacteria 2512
12 Ga0055535_1005166 3300003761 Bacteria 2942
13 Ga0055524_1004630 3300003775 Bacteria 6312
14 Ga0055524_1008145 3300003775 Bacteria 4379
15 Ga0055536_1000013 3300003781 Bacteria 240693
16 Ga0055536_1000032 3300003781 Bacteria 150527
17 Ga0055536_1000277 3300003781 Bacteria 39159
18 Ga0055528_1000018 3300003790 Bacteria 155302
19 Ga0055530_10000004 3300003791 Bacteria 231465
20 Ga0055530_10000029 3300003791 Bacteria 127049
21 Ga0055530_10000062 3300003791 Bacteria 94942
22 Ga0055530_10000648 3300003791 Bacteria 29930
23 Ga0055540_1000008 3300003792 Bacteria 309635
24 Ga0055540_1000017 3300003792 Bacteria 231465
25 Ga0055540_1000166 3300003792 Bacteria 65613
26 Ga0055531_10000242 3300003794 Bacteria 59638
27 Ga0055541_1000024 3300003841 Bacteria 216576
28 Ga0065714_10002302 3300005288 Bacteria 45300
29 Ga0065714_10008929 3300005288 Bacteria 4155
30 Ga0065714_10072254 3300005288 Bacteria 3402
31 Ga0065714_10082726 3300005288 Bacteria 2290
32 Ga0065704_10038423 3300005289 Bacteria 1188
33 Ga0065704_10070262 3300005289 Bacteria 45316
34 Ga0065704_10111062 3300005289 Bacteria 1965
35 Ga0065704_10160409 3300005289 Bacteria 1347
36 Ga0070670_100000034 3300005331 Bacteria 158067
37 Ga0070670_100000381 3300005331 Bacteria 36865
38 Ga0070670_100002591 3300005331 Bacteria 14942
39 Ga0070668_100125963 3300005347 Bacteria 2052
40 Ga0070669_100000259 3300005353 Bacteria 43326
41 Ga0070667_100534870 3300005367 Bacteria 1076
42 Ga0070662_100002140 3300005457 Bacteria 12105
43 Ga0068853_100074172 3300005539 Bacteria 2968
44 Ga0068851_10007430 3300005834 Bacteria 5031
45 Ga0075364_10097464 3300006051 Bacteria 1956
46 Ga0075364_10230563 3300006051 Bacteria 1257
47 Ga0075432_10000821 3300006058 Bacteria 9721
48 Ga0075432_10005619 3300006058 Bacteria 4271
49 Ga0075369_10094846 3300006186 Bacteria 1334
50 Ga0105251_10000207 3300009011 Bacteria 59294
51 Ga0105251_10008072 3300009011 Bacteria 6377
52 Ga0105251_10011506 3300009011 Bacteria 5052
53 Ga0105244_10018340 3300009036 Bacteria 3928
54 Ga0105244_10034292 3300009036 Bacteria 2673
55 Ga0105244_10053034 3300009036 Bacteria 2062
56 Ga0105250_10000207 3300009092 Bacteria 49366
57 Ga0105250_10000353 3300009092 Bacteria 35144
58 Ga0105250_10001427 3300009092 Bacteria 12904
59 Ga0105250_10017372 3300009092 Bacteria 2926
60 Ga0105243_10000170 3300009148 Bacteria 74646
61 Ga0105243_10002467 3300009148 Bacteria 15446
62 Ga0105243_10080694 3300009148 Bacteria 2654
63 Ga0105248_10252084 3300009177 Bacteria 1987
64 Ga0105237_10208062 3300009545 Bacteria 1957
65 Ga0105249_10569842 3300009553 Bacteria 1185
66 Ga0157345_1000001 3300012498 Bacteria 152919
67 Ga0157373_10002166 3300013100 Bacteria 14871
68 Ga0157373_10015520 3300013100 Bacteria 5569
69 Ga0157373_10088366 3300013100 Bacteria 2183
70 Ga0157371_10002985 3300013102 Bacteria 15712
71 Ga0157371_10011312 3300013102 Bacteria 6887
72 Ga0157370_10056689 3300013104 Bacteria 3729
73 Ga0157369_10011709 3300013105 Bacteria 9958
74 Ga0157369_10206262 3300013105 Bacteria 2061
75 Ga0163162_10441039 3300013306 Bacteria 1434
76 Ga0157372_10000821 3300013307 Bacteria 33625
77 Ga0182008_10000429 3300014497 Bacteria 32349
78 Ga0182008_10004315 3300014497 Bacteria 8325
79 Ga0182008_10005140 3300014497 Bacteria 7507
80 Ga0182008_10007005 3300014497 Bacteria 6250
81 Ga0182006_1000677 3300015261 Bacteria 23894
82 Ga0182006_1001013 3300015261 Bacteria 18374
83 Ga0182006_1006763 3300015261 Bacteria 5296
84 Ga0182007_10000766 3300015262 Bacteria 18016
85 Ga0182007_10001255 3300015262 Bacteria 13789
86 Ga0182005_1002698 3300015265 Bacteria 6225
87 Ga0182005_1005588 3300015265 Bacteria 3916
88 Ga0163161_10011334 3300017792 Bacteria 6180
89 Ga0163161_10022604 3300017792 Bacteria 4429
90 Ga0163161_10030055 3300017792 Bacteria 3864
91 Ga0163161_10031082 3300017792 Bacteria 3803
92 Ga0209435_101329 3300025206 Bacteria 3210
93 Ga0209760_100105 3300025207 Bacteria 64565
94 Ga0209784_100017 3300025224 Bacteria 472003
95 Ga0209566_100014 3300025225 Bacteria 472003
96 Ga0209674_100028 3300025226 Bacteria 472003
97 Ga0209147_100038 3300025229 Bacteria 314497
98 Ga0209563_100032 3300025230 Bacteria 472003
99 Ga0207427_100003 3300025231 Bacteria 1035004
100 Ga0209437_100002 3300025233 Bacteria 1574801
101 Ga0209258_100197 3300025242 Bacteria 124028
102 Ga0209646_1000171 3300025246 Bacteria 84951
103 Ga0209677_100018 3300025253 Bacteria 472003
104 Ga0209759_1021150 3300025256 Bacteria 1490
105 Ga0209233_1000004 3300025261 Bacteria 1574798
106 Ga0209673_1000055 3300025273 Bacteria 272768
107 Ga0209675_1002987 3300025291 Bacteria 8330
108 Ga0209676_1000002 3300025292 Bacteria 1732948
109 Ga0209676_1000003 3300025292 Bacteria 1454178
110 Ga0209676_1000120 3300025292 Bacteria 200565
111 Ga0209676_1001065 3300025292 Bacteria 31352
112 Ga0209564_1025815 3300025295 Bacteria 1963
113 Ga0209564_1030508 3300025295 Bacteria 1669
114 Ga0209050_1000004 3300025298 Bacteria 1600040
115 Ga0209050_1000006 3300025298 Bacteria 1359702
116 Ga0209050_1000037 3300025298 Bacteria 415612
117 Ga0209256_1000147 3300025299 Bacteria 149002
118 Ga0209256_1000401 3300025299 Bacteria 68618
119 Ga0209051_1000001 3300025303 Bacteria 1732974
120 Ga0209051_1000040 3300025303 Bacteria 315055
121 Ga0209051_1000052 3300025303 Bacteria 283346
122 Ga0209257_1000029 3300025304 Bacteria 695617
123 Ga0209257_1006677 3300025304 Bacteria 7308
124 Ga0207656_10000034 3300025321 Bacteria 66750
125 Ga0207696_1000002 3300025711 Bacteria 1098043
126 Ga0207696_1000108 3300025711 Bacteria 157445
127 Ga0207696_1002028 3300025711 Bacteria 10253
128 Ga0207696_1003553 3300025711 Bacteria 7044
129 Ga0207696_1054692 3300025711 Bacteria 1134
130 Ga0207655_1000141 3300025728 Bacteria 138956
131 Ga0207655_1000520 3300025728 Bacteria 49037
132 Ga0207655_1002113 3300025728 Bacteria 16620
133 Ga0207655_1024127 3300025728 Bacteria 2990
134 Ga0207655_1097271 3300025728 Bacteria 1022
135 Ga0207713_1000122 3300025735 Bacteria 122196
136 Ga0207713_1001298 3300025735 Bacteria 20557
137 Ga0207713_1007845 3300025735 Bacteria 6224
138 Ga0207713_1008251 3300025735 Bacteria 6024
139 Ga0207681_10000215 3300025923 Bacteria 45747
140 Ga0207650_10000066 3300025925 Bacteria 140329
141 Ga0207650_10000272 3300025925 Bacteria 54462
142 Ga0207650_10003085 3300025925 Bacteria 11473
143 Ga0207706_10007035 3300025933 Bacteria 10402
144 Ga0207709_10000004 3300025935 Bacteria 825156
145 Ga0207709_10004673 3300025935 Bacteria 7877
146 Ga0207711_10221461 3300025941 Bacteria 1731
147 Ga0209281_1002332 3300027111 Bacteria 7885
148 Ga0209281_1002401 3300027111 Bacteria 7608
149 Ga0209371_1025973 3300027312 Bacteria 1339
150 Ga0207428_10023325 3300027907 Bacteria 5205
151 Ga0307511_10017686 3300030521 Bacteria 6833
152 Ga0316178_1157838 3300030735 Bacteria 5384
153 Ga0316181_1238654 3300030744 Bacteria 4692
154 Ga0307408_100000292 3300031548 Bacteria 48808
155 Ga0307408_100001576 3300031548 Bacteria 16846
156 Ga0307408_100002489 3300031548 Bacteria 12897
157 Ga0307408_100031974 3300031548 Bacteria 3667
158 Ga0307405_10000137 3300031731 Bacteria 28468
159 Ga0307405_10008309 3300031731 Bacteria 5251
160 Ga0307413_10120551 3300031824 Bacteria 1776
161 Ga0307406_10064937 3300031901 Bacteria 2370
162 Ga0307412_10002134 3300031911 Bacteria 10967
163 Ga0307412_10121990 3300031911 Bacteria 1878
164 Ga0307409_100017968 3300031995 Bacteria 4734
165 Ga0307414_10292588 3300032004 Bacteria 1374
166 Ga0307411_10020132 3300032005 Bacteria 3872
167 Ga0307411_10024161 3300032005 Bacteria 3617
168 Ga0373927_0000706 3300035695 Bacteria 25593
169 Ga0373925_0000597 3300037068 Bacteria 34700
170 Ga0395905_0064982 3300037471 Bacteria 3415
171 Ga0439438_000979 3300041405 Bacteria 12767
172 Ga0439438_001358 3300041405 Bacteria 10809
173 Ga0439447_000025 3300041407 Bacteria 50859
174 Ga0439466_0003466 3300041411 Bacteria 6113
175 Ga0439466_0005163 3300041411 Bacteria 5002
176 Ga0439466_0011161 3300041411 Bacteria 3326
177 Ga0439465_0002423 3300041413 Bacteria 6110
178 Ga0439431_0000048 3300041997 Bacteria 17878
179 Ga0439432_000667 3300042006 Bacteria 12828
180 Ga0439432_001831 3300042006 Bacteria 7983
181 Ga0439432_003642 3300042006 Bacteria 5694
182 Ga0439432_011894 3300042006 Bacteria 2990
183 Ga0439451_000431 3300042009 Bacteria 8193
184 Ga0439451_002651 3300042009 Bacteria 3634
185 Ga0439452_000024 3300042010 Bacteria 230396
186 Ga0439452_001785 3300042010 Bacteria 8384
187 Ga0439452_004120 3300042010 Bacteria 4939
188 Ga0439452_008576 3300042010 Bacteria 3066
189 Ga0439452_032584 3300042010 Bacteria 1271
190 Ga0439456_022675 3300042013 Bacteria 1330
191 Ga0439463_002790 3300042016 Bacteria 4430
192 Ga0439463_008411 3300042016 Bacteria 2544
193 Ga0450911_000030 3300042115 Bacteria 75536
194 Ga0450911_005553 3300042115 Bacteria 1943
195 Ga0450919_000226 3300042121 Bacteria 6294
196 Ga0450922_001115 3300042124 Bacteria 2665
197 Ga0450890_000296 3300042127 Bacteria 7251
198 Ga0450897_003222 3300042128 Bacteria 1294
199 Ga0450898_001443 3300042134 Bacteria 3135
200 Ga0450902_016428 3300042137 Bacteria 1206
201 Ga0450903_002701 3300042138 Bacteria 3127
202 Ga0450903_027509 3300042138 Bacteria 865
203 Ga0450904_001386 3300042139 Bacteria 3462
204 Ga0450905_006486 3300042142 Bacteria 1584
205 Ga0450906_000016 3300042145 Bacteria 32476
206 Ga0450906_004234 3300042145 Bacteria 3019
207 Ga0450907_000039 3300042146 Bacteria 57175
208 Ga0450907_007425 3300042146 Bacteria 1829
209 Ga0450910_000003 3300042147 Bacteria 81243
210 Ga0439446_0000458 3300042156 Bacteria 8062
211 Ga0450908_000492 3300042184 Bacteria 7594
212 Ga0450909_006164 3300042185 Bacteria 1729
213 Ga0439434_0023716 3300042435 Bacteria 1848
214 Ga0439460_0005851 3300042461 Bacteria 3032
215 Ga0450901_000416 3300042533 Bacteria 5137
216 Ga0495617_006028 3300046452 Bacteria 4274
217 Ga0495617_013438 3300046452 Bacteria 2787
218 Ga0495617_029959 3300046452 Bacteria 1829
219 Ga0495627_000538 3300046453 Bacteria 31227
220 Ga0495627_032067 3300046453 Bacteria 1655
221 Ga0495591_000139 3300046458 Bacteria 78636
222 Ga0495591_000277 3300046458 Bacteria 47800
223 Ga0495591_005842 3300046458 Bacteria 5593
224 Ga0495629_0006452 3300046459 Bacteria 8693
225 Ga0495638_0079148 3300046460 Bacteria 1999
226 Ga0495638_0152233 3300046460 Bacteria 1341
227 Ga0495653_0017374 3300046463 Bacteria 5851
228 Ga0495653_0027898 3300046463 Bacteria 4518
229 Ga0495653_0328099 3300046463 Bacteria 990
230 Ga0495650_0028800 3300046471 Bacteria 2541
231 Ga0495650_0033219 3300046471 Bacteria 2298
232 Ga0495650_0042051 3300046471 Bacteria 1949
233 Ga0495582_0008582 3300046473 Bacteria 5634
234 Ga0495605_0007746 3300046474 Bacteria 6086
235 Ga0495605_0015413 3300046474 Bacteria 4161
236 Ga0495605_0030007 3300046474 Bacteria 2792
237 Ga0495605_0057570 3300046474 Bacteria 1870
238 Ga0495639_0000066 3300046475 Bacteria 48162
239 Ga0495584_0017052 3300046491 Bacteria 3702
240 Ga0495584_0022096 3300046491 Bacteria 3228
241 Ga0495584_0040998 3300046491 Bacteria 2337
242 Ga0495585_0020167 3300046492 Bacteria 3835
243 Ga0495585_0032199 3300046492 Bacteria 2970
244 Ga0495585_0056094 3300046492 Bacteria 2176
245 Ga0495594_0015269 3300046499 Bacteria 4032
246 Ga0495607_0000540 3300046501 Bacteria 37020
247 Ga0495607_0003561 3300046501 Bacteria 11849
248 Ga0495607_0011933 3300046501 Bacteria 5756
249 Ga0495607_0021884 3300046501 Bacteria 4021
250 Ga0495607_0047329 3300046501 Bacteria 2520
251 Ga0495606_0003459 3300046507 Bacteria 16749
252 Ga0495606_0015212 3300046507 Bacteria 5943
253 Ga0495616_0000101 3300046513 Bacteria 73493
254 Ga0495616_0000663 3300046513 Bacteria 25582
255 Ga0495616_0014457 3300046513 Bacteria 4417
256 Ga0495620_0003915 3300046515 Bacteria 8484
257 Ga0495628_0031807 3300046516 Bacteria 4265
258 Ga0495630_0000759 3300046517 Bacteria 22642
259 Ga0495630_0024105 3300046517 Bacteria 4500
260 Ga0495631_0000013 3300046518 Bacteria 109794
261 Ga0495632_0015974 3300046519 Bacteria 4189
262 Ga0495637_0005411 3300046520 Bacteria 6512
263 Ga0495637_0006865 3300046520 Bacteria 5689
264 Ga0495637_0024369 3300046520 Bacteria 2738
265 Ga0495637_0030844 3300046520 Bacteria 2374
266 Ga0495643_0029777 3300046522 Bacteria 3052
267 Ga0495648_0000042 3300046524 Bacteria 179918
268 Ga0495648_0000495 3300046524 Bacteria 42433
269 Ga0495648_0001223 3300046524 Bacteria 25711
270 Ga0495648_0018323 3300046524 Bacteria 4962
271 Ga0495648_0032558 3300046524 Bacteria 3418
272 Ga0495666_0004144 3300046526 Bacteria 7310
273 Ga0495654_0000145 3300046530 Bacteria 73703
274 Ga0495654_0038484 3300046530 Bacteria 2391
275 Ga0495654_0090307 3300046530 Bacteria 1422
276 Ga0495665_0080126 3300046531 Bacteria 1718
277 Ga0495586_0008705 3300046535 Bacteria 5404
278 Ga0495587_0021674 3300046536 Bacteria 3964
279 Ga0495609_0075595 3300046538 Bacteria 1476
280 Ga0495597_0000117 3300046542 Bacteria 71911
281 Ga0495597_0026779 3300046542 Bacteria 2648
282 Ga0495633_0000564 3300046558 Bacteria 36203
283 Ga0495633_0007118 3300046558 Bacteria 6500
284 Ga0495633_0012386 3300046558 Bacteria 4538
285 Ga0495633_0013280 3300046558 Bacteria 4345
286 Ga0495633_0030197 3300046558 Bacteria 2634
287 Ga0495633_0140973 3300046558 Bacteria 1114
288 Ga0495656_0009096 3300046615 Bacteria 3565
289 Ga0495634_0082099 3300046642 Bacteria 2107
290 Ga0495611_0014576 3300046648 Bacteria 3361
291 Ga0495611_0059560 3300046648 Bacteria 1733
292 Ga0495611_0093424 3300046648 Bacteria 1391
293 Ga0495625_0005136 3300046660 Bacteria 12086
294 Ga0495625_0006501 3300046660 Bacteria 10383
295 Ga0495635_0037712 3300046663 Bacteria 3345
296 Ga0495661_0000037 3300046665 Bacteria 164234
297 Ga0495661_0128507 3300046665 Bacteria 1391
298 Ga0495623_0092543 3300046679 Bacteria 1853
299 Ga0495646_0006219 3300046680 Bacteria 7572
300 Ga0495669_0216731 3300046684 Bacteria 917
301 Ga0495613_0004820 3300046689 Bacteria 10119
302 Ga0495624_0005155 3300046690 Bacteria 9438
303 Ga0495624_0034468 3300046690 Bacteria 3274
304 Ga0495670_0000722 3300046691 Bacteria 15757
305 Ga0495670_0065915 3300046691 Bacteria 1826
306 Ga0495671_0008889 3300046692 Bacteria 5640
307 Ga0495671_0013022 3300046692 Bacteria 4523
308 Ga0495649_0004478 3300046694 Bacteria 9122
309 Ga0495649_0044188 3300046694 Bacteria 2432
310 Ga0495589_0068339 3300046794 Bacteria 1738
311 Ga0495660_0001322 3300046810 Bacteria 17096
312 Ga0495660_0001349 3300046810 Bacteria 16870
313 Ga0495660_0003240 3300046810 Bacteria 10118
314 Ga0495660_0008826 3300046810 Bacteria 5887
315 Ga0495660_0137242 3300046810 Bacteria 1221
316 Ga0495581_0016575 3300047315 Bacteria 4282
317 Ga0495604_0013709 3300047317 Bacteria 6462
318 Ga0495604_0024198 3300047317 Bacteria 4846
319 Ga0495672_0006019 3300047320 Bacteria 9490
320 Ga0495672_0013454 3300047320 Bacteria 5645
321 Ga0495672_0137258 3300047320 Bacteria 1281
322 Ga0495676_0002798 3300047321 Bacteria 15711
323 Ga0495680_0002988 3300047322 Bacteria 16883
324 Ga0495680_0079238 3300047322 Bacteria 2484
325 Ga0495680_0205504 3300047322 Bacteria 1411
326 Ga0495683_0000022 3300047323 Bacteria 163268
327 Ga0495683_0000268 3300047323 Bacteria 46160
328 Ga0495683_0019719 3300047323 Bacteria 3480
329 Ga0495683_0033186 3300047323 Bacteria 2628
330 Ga0495687_000784 3300047443 Bacteria 34187
331 Ga0495675_0009980 3300047444 Bacteria 5922
332 Ga0495675_0033332 3300047444 Bacteria 3288
333 Ga0495679_005202 3300047446 Bacteria 5814
334 Ga0495673_0001186 3300047469 Bacteria 21914
335 Ga0495673_0003466 3300047469 Bacteria 10382
336 Ga0495673_0004351 3300047469 Bacteria 8893
337 Ga0495673_0039669 3300047469 Bacteria 2135
338 Ga0495681_0004277 3300047470 Bacteria 9787
339 Ga0495681_0020517 3300047470 Bacteria 3584
340 Ga0495681_0029657 3300047470 Bacteria 2797
341 Ga0495681_0031486 3300047470 Bacteria 2683
342 Ga0495686_0000378 3300047472 Bacteria 71459
343 Ga0495686_0018761 3300047472 Bacteria 4634
344 Ga0495686_0019055 3300047472 Bacteria 4589
345 Ga0495686_0165698 3300047472 Bacteria 1288
346 Ga0495593_0038671 3300047673 Bacteria 2576
347 Ga0495602_0024473 3300048088 Bacteria 5857
348 Ga0495626_0000671 3300048091 Bacteria 32949
349 Ga0496106_0188137 3300048909 Bacteria 1640
350 Ga0496116_0000038 3300048919 Bacteria 370217
351 Ga0496116_0000312 3300048919 Bacteria 80868
352 Ga0496116_0000646 3300048919 Bacteria 45529
353 Ga0496116_0001263 3300048919 Bacteria 29190
354 Ga0496116_0002313 3300048919 Bacteria 20197
355 Ga0496117_0000597 3300048920 Bacteria 59321
356 Ga0496117_0000807 3300048920 Bacteria 48627
357 Ga0496117_0004196 3300048920 Bacteria 16096
358 Ga0496117_0004650 3300048920 Bacteria 14934
359 Ga0496117_0009361 3300048920 Bacteria 9123
360 Ga0496117_0019370 3300048920 Bacteria 5592
361 Ga0496117_0024859 3300048920 Bacteria 4721
362 Ga0496117_0041281 3300048920 Bacteria 3383
363 Ga0496118_0001066 3300048921 Bacteria 42810
364 Ga0496118_0018588 3300048921 Bacteria 6260
365 Ga0496118_0020919 3300048921 Bacteria 5783
366 Ga0496118_0038892 3300048921 Bacteria 3805
367 Ga0496118_0049112 3300048921 Bacteria 3251
368 Ga0496118_0053697 3300048921 Bacteria 3059
369 Ga0496119_0003729 3300048922 Bacteria 15607
370 Ga0496119_0032704 3300048922 Bacteria 3462
371 Ga0496120_0002470 3300048923 Bacteria 18618
372 Ga0496120_0034116 3300048923 Bacteria 3052
373 Ga0496120_0043123 3300048923 Bacteria 2630
374 Ga0496120_0048376 3300048923 Bacteria 2447
375 Ga0496121_0000001 3300048924 Bacteria 1830318
376 Ga0496121_0000377 3300048924 Bacteria 91399
377 Ga0496121_0001424 3300048924 Bacteria 40476
378 Ga0496122_0018269 3300048925 Bacteria 6491
379 Ga0496122_0022873 3300048925 Bacteria 5535
380 Ga0496122_0026984 3300048925 Bacteria 4928
381 Ga0496122_0061343 3300048925 Bacteria 2760
382 Ga0496122_0074444 3300048925 Bacteria 2402
383 Ga0496123_0000881 3300048926 Bacteria 47635
384 Ga0496123_0001515 3300048926 Bacteria 32169
385 Ga0496123_0013256 3300048926 Bacteria 6943
386 Ga0496123_0014379 3300048926 Bacteria 6565
387 Ga0496123_0021970 3300048926 Bacteria 4935
388 Ga0496123_0028038 3300048926 Bacteria 4178
389 Ga0496123_0029152 3300048926 Bacteria 4072
390 Ga0496124_0000191 3300048927 Bacteria 121192
391 Ga0496124_0000236 3300048927 Bacteria 107751
392 Ga0496124_0000747 3300048927 Bacteria 53318
393 Ga0496124_0013980 3300048927 Bacteria 7791
394 Ga0496124_0098752 3300048927 Bacteria 2368
395 Ga0496124_0102401 3300048927 Bacteria 2317
396 Ga0496124_0117464 3300048927 Bacteria 2130
397 Ga0496124_0151592 3300048927 Bacteria 1817
398 Ga0496124_0171632 3300048927 Bacteria 1678
399 Ga0496125_0000001 3300048928 Bacteria 1766138
400 Ga0496125_0000465 3300048928 Bacteria 72631
401 Ga0496125_0008593 3300048928 Bacteria 10662
402 Ga0496125_0030170 3300048928 Bacteria 4854
403 Ga0496125_0046946 3300048928 Bacteria 3617
404 Ga0496125_0052652 3300048928 Bacteria 3346
405 Ga0496126_0001120 3300048929 Bacteria 44884
406 Ga0496126_0004738 3300048929 Bacteria 16040
407 Ga0496126_0070186 3300048929 Bacteria 3122
408 Ga0496126_0082256 3300048929 Bacteria 2845
409 Ga0496126_0217372 3300048929 Bacteria 1607
410 Ga0495678_002732 3300049459 Bacteria 11598
411 Ga0495682_0000085 3300049460 Bacteria 81879
412 Ga0495682_0035071 3300049460 Bacteria 1848
413 Ga0501227_005863 3300049665 Bacteria 2635
414 Ga0501252_006357 3300049682 Bacteria 1312
415 Ga0501226_000725 3300049853 Bacteria 4475
416 nmdc:mga07m45_224639_c1 3300050496 Bacteria 1093
417 nmdc:mga0sz30_36971_c1 3300050516 Bacteria 2042
418 Ga0500608_145989 3300053122 Bacteria 1043
419 Ga0500559_0105046 3300053136 Bacteria 1304
420 Ga0500561_0000073 3300053137 Bacteria 19888
421 Ga0500616_0027986 3300053153 Bacteria 3110
422 Ga0500622_0004078 3300053156 Bacteria 9366
423 Ga0500624_000232 3300053157 Bacteria 20230
424 Ga0500636_0001432 3300053177 Bacteria 12994

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046531 Ga0495665_0080126 Ga0495665_0080126_60_731 199
2 3300005347 Ga0070668_100125963 Ga0070668_1001259632 200
3 3300009545 Ga0105237_10208062 Ga0105237_102080623 219
4 3300046463 Ga0495653_0328099 Ga0495653_0328099_178_972 219
5 3300046684 Ga0495669_0216731 Ga0495669_0216731_11_805 219
6 3300047673 Ga0495593_0038671 Ga0495593_0038671_634_1428 219
7 iso_pu_bacteria 2599185319 2600041508 220
8 3300037471 Ga0395905_0064982 Ga0395905_0064982_1667_2479 221
9 3300046810 Ga0495660_0003240 Ga0495660_0003240_4987_5796 221
10 3300005289 Ga0065704_10038423 Ga0065704_100384232 224
11 3300009092 Ga0105250_10000353 Ga0105250_100003539 224
12 3300017792 Ga0163161_10011334 Ga0163161_100113343 224
13 3300017792 Ga0163161_10022604 Ga0163161_100226043 224
14 3300025711 Ga0207696_1000108 Ga0207696_1000108104 224
15 3300031731 Ga0307405_10000137 Ga0307405_1000013722 224
16 3300031911 Ga0307412_10121990 Ga0307412_101219902 224
17 3300042128 Ga0450897_003222 Ga0450897_003222_328_1116 224
18 3300042134 Ga0450898_001443 Ga0450898_001443_1674_2462 224
19 3300046459 Ga0495629_0006452 Ga0495629_0006452_2359_3186 224
20 3300046473 Ga0495582_0008582 Ga0495582_0008582_946_1773 224
21 3300046499 Ga0495594_0015269 Ga0495594_0015269_761_1588 224
22 3300046526 Ga0495666_0004144 Ga0495666_0004144_2793_3620 224
23 3300046535 Ga0495586_0008705 Ga0495586_0008705_481_1308 224
24 3300046536 Ga0495587_0021674 Ga0495587_0021674_1928_2755 224
25 3300046642 Ga0495634_0082099 Ga0495634_0082099_1089_1916 224
26 3300046648 Ga0495611_0014576 Ga0495611_0014576_2246_3130 224
27 3300046663 Ga0495635_0037712 Ga0495635_0037712_662_1489 224
28 3300046680 Ga0495646_0006219 Ga0495646_0006219_6002_6829 224
29 3300046689 Ga0495613_0004820 Ga0495613_0004820_2077_2904 224
30 3300047315 Ga0495581_0016575 Ga0495581_0016575_664_1491 224
31 3300047317 Ga0495604_0013709 Ga0495604_0013709_1387_2214 224
32 3300047322 Ga0495680_0002988 Ga0495680_0002988_12292_13119 224
33 3300047444 Ga0495675_0009980 Ga0495675_0009980_243_1070 224
34 3300048920 Ga0496117_0004650 Ga0496117_0004650_9202_9990 224
35 3300048921 Ga0496118_0018588 Ga0496118_0018588_1926_2714 224
36 3300048921 Ga0496118_0020919 Ga0496118_0020919_2974_3858 224
37 3300048923 Ga0496120_0043123 Ga0496120_0043123_1302_2090 224
38 3300048925 Ga0496122_0061343 Ga0496122_0061343_619_1407 224
39 3300048926 Ga0496123_0013256 Ga0496123_0013256_5024_5812 224
40 3300048927 Ga0496124_0098752 Ga0496124_0098752_858_1742 224
41 3300048928 Ga0496125_0046946 Ga0496125_0046946_1926_2810 224
42 3300048929 Ga0496126_0004738 Ga0496126_0004738_13993_14835 224
43 3300015262 Ga0182007_10001255 Ga0182007_1000125512 226
44 3300046463 Ga0495653_0017374 Ga0495653_0017374_754_1554 227
45 3300042115 Ga0450911_005553 Ga0450911_005553_858_1646 233
46 3300042138 Ga0450903_027509 Ga0450903_027509_14_802 233
47 3300047472 Ga0495686_0019055 Ga0495686_0019055_2656_3459 233
48 3300048920 Ga0496117_0019370 Ga0496117_0019370_3655_4443 233
49 3300048921 Ga0496118_0038892 Ga0496118_0038892_1979_2767 233
50 3300046648 Ga0495611_0093424 Ga0495611_0093424_455_1222 234
51 iso_pu_bacteria 2675903420 2677896610 234
52 iso_pu_bacteria 2969304461 2969307062 234
53 iso_pu_bacteria 3007855910 3007856998 234
54 iso_pu_bacteria 2510461069 2510842728 236
55 iso_pu_bacteria 2511231004 2511257475 236
56 iso_pu_bacteria 2511231010 2511290260 236
57 iso_pu_bacteria 2511231016 2511325519 236
58 iso_pu_bacteria 2511231018 2511341542 236
59 iso_pu_bacteria 2511231022 2511362495 236
60 iso_pu_bacteria 2511231023 2511366763 236
61 iso_pu_bacteria 2511231156 2511824490 236
62 iso_pu_bacteria 2515075009 2515110347 236
63 iso_pu_bacteria 2516653046 2516898285 236
64 iso_pu_bacteria 2554235341 2555669805 236
65 iso_pu_bacteria 2597489887 2597859104 236
66 iso_pu_bacteria 2597489888 2597865221 236
67 iso_pu_bacteria 2597489889 2597871077 236
68 iso_pu_bacteria 2599185160 2599353184 236
69 iso_pu_bacteria 2599185164 2599378292 236
70 iso_pu_bacteria 2599185165 2599384331 236
71 iso_pu_bacteria 2599185181 2599460018 236
72 iso_pu_bacteria 2599185185 2599487465 236
73 iso_pu_bacteria 2599185186 2599489039 236
74 iso_pu_bacteria 2599185188 2599502094 236
75 iso_pu_bacteria 2599185189 2599508633 236
76 iso_pu_bacteria 2599185212 2599614725 236
77 iso_pu_bacteria 2599185236 2599722144 236
78 iso_pu_bacteria 2599185248 2599768801 236
79 iso_pu_bacteria 2599185257 2599806212 236
80 iso_pu_bacteria 2599185288 2599877977 236
81 iso_pu_bacteria 2599185289 2599884555 236
82 iso_pu_bacteria 2599185291 2599896266 236
83 iso_pu_bacteria 2599185300 2599932848 236
84 iso_pu_bacteria 2599185303 2599952215 236
85 iso_pu_bacteria 2599185305 2599958152 236
86 iso_pu_bacteria 2599185306 2599964011 236
87 iso_pu_bacteria 2599185308 2599976734 236
88 iso_pu_bacteria 2599185311 2599996675 236
89 iso_pu_bacteria 2599185313 2600003799 236
90 iso_pu_bacteria 2599185314 2600010903 236
91 iso_pu_bacteria 2599185315 2600015875 236
92 iso_pu_bacteria 2599185316 2600021881 236
93 iso_pu_bacteria 2599185317 2600031896 236
94 iso_pu_bacteria 2599185318 2600037346 236
95 iso_pu_bacteria 2599185321 2600051081 236
96 iso_pu_bacteria 2599185322 2600059463 236
97 iso_pu_bacteria 2599185323 2600063716 236
98 iso_pu_bacteria 2599185324 2600069151 236
99 iso_pu_bacteria 2599185325 2600075155 236
100 iso_pu_bacteria 2599185356 2600212625 236
101 iso_pu_bacteria 2600254930 2600361688 236
102 iso_pu_bacteria 2600255296 2601689524 236
103 iso_pu_bacteria 2600255313 2601772793 236
104 iso_pu_bacteria 2600255318 2601799498 236
105 iso_pu_bacteria 2603880185 2606078268 236
106 iso_pu_bacteria 2603880199 2606130376 236
107 iso_pu_bacteria 2619619299 2621302317 236
108 iso_pu_bacteria 2623620443 2624480466 236
109 iso_pu_bacteria 2623620446 2624491572 236
110 iso_pu_bacteria 2643221571 2643869331 236
111 iso_pu_bacteria 2643221610 2644065272 236
112 iso_pu_bacteria 2643221650 2644281077 236
113 iso_pu_bacteria 2643221675 2644418122 236
114 iso_pu_bacteria 2643221680 2644451378 236
115 iso_pu_bacteria 2643221713 2644622054 236
116 iso_pu_bacteria 2643221726 2644691642 236
117 iso_pu_bacteria 2667528170 2671088959 236
118 iso_pu_bacteria 2667528176 2671126965 236
119 iso_pu_bacteria 2671180172 2671772724 236
120 iso_pu_bacteria 2675903515 2678263508 236
121 iso_pu_bacteria 2713897148 2715751585 236
122 iso_pu_bacteria 2713897149 2715759380 236
123 iso_pu_bacteria 2721755607 2723249975 236
124 iso_pu_bacteria 2738541265 2738674417 236
125 iso_pu_bacteria 2738541282 2738752810 236
126 iso_pu_bacteria 2738541294 2738810039 236
127 iso_pu_bacteria 2738541303 2738861851 236
128 iso_pu_bacteria 2738541309 2738897399 236
129 iso_pu_bacteria 2738543015 2739258042 236
130 iso_pu_bacteria 2738543025 2739311671 236
131 iso_pu_bacteria 2744054620 2745009839 236
132 iso_pu_bacteria 2758568016 2758638406 236
133 iso_pu_bacteria 2773857673 2774134202 236
134 iso_pu_bacteria 2775506902 2776267137 236
135 iso_pu_bacteria 2775506904 2776280277 236
136 iso_pu_bacteria 2784132063 2784264017 236
137 iso_pu_bacteria 2791355520 2794597891 236
138 iso_pu_bacteria 2808606385 2808976992 236
139 iso_pu_bacteria 2808606388 2808992147 236
140 iso_pu_bacteria 2816332298 2817488258 236
141 iso_pu_bacteria 2818991467 2819721826 236
142 iso_pu_bacteria 2825651385 2825652300 236
143 iso_pu_bacteria 2834028612 2834032851 236
144 iso_pu_bacteria 2838736955 2838741822 236
145 iso_pu_bacteria 2841734538 2841735524 236
146 iso_pu_bacteria 2841840854 2841845762 236
147 iso_pu_bacteria 2842140634 2842145466 236
148 iso_pu_bacteria 2842826826 2842827553 236
149 iso_pu_bacteria 2842832357 2842834781 236
150 iso_pu_bacteria 2842837860 2842841337 236
151 iso_pu_bacteria 2842843487 2842843491 236
152 iso_pu_bacteria 2842854478 2842854989 236
153 iso_pu_bacteria 2844665904 2844670851 236
154 iso_pu_bacteria 2852612431 2852613674 236
155 iso_pu_bacteria 2852657418 2852657903 236
156 iso_pu_bacteria 2852667396 2852668590 236
157 iso_pu_bacteria 2860339153 2860344656 236
158 iso_pu_bacteria 2871474448 2871476236 236
159 iso_pu_bacteria 2878029506 2878032400 236
160 iso_pu_bacteria 2880230671 2880233918 236
161 iso_pu_bacteria 2889306138 2889311308 236
162 iso_pu_bacteria 2904483920 2904489857 236
163 iso_pu_bacteria 2904518522 2904523225 236
164 iso_pu_bacteria 2913036834 2913039127 236
165 iso_pu_bacteria 2916021584 2916028349 236
166 iso_pu_bacteria 2916028427 2916028661 236
167 iso_pu_bacteria 2916055098 2916056051 236
168 iso_pu_bacteria 2917070673 2917073623 236
169 iso_pu_bacteria 2919063839 2919065242 236
170 iso_pu_bacteria 2919385768 2919387107 236
171 iso_pu_bacteria 2919487758 2919489053 236
172 iso_pu_bacteria 2919527303 2919532925 236
173 iso_pu_bacteria 2919697872 2919703937 236
174 iso_pu_bacteria 2921263974 2921264285 236
175 iso_pu_bacteria 2923586266 2923588141 236
176 iso_pu_bacteria 2924172951 2924179474 236
177 iso_pu_bacteria 2929138655 2929140294 236
178 iso_pu_bacteria 2929144301 2929147746 236
179 iso_pu_bacteria 2931369376 2931374861 236
180 iso_pu_bacteria 2931396565 2931402177 236
181 iso_pu_bacteria 2935353572 2935357365 236
182 iso_pu_bacteria 2937042894 2937047647 236
183 iso_pu_bacteria 2937071275 2937075850 236
184 iso_pu_bacteria 2937126314 2937126587 236
185 iso_pu_bacteria 2946006987 2946010528 236
186 iso_pu_bacteria 2946027586 2946028507 236
187 iso_pu_bacteria 2947233263 2947239056 236
188 iso_pu_bacteria 2957478035 2957478260 236
189 iso_pu_bacteria 2964636051 2964639887 236
190 iso_pu_bacteria 2964705432 2964706870 236
191 iso_pu_bacteria 2967775926 2967780356 236
192 iso_pu_bacteria 2974289157 2974290820 236
193 iso_pu_bacteria 2998139840 2998142994 236
194 iso_pu_bacteria 3005416602 3005419385 236
195 iso_pu_bacteria 3007861166 3007862030 236
196 iso_pu_bacteria 3007866637 3007868452 236
197 iso_pu_bacteria 637000220 637320144 236
198 iso_pu_bacteria 8001845381 8001846433 236
199 iso_pu_bacteria 8004633249 8004639375 236
200 iso_pu_bacteria 8005460587 8005460986 236
201 iso_pu_bacteria 8019775933 8019781973 236
202 iso_pu_bacteria 8029995093 8029997793 236
203 iso_pu_bacteria 8054285046 8054287929 236
204 iso_pu_bacteria 8054285046 8054291396 236
205 iso_pu_bacteria 8054347763 8054350656 236
206 iso_pu_bacteria 8055770955 8055773601 236
207 iso_pu_bacteria 8056125926 8056128344 236
208 iso_pu_bacteria 8056131705 8056134197 236
209 iso_pu_bacteria 8056143049 8056146996 236
210 iso_pu_bacteria 8056148874 8056150310 236
211 iso_pu_bacteria 8056166840 8056168198 236
212 iso_pu_bacteria 8056569372 8056574107 236
213 3300003756 Ga0055533_1000353 Ga0055533_10003534 238
214 3300003759 Ga0055525_1002000 Ga0055525_10020004 238
215 3300005367 Ga0070667_100534870 Ga0070667_1005348701 238
216 3300006051 Ga0075364_10097464 Ga0075364_100974643 238
217 3300006058 Ga0075432_10005619 Ga0075432_100056194 238
218 3300009092 Ga0105250_10001427 Ga0105250_100014277 238
219 3300012498 Ga0157345_1000001 Ga0157345_1000001144 238
220 3300013105 Ga0157369_10011709 Ga0157369_100117094 238
221 3300017792 Ga0163161_10030055 Ga0163161_100300553 238
222 3300025711 Ga0207696_1003553 Ga0207696_10035537 238
223 3300030521 Ga0307511_10017686 Ga0307511_100176863 238
224 3300041411 Ga0439466_0005163 Ga0439466_0005163_1837_2727 238
225 3300041413 Ga0439465_0002423 Ga0439465_0002423_2458_3348 238
226 3300042006 Ga0439432_003642 Ga0439432_003642_2802_3692 238
227 3300042009 Ga0439451_002651 Ga0439451_002651_1843_2733 238
228 3300042010 Ga0439452_004120 Ga0439452_004120_3733_4521 238
229 3300042016 Ga0439463_008411 Ga0439463_008411_445_1335 238
230 3300042121 Ga0450919_000226 Ga0450919_000226_3223_4113 238
231 3300042127 Ga0450890_000296 Ga0450890_000296_1746_2636 238
232 3300042137 Ga0450902_016428 Ga0450902_016428_281_1171 238
233 3300042146 Ga0450907_007425 Ga0450907_007425_482_1270 238
234 3300042156 Ga0439446_0000458 Ga0439446_0000458_4293_5183 238
235 3300042185 Ga0450909_006164 Ga0450909_006164_523_1311 238
236 3300042435 Ga0439434_0023716 Ga0439434_0023716_61_951 238
237 3300042461 Ga0439460_0005851 Ga0439460_0005851_428_1318 238
238 3300046453 Ga0495627_032067 Ga0495627_032067_577_1359 238
239 3300046471 Ga0495650_0028800 Ga0495650_0028800_390_1172 238
240 3300046471 Ga0495650_0033219 Ga0495650_0033219_147_929 238
241 3300046474 Ga0495605_0015413 Ga0495605_0015413_748_1530 238
242 3300046501 Ga0495607_0011933 Ga0495607_0011933_1675_2457 238
243 3300046513 Ga0495616_0000663 Ga0495616_0000663_3308_4090 238
244 3300046515 Ga0495620_0003915 Ga0495620_0003915_4587_5369 238
245 3300046518 Ga0495631_0000013 Ga0495631_0000013_81044_81826 238
246 3300046520 Ga0495637_0006865 Ga0495637_0006865_2497_3279 238
247 3300046522 Ga0495643_0029777 Ga0495643_0029777_1352_2134 238
248 3300046524 Ga0495648_0001223 Ga0495648_0001223_11896_12678 238
249 3300046524 Ga0495648_0032558 Ga0495648_0032558_694_1476 238
250 3300046542 Ga0495597_0000117 Ga0495597_0000117_45630_46412 238
251 3300046558 Ga0495633_0000564 Ga0495633_0000564_26310_27092 238
252 3300046648 Ga0495611_0059560 Ga0495611_0059560_667_1449 238
253 3300046690 Ga0495624_0034468 Ga0495624_0034468_2247_3029 238
254 3300046810 Ga0495660_0001349 Ga0495660_0001349_7443_8225 238
255 3300046810 Ga0495660_0137242 Ga0495660_0137242_112_894 238
256 3300047320 Ga0495672_0013454 Ga0495672_0013454_2153_2941 238
257 3300047470 Ga0495681_0004277 Ga0495681_0004277_3436_4218 238
258 3300047470 Ga0495681_0031486 Ga0495681_0031486_1344_2126 238
259 3300047472 Ga0495686_0018761 Ga0495686_0018761_199_1008 238
260 3300049460 Ga0495682_0000085 Ga0495682_0000085_50761_51543 238
261 iso_pu_bacteria 2501025501 2501075993 238
262 iso_pu_bacteria 2501025504 2501409694 238
263 iso_pu_bacteria 2510917014 2511099218 238
264 iso_pu_bacteria 2510917015 2511108678 238
265 3300041411 Ga0439466_0011161 Ga0439466_0011161_1104_1889 239
266 3300042006 Ga0439432_001831 Ga0439432_001831_2536_3321 239
267 3300042009 Ga0439451_000431 Ga0439451_000431_2518_3303 239
268 3300042010 Ga0439452_001785 Ga0439452_001785_5063_5848 239
269 3300042013 Ga0439456_022675 Ga0439456_022675_21_806 239
270 3300042138 Ga0450903_002701 Ga0450903_002701_502_1392 239
271 3300042145 Ga0450906_004234 Ga0450906_004234_1396_2184 239
272 3300042184 Ga0450908_000492 Ga0450908_000492_4229_5119 239
273 3300046691 Ga0495670_0065915 Ga0495670_0065915_808_1779 239
274 3300053136 Ga0500559_0105046 Ga0500559_0105046_21_830 239
275 2162886007 SwRhRL2b_contig_1366508 SwRhRL2b_0892.00003500 240
276 3300002737 JGI25162J39368_1000004 JGI25162J39368_1000004337 240
277 3300002772 JGI25164J39214_1000026 JGI25164J39214_100002646 240
278 3300003214 JGI25165J46597_1000011 JGI25165J46597_1000011337 240
279 3300003215 JGI25153J46596_10036842 JGI25153J46596_100368422 240
280 3300003752 Ga0055539_1000036 Ga0055539_1000036159 240
281 3300003756 Ga0055533_1000046 Ga0055533_1000046159 240
282 3300003758 Ga0055532_1000032 Ga0055532_1000032159 240
283 3300003759 Ga0055525_1000217 Ga0055525_100021726 240
284 3300003761 Ga0055535_1005166 Ga0055535_10051663 240
285 3300003775 Ga0055524_1004630 Ga0055524_10046303 240
286 3300003775 Ga0055524_1008145 Ga0055524_10081454 240
287 3300003781 Ga0055536_1000013 Ga0055536_1000013199 240
288 3300003781 Ga0055536_1000032 Ga0055536_100003283 240
289 3300003781 Ga0055536_1000277 Ga0055536_100027717 240
290 3300003790 Ga0055528_1000018 Ga0055528_1000018112 240
291 3300003791 Ga0055530_10000004 Ga0055530_1000000433 240
292 3300003791 Ga0055530_10000029 Ga0055530_1000002983 240
293 3300003791 Ga0055530_10000062 Ga0055530_1000006277 240
294 3300003791 Ga0055530_10000648 Ga0055530_1000064819 240
295 3300003792 Ga0055540_1000008 Ga0055540_1000008246 240
296 3300003792 Ga0055540_1000017 Ga0055540_1000017170 240
297 3300003792 Ga0055540_1000166 Ga0055540_100016625 240
298 3300003794 Ga0055531_10000242 Ga0055531_1000024228 240
299 3300003841 Ga0055541_1000024 Ga0055541_1000024159 240
300 3300005288 Ga0065714_10002302 Ga0065714_1000230222 240
301 3300005288 Ga0065714_10008929 Ga0065714_100089293 240
302 3300005288 Ga0065714_10072254 Ga0065714_100722543 240
303 3300005288 Ga0065714_10082726 Ga0065714_100827262 240
304 3300005289 Ga0065704_10070262 Ga0065704_100702627 240
305 3300005289 Ga0065704_10111062 Ga0065704_101110622 240
306 3300005289 Ga0065704_10160409 Ga0065704_101604092 240
307 3300005331 Ga0070670_100000034 Ga0070670_10000003494 240
308 3300005331 Ga0070670_100000381 Ga0070670_10000038135 240
309 3300005331 Ga0070670_100002591 Ga0070670_1000025914 240
310 3300005353 Ga0070669_100000259 Ga0070669_10000025928 240
311 3300005457 Ga0070662_100002140 Ga0070662_10000214012 240
312 3300005539 Ga0068853_100074172 Ga0068853_1000741722 240
313 3300005834 Ga0068851_10007430 Ga0068851_100074303 240
314 3300006051 Ga0075364_10230563 Ga0075364_102305631 240
315 3300006058 Ga0075432_10000821 Ga0075432_1000082113 240
316 3300006186 Ga0075369_10094846 Ga0075369_100948462 240
317 3300009011 Ga0105251_10000207 Ga0105251_1000020725 240
318 3300009011 Ga0105251_10008072 Ga0105251_100080725 240
319 3300009011 Ga0105251_10011506 Ga0105251_100115065 240
320 3300009036 Ga0105244_10018340 Ga0105244_100183402 240
321 3300009036 Ga0105244_10034292 Ga0105244_100342922 240
322 3300009036 Ga0105244_10053034 Ga0105244_100530342 240
323 3300009092 Ga0105250_10000207 Ga0105250_100002073 240
324 3300009092 Ga0105250_10017372 Ga0105250_100173723 240
325 3300009148 Ga0105243_10000170 Ga0105243_1000017028 240
326 3300009148 Ga0105243_10002467 Ga0105243_1000246716 240
327 3300009148 Ga0105243_10080694 Ga0105243_100806942 240
328 3300009177 Ga0105248_10252084 Ga0105248_102520842 240
329 3300009553 Ga0105249_10569842 Ga0105249_105698422 240
330 3300013100 Ga0157373_10002166 Ga0157373_1000216612 240
331 3300013100 Ga0157373_10015520 Ga0157373_100155204 240
332 3300013100 Ga0157373_10088366 Ga0157373_100883662 240
333 3300013102 Ga0157371_10002985 Ga0157371_1000298511 240
334 3300013102 Ga0157371_10011312 Ga0157371_100113126 240
335 3300013104 Ga0157370_10056689 Ga0157370_100566893 240
336 3300013105 Ga0157369_10206262 Ga0157369_102062622 240
337 3300013306 Ga0163162_10441039 Ga0163162_104410392 240
338 3300013307 Ga0157372_10000821 Ga0157372_1000082112 240
339 3300014497 Ga0182008_10000429 Ga0182008_100004292 240
340 3300014497 Ga0182008_10004315 Ga0182008_100043158 240
341 3300014497 Ga0182008_10005140 Ga0182008_100051409 240
342 3300014497 Ga0182008_10007005 Ga0182008_100070055 240
343 3300015261 Ga0182006_1000677 Ga0182006_10006776 240
344 3300015261 Ga0182006_1001013 Ga0182006_100101325 240
345 3300015261 Ga0182006_1006763 Ga0182006_10067632 240
346 3300015262 Ga0182007_10000766 Ga0182007_1000076625 240
347 3300015265 Ga0182005_1002698 Ga0182005_10026985 240
348 3300015265 Ga0182005_1005588 Ga0182005_10055884 240
349 3300017792 Ga0163161_10031082 Ga0163161_100310822 240
350 3300025206 Ga0209435_101329 Ga0209435_1013292 240
351 3300025207 Ga0209760_100105 Ga0209760_10010557 240
352 3300025224 Ga0209784_100017 Ga0209784_100017290 240
353 3300025225 Ga0209566_100014 Ga0209566_100014290 240
354 3300025226 Ga0209674_100028 Ga0209674_100028290 240
355 3300025229 Ga0209147_100038 Ga0209147_100038145 240
356 3300025230 Ga0209563_100032 Ga0209563_100032290 240
357 3300025231 Ga0207427_100003 Ga0207427_100003335 240
358 3300025233 Ga0209437_100002 Ga0209437_100002678 240
359 3300025242 Ga0209258_100197 Ga0209258_10019770 240
360 3300025246 Ga0209646_1000171 Ga0209646_100017181 240
361 3300025253 Ga0209677_100018 Ga0209677_100018290 240
362 3300025256 Ga0209759_1021150 Ga0209759_10211502 240
363 3300025261 Ga0209233_1000004 Ga0209233_1000004747 240
364 3300025273 Ga0209673_1000055 Ga0209673_1000055112 240
365 3300025291 Ga0209675_1002987 Ga0209675_10029874 240
366 3300025292 Ga0209676_1000002 Ga0209676_10000021326 240
367 3300025292 Ga0209676_1000003 Ga0209676_10000031040 240
368 3300025292 Ga0209676_1000120 Ga0209676_100012013 240
369 3300025292 Ga0209676_1001065 Ga0209676_10010655 240
370 3300025295 Ga0209564_1025815 Ga0209564_10258152 240
371 3300025295 Ga0209564_1030508 Ga0209564_10305082 240
372 3300025298 Ga0209050_1000004 Ga0209050_10000041022 240
373 3300025298 Ga0209050_1000006 Ga0209050_1000006244 240
374 3300025298 Ga0209050_1000037 Ga0209050_100003732 240
375 3300025299 Ga0209256_1000147 Ga0209256_1000147112 240
376 3300025299 Ga0209256_1000401 Ga0209256_10004015 240
377 3300025303 Ga0209051_1000001 Ga0209051_10000011326 240
378 3300025303 Ga0209051_1000040 Ga0209051_100004033 240
379 3300025303 Ga0209051_1000052 Ga0209051_1000052233 240
380 3300025304 Ga0209257_1000029 Ga0209257_1000029244 240
381 3300025304 Ga0209257_1006677 Ga0209257_10066776 240
382 3300025321 Ga0207656_10000034 Ga0207656_100000343 240
383 3300025711 Ga0207696_1000002 Ga0207696_1000002341 240
384 3300025711 Ga0207696_1002028 Ga0207696_10020285 240
385 3300025711 Ga0207696_1054692 Ga0207696_10546922 240
386 3300025728 Ga0207655_1000141 Ga0207655_1000141157 240
387 3300025728 Ga0207655_1000520 Ga0207655_100052039 240
388 3300025728 Ga0207655_1002113 Ga0207655_100211310 240
389 3300025728 Ga0207655_1024127 Ga0207655_10241273 240
390 3300025728 Ga0207655_1097271 Ga0207655_10972712 240
391 3300025735 Ga0207713_1000122 Ga0207713_100012286 240
392 3300025735 Ga0207713_1001298 Ga0207713_100129817 240
393 3300025735 Ga0207713_1007845 Ga0207713_10078454 240
394 3300025735 Ga0207713_1008251 Ga0207713_10082518 240
395 3300025923 Ga0207681_10000215 Ga0207681_1000021529 240
396 3300025925 Ga0207650_10000066 Ga0207650_1000006694 240
397 3300025925 Ga0207650_10000272 Ga0207650_1000027210 240
398 3300025925 Ga0207650_10003085 Ga0207650_100030854 240
399 3300025933 Ga0207706_10007035 Ga0207706_100070353 240
400 3300025935 Ga0207709_10000004 Ga0207709_10000004612 240
401 3300025935 Ga0207709_10004673 Ga0207709_100046734 240
402 3300025941 Ga0207711_10221461 Ga0207711_102214611 240
403 3300027111 Ga0209281_1002332 Ga0209281_10023322 240
404 3300027111 Ga0209281_1002401 Ga0209281_10024016 240
405 3300027312 Ga0209371_1025973 Ga0209371_10259732 240
406 3300027907 Ga0207428_10023325 Ga0207428_100233252 240
407 3300030735 Ga0316178_1157838 Ga0316178_11578385 240
408 3300030744 Ga0316181_1238654 Ga0316181_12386542 240
409 3300031548 Ga0307408_100000292 Ga0307408_10000029240 240
410 3300031548 Ga0307408_100001576 Ga0307408_1000015764 240
411 3300031548 Ga0307408_100002489 Ga0307408_10000248912 240
412 3300031548 Ga0307408_100031974 Ga0307408_1000319742 240
413 3300031731 Ga0307405_10008309 Ga0307405_100083092 240
414 3300031824 Ga0307413_10120551 Ga0307413_101205513 240
415 3300031901 Ga0307406_10064937 Ga0307406_100649372 240
416 3300031911 Ga0307412_10002134 Ga0307412_100021348 240
417 3300031995 Ga0307409_100017968 Ga0307409_1000179685 240
418 3300032004 Ga0307414_10292588 Ga0307414_102925882 240
419 3300032005 Ga0307411_10020132 Ga0307411_100201324 240
420 3300032005 Ga0307411_10024161 Ga0307411_100241614 240
421 3300035695 Ga0373927_0000706 Ga0373927_0000706_5571_6407 240
422 3300037068 Ga0373925_0000597 Ga0373925_0000597_12816_13652 240
423 3300041405 Ga0439438_000979 Ga0439438_000979_5468_6256 240
424 3300041405 Ga0439438_001358 Ga0439438_001358_5468_6256 240
425 3300041407 Ga0439447_000025 Ga0439447_000025_17197_17985 240
426 3300041411 Ga0439466_0003466 Ga0439466_0003466_3736_4524 240
427 3300041997 Ga0439431_0000048 Ga0439431_0000048_7120_7908 240
428 3300042006 Ga0439432_000667 Ga0439432_000667_10890_11678 240
429 3300042006 Ga0439432_011894 Ga0439432_011894_1823_2611 240
430 3300042010 Ga0439452_000024 Ga0439452_000024_83359_84147 240
431 3300042010 Ga0439452_008576 Ga0439452_008576_2244_3032 240
432 3300042010 Ga0439452_032584 Ga0439452_032584_58_846 240
433 3300042016 Ga0439463_002790 Ga0439463_002790_1150_1938 240
434 3300042115 Ga0450911_000030 Ga0450911_000030_27294_28082 240
435 3300042124 Ga0450922_001115 Ga0450922_001115_764_1552 240
436 3300042139 Ga0450904_001386 Ga0450904_001386_1512_2300 240
437 3300042142 Ga0450905_006486 Ga0450905_006486_755_1543 240
438 3300042145 Ga0450906_000016 Ga0450906_000016_3162_3950 240
439 3300042146 Ga0450907_000039 Ga0450907_000039_19315_20103 240
440 3300042147 Ga0450910_000003 Ga0450910_000003_43473_44261 240
441 3300042533 Ga0450901_000416 Ga0450901_000416_2549_3337 240
442 3300046452 Ga0495617_006028 Ga0495617_006028_2140_2928 240
443 3300046452 Ga0495617_013438 Ga0495617_013438_1622_2410 240
444 3300046452 Ga0495617_029959 Ga0495617_029959_812_1600 240
445 3300046453 Ga0495627_000538 Ga0495627_000538_30106_30894 240
446 3300046458 Ga0495591_000139 Ga0495591_000139_3988_4776 240
447 3300046458 Ga0495591_000277 Ga0495591_000277_42136_42924 240
448 3300046458 Ga0495591_005842 Ga0495591_005842_2614_3402 240
449 3300046460 Ga0495638_0079148 Ga0495638_0079148_729_1517 240
450 3300046460 Ga0495638_0152233 Ga0495638_0152233_425_1213 240
451 3300046463 Ga0495653_0027898 Ga0495653_0027898_952_1740 240
452 3300046471 Ga0495650_0042051 Ga0495650_0042051_334_1122 240
453 3300046474 Ga0495605_0007746 Ga0495605_0007746_4726_5514 240
454 3300046474 Ga0495605_0030007 Ga0495605_0030007_1573_2361 240
455 3300046474 Ga0495605_0057570 Ga0495605_0057570_15_803 240
456 3300046475 Ga0495639_0000066 Ga0495639_0000066_462_1250 240
457 3300046491 Ga0495584_0017052 Ga0495584_0017052_1706_2533 240
458 3300046491 Ga0495584_0022096 Ga0495584_0022096_2120_2908 240
459 3300046491 Ga0495584_0040998 Ga0495584_0040998_1522_2310 240
460 3300046492 Ga0495585_0020167 Ga0495585_0020167_444_1232 240
461 3300046492 Ga0495585_0032199 Ga0495585_0032199_691_1479 240
462 3300046492 Ga0495585_0056094 Ga0495585_0056094_449_1237 240
463 3300046501 Ga0495607_0000540 Ga0495607_0000540_7823_8611 240
464 3300046501 Ga0495607_0003561 Ga0495607_0003561_8149_8937 240
465 3300046501 Ga0495607_0021884 Ga0495607_0021884_946_1773 240
466 3300046501 Ga0495607_0047329 Ga0495607_0047329_1264_2052 240
467 3300046507 Ga0495606_0003459 Ga0495606_0003459_24_812 240
468 3300046507 Ga0495606_0015212 Ga0495606_0015212_745_1533 240
469 3300046513 Ga0495616_0000101 Ga0495616_0000101_68711_69499 240
470 3300046513 Ga0495616_0014457 Ga0495616_0014457_2165_2953 240
471 3300046516 Ga0495628_0031807 Ga0495628_0031807_3243_4043 240
472 3300046517 Ga0495630_0000759 Ga0495630_0000759_18771_19571 240
473 3300046517 Ga0495630_0024105 Ga0495630_0024105_3450_4238 240
474 3300046519 Ga0495632_0015974 Ga0495632_0015974_244_1032 240
475 3300046520 Ga0495637_0005411 Ga0495637_0005411_2185_3012 240
476 3300046520 Ga0495637_0024369 Ga0495637_0024369_1924_2712 240
477 3300046520 Ga0495637_0030844 Ga0495637_0030844_1264_2052 240
478 3300046524 Ga0495648_0000042 Ga0495648_0000042_46948_47736 240
479 3300046524 Ga0495648_0000495 Ga0495648_0000495_28399_29226 240
480 3300046524 Ga0495648_0018323 Ga0495648_0018323_2934_3722 240
481 3300046530 Ga0495654_0000145 Ga0495654_0000145_4233_5021 240
482 3300046530 Ga0495654_0038484 Ga0495654_0038484_62_850 240
483 3300046530 Ga0495654_0090307 Ga0495654_0090307_364_1152 240
484 3300046538 Ga0495609_0075595 Ga0495609_0075595_522_1310 240
485 3300046542 Ga0495597_0026779 Ga0495597_0026779_603_1391 240
486 3300046558 Ga0495633_0007118 Ga0495633_0007118_5063_5908 240
487 3300046558 Ga0495633_0012386 Ga0495633_0012386_2392_3180 240
488 3300046558 Ga0495633_0013280 Ga0495633_0013280_1512_2351 240
489 3300046558 Ga0495633_0030197 Ga0495633_0030197_1184_1972 240
490 3300046558 Ga0495633_0140973 Ga0495633_0140973_237_1073 240
491 3300046615 Ga0495656_0009096 Ga0495656_0009096_2411_3199 240
492 3300046660 Ga0495625_0005136 Ga0495625_0005136_7654_8442 240
493 3300046660 Ga0495625_0006501 Ga0495625_0006501_2129_2956 240
494 3300046665 Ga0495661_0000037 Ga0495661_0000037_5473_6261 240
495 3300046665 Ga0495661_0128507 Ga0495661_0128507_474_1262 240
496 3300046679 Ga0495623_0092543 Ga0495623_0092543_377_1177 240
497 3300046690 Ga0495624_0005155 Ga0495624_0005155_4458_5246 240
498 3300046691 Ga0495670_0000722 Ga0495670_0000722_3024_3812 240
499 3300046692 Ga0495671_0008889 Ga0495671_0008889_457_1245 240
500 3300046692 Ga0495671_0013022 Ga0495671_0013022_2158_2946 240
501 3300046694 Ga0495649_0004478 Ga0495649_0004478_3645_4433 240
502 3300046694 Ga0495649_0044188 Ga0495649_0044188_1181_1969 240
503 3300046794 Ga0495589_0068339 Ga0495589_0068339_150_977 240
504 3300046810 Ga0495660_0001322 Ga0495660_0001322_11064_11852 240
505 3300046810 Ga0495660_0008826 Ga0495660_0008826_4404_5192 240
506 3300047317 Ga0495604_0024198 Ga0495604_0024198_911_1711 240
507 3300047320 Ga0495672_0006019 Ga0495672_0006019_4528_5316 240
508 3300047320 Ga0495672_0137258 Ga0495672_0137258_345_1133 240
509 3300047321 Ga0495676_0002798 Ga0495676_0002798_2796_3584 240
510 3300047322 Ga0495680_0079238 Ga0495680_0079238_319_1119 240
511 3300047322 Ga0495680_0205504 Ga0495680_0205504_69_857 240
512 3300047323 Ga0495683_0000022 Ga0495683_0000022_78594_79421 240
513 3300047323 Ga0495683_0000268 Ga0495683_0000268_2159_2947 240
514 3300047323 Ga0495683_0019719 Ga0495683_0019719_2628_3416 240
515 3300047323 Ga0495683_0033186 Ga0495683_0033186_389_1177 240
516 3300047443 Ga0495687_000784 Ga0495687_000784_2982_3770 240
517 3300047444 Ga0495675_0033332 Ga0495675_0033332_2263_3063 240
518 3300047446 Ga0495679_005202 Ga0495679_005202_4454_5242 240
519 3300047469 Ga0495673_0001186 Ga0495673_0001186_367_1155 240
520 3300047469 Ga0495673_0003466 Ga0495673_0003466_532_1320 240
521 3300047469 Ga0495673_0004351 Ga0495673_0004351_223_1011 240
522 3300047469 Ga0495673_0039669 Ga0495673_0039669_447_1235 240
523 3300047470 Ga0495681_0020517 Ga0495681_0020517_1228_2016 240
524 3300047470 Ga0495681_0029657 Ga0495681_0029657_872_1660 240
525 3300047472 Ga0495686_0000378 Ga0495686_0000378_67666_68454 240
526 3300047472 Ga0495686_0165698 Ga0495686_0165698_79_906 240
527 3300048088 Ga0495602_0024473 Ga0495602_0024473_2844_3644 240
528 3300048091 Ga0495626_0000671 Ga0495626_0000671_30901_31689 240
529 3300048909 Ga0496106_0188137 Ga0496106_0188137_279_1067 240
530 3300048919 Ga0496116_0000038 Ga0496116_0000038_89987_90775 240
531 3300048919 Ga0496116_0000312 Ga0496116_0000312_4968_5756 240
532 3300048919 Ga0496116_0000646 Ga0496116_0000646_14237_15025 240
533 3300048919 Ga0496116_0001263 Ga0496116_0001263_320_1108 240
534 3300048919 Ga0496116_0002313 Ga0496116_0002313_1146_1934 240
535 3300048920 Ga0496117_0000597 Ga0496117_0000597_21241_22029 240
536 3300048920 Ga0496117_0000807 Ga0496117_0000807_14172_14960 240
537 3300048920 Ga0496117_0004196 Ga0496117_0004196_10111_10899 240
538 3300048920 Ga0496117_0009361 Ga0496117_0009361_493_1281 240
539 3300048920 Ga0496117_0024859 Ga0496117_0024859_304_1092 240
540 3300048920 Ga0496117_0041281 Ga0496117_0041281_2104_2892 240
541 3300048921 Ga0496118_0001066 Ga0496118_0001066_23886_24674 240
542 3300048921 Ga0496118_0049112 Ga0496118_0049112_555_1343 240
543 3300048921 Ga0496118_0053697 Ga0496118_0053697_1029_1817 240
544 3300048922 Ga0496119_0003729 Ga0496119_0003729_5600_6388 240
545 3300048922 Ga0496119_0032704 Ga0496119_0032704_661_1449 240
546 3300048923 Ga0496120_0002470 Ga0496120_0002470_2662_3450 240
547 3300048923 Ga0496120_0034116 Ga0496120_0034116_1268_2056 240
548 3300048923 Ga0496120_0048376 Ga0496120_0048376_1035_1823 240
549 3300048924 Ga0496121_0000001 Ga0496121_0000001_1595955_1596743 240
550 3300048924 Ga0496121_0000377 Ga0496121_0000377_90039_90827 240
551 3300048924 Ga0496121_0001424 Ga0496121_0001424_37659_38447 240
552 3300048925 Ga0496122_0018269 Ga0496122_0018269_2875_3684 240
553 3300048925 Ga0496122_0022873 Ga0496122_0022873_2941_3729 240
554 3300048925 Ga0496122_0026984 Ga0496122_0026984_3601_4389 240
555 3300048925 Ga0496122_0074444 Ga0496122_0074444_131_919 240
556 3300048926 Ga0496123_0000881 Ga0496123_0000881_27799_28587 240
557 3300048926 Ga0496123_0001515 Ga0496123_0001515_18543_19331 240
558 3300048926 Ga0496123_0014379 Ga0496123_0014379_1983_2771 240
559 3300048926 Ga0496123_0021970 Ga0496123_0021970_3200_3988 240
560 3300048926 Ga0496123_0028038 Ga0496123_0028038_1454_2242 240
561 3300048926 Ga0496123_0029152 Ga0496123_0029152_52_840 240
562 3300048927 Ga0496124_0000191 Ga0496124_0000191_91180_91968 240
563 3300048927 Ga0496124_0000236 Ga0496124_0000236_52940_53776 240
564 3300048927 Ga0496124_0000747 Ga0496124_0000747_8211_8999 240
565 3300048927 Ga0496124_0013980 Ga0496124_0013980_5398_6234 240
566 3300048927 Ga0496124_0102401 Ga0496124_0102401_1360_2148 240
567 3300048927 Ga0496124_0117464 Ga0496124_0117464_368_1156 240
568 3300048927 Ga0496124_0151592 Ga0496124_0151592_439_1227 240
569 3300048927 Ga0496124_0171632 Ga0496124_0171632_612_1400 240
570 3300048928 Ga0496125_0000001 Ga0496125_0000001_1754655_1755443 240
571 3300048928 Ga0496125_0000465 Ga0496125_0000465_6211_6999 240
572 3300048928 Ga0496125_0008593 Ga0496125_0008593_3854_4663 240
573 3300048928 Ga0496125_0030170 Ga0496125_0030170_373_1161 240
574 3300048928 Ga0496125_0052652 Ga0496125_0052652_812_1648 240
575 3300048929 Ga0496126_0001120 Ga0496126_0001120_34211_34999 240
576 3300048929 Ga0496126_0070186 Ga0496126_0070186_881_1669 240
577 3300048929 Ga0496126_0082256 Ga0496126_0082256_1614_2402 240
578 3300048929 Ga0496126_0217372 Ga0496126_0217372_640_1428 240
579 3300049459 Ga0495678_002732 Ga0495678_002732_2785_3573 240
580 3300049460 Ga0495682_0035071 Ga0495682_0035071_679_1467 240
581 3300049665 Ga0501227_005863 Ga0501227_005863_381_1169 240
582 3300049682 Ga0501252_006357 Ga0501252_006357_188_976 240
583 3300049853 Ga0501226_000725 Ga0501226_000725_1709_2497 240
584 3300050496 nmdc:mga07m45_224639_c1 nmdc:mga07m45_224639_c1_138_974 240
585 3300050516 nmdc:mga0sz30_36971_c1 nmdc:mga0sz30_36971_c1_1007_1843 240
586 3300053122 Ga0500608_145989 Ga0500608_145989_198_986 240
587 3300053137 Ga0500561_0000073 Ga0500561_0000073_2868_3704 240
588 3300053153 Ga0500616_0027986 Ga0500616_0027986_1047_1835 240
589 3300053156 Ga0500622_0004078 Ga0500622_0004078_3285_4073 240
590 3300053157 Ga0500624_000232 Ga0500624_000232_11366_12154 240
591 3300053177 Ga0500636_0001432 Ga0500636_0001432_9321_10109 240
592 iso_pu_bacteria 2508501127 2509145513 240
593 iso_pu_bacteria 2558860242 2559297391 240
594 iso_pu_bacteria 2738543031 2739351633 240
595 iso_pu_bacteria 2878788777 2878793945 240
596 iso_pu_bacteria 2937836603 2937842338 240
597 iso_pu_bacteria 2958071322 2958075479 240
598 iso_pu_bacteria 2979089926 2979090535 240
599 iso_pu_bacteria 2979095461 2979096061 240
600 iso_pu_bacteria 650716007 650843824 240

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

41

234

0.97

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

47

245

0.93

PF08659

KR

KR domain

41

212

0.9

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

43

196

0.7

Structural Annotation

Top 5 Hits

ID Description Score Start End
4bmv-assembly4.cif.gz_I short-chain dehydrogenase from sphingobium yanoikuyae in complex with nadph 0.8431 5 236
4bmv-assembly2.cif.gz_D short-chain dehydrogenase from sphingobium yanoikuyae in complex with nadph 0.8412 3 237
4bmv-assembly2.cif.gz_D short-chain dehydrogenase from sphingobium yanoikuyae in complex with nadph 0.8224 3 237
4bmv-assembly4.cif.gz_I short-chain dehydrogenase from sphingobium yanoikuyae in complex with nadph 0.8145 5 236
6ze0-assembly2.cif.gz_C-2 orthorhombic crystal structure of the bulky-bulky ketone specific alcohol dehydrogenase from comamonas testosteroni 0.8084 5 238
ID Description Score Start End Superfamily
af_A0A0R0HUJ2_8_65_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9488 5 54 3.40.50.720
af_Q0JEC9_1_74_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8883 5 61 3.40.50.720
af_C6T421_12_106_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8626 5 65 3.40.50.720
af_F4J128_251_373_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.861 71 166 3.40.50.720
af_A0A0P0X9U1_21_128_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8443 5 67 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A0T9PN84-F1-model_v4 Short chain dehydrogenase 0.9187 130 240
AF-I3V3I7-F1-model_v4 Short-chain dehydrogenase/reductase SDR 0.9134 110 239
AF-A0A358GZA9-F1-model_v4 deleted 0.9009 75 238
AF-A0A7W6JR17-F1-model_v4 SDR family oxidoreductase 0.8977 73 239 GO:0016491
AF-A0A3M4CMJ9-F1-model_v4 deleted 0.8934 70 240

Feature Viewer

pLDDT pTM Quality
83.87 0.82 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map