metagRoot

F467858

General Info

Members	Datasets	Scaffolds	Average Seq Length
599	254	599	310

Family's Representative Sequence

Representative Sequence	3300007788\|Ga0099795_10038282\|Ga0099795_100382822
Length	346
Sequence	MPGPPVATVWLGYSGYHFCGGVVDYDSSIGAVMKKLSFVVSLPTNDNDYQQEQAAAAEKAARQLGVDVKIIHANNDAVTQSQQLLEFVQCDSSSRPDAIVFEPAGGTAFPQVARAAAAAGIGWVVLNHEADYISQLRLAHQVPVFAISSDHEEVGKIQGKQFAALLPQGGSVLYIEGPANSSAAKERTAGMNRTKPANIQVKSLRANWTEESAYRAVSSWLRLSTSQAAKINLVAAQDDSMAAGSRKAFSEMADGDRERWMRIPFTGCDGMLNTGHAWVRSGVLAATIYIRPNTDLALEMLTESIRSGSPLPEQKLTVPESIPSLQELVNRGKHPDAEKLHRTARA

Samples

	Sample ID	Description	Type	Environment
1	2162886012	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1	Metagenome	Rhizosphere
2	3300000546	Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled	Metagenome	Rhizosphere
3	3300001976	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7	Metagenome	Rhizosphere
4	3300001991	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2	Metagenome	Rhizosphere
5	3300002459	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6	Metagenome	Rhizosphere
6	3300005293	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2)	Metagenome	Rhizosphere
7	3300005327	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG	Metagenome	Rhizosphere
8	3300005328	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG	Metagenome	Rhizosphere
9	3300005329	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG	Metagenome	Rhizosphere
10	3300005330	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG	Metagenome	Rhizosphere
11	3300005331	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG	Metagenome	Rhizosphere
12	3300005333	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG	Metagenome	Rhizosphere
13	3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Metagenome	Rhizosphere
14	3300005335	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG	Metagenome	Rhizosphere
15	3300005336	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG	Metagenome	Rhizosphere
16	3300005337	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG	Metagenome	Rhizosphere
17	3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Metagenome	Rhizosphere
18	3300005339	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG	Metagenome	Rhizosphere
19	3300005341	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG	Metagenome	Rhizosphere
20	3300005344	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG	Metagenome	Rhizosphere
21	3300005354	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG	Metagenome	Rhizosphere
22	3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Metagenome	Rhizosphere
23	3300005365	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG	Metagenome	Rhizosphere
24	3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Metagenome	Rhizosphere
25	3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Metagenome	Rhizosphere
26	3300005406	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG	Metagenome	Rhizosphere
27	3300005434	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG	Metagenome	Rhizosphere
28	3300005435	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG	Metagenome	Rhizosphere
29	3300005436	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG	Metagenome	Rhizosphere
30	3300005437	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG	Metagenome	Rhizosphere
31	3300005439	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG	Metagenome	Rhizosphere
32	3300005440	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG	Metagenome	Rhizosphere
33	3300005444	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG	Metagenome	Rhizosphere
34	3300005445	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG	Metagenome	Rhizosphere
35	3300005455	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG	Metagenome	Rhizosphere
36	3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Metagenome	Rhizosphere
37	3300005458	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG	Metagenome	Rhizosphere
38	3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Metagenome	Rhizosphere
39	3300005466	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG	Metagenome	Rhizosphere
40	3300005467	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG	Metagenome	Rhizosphere
41	3300005468	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG	Metagenome	Rhizosphere
42	3300005471	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG	Metagenome	Rhizosphere
43	3300005518	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG	Metagenome	Rhizosphere
44	3300005530	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG	Metagenome	Rhizosphere
45	3300005535	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG	Metagenome	Rhizosphere
46	3300005536	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG	Metagenome	Rhizosphere
47	3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Metagenome	Rhizosphere
48	3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Metagenome	Rhizosphere
49	3300005544	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG	Metagenome	Rhizosphere
50	3300005545	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG	Metagenome	Rhizosphere
51	3300005546	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG	Metagenome	Rhizosphere
52	3300005547	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG	Metagenome	Rhizosphere
53	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
54	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
55	3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Metagenome	Rhizosphere
56	3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Metagenome	Rhizosphere
57	3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Metagenome	Rhizosphere
58	3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Metagenome	Rhizosphere
59	3300005615	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG	Metagenome	Rhizosphere
60	3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Metagenome	Rhizosphere
61	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
62	3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Metagenome	Rhizosphere
63	3300005718	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2	Metagenome	Rhizosphere
64	3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Metagenome	Rhizosphere
65	3300005834	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2	Metagenome	Rhizosphere
66	3300005840	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2	Metagenome	Rhizosphere
67	3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Metagenome	Rhizosphere
68	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
69	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
70	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
71	3300006028	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG	Metagenome	Rhizosphere
72	3300006163	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG	Metagenome	Rhizosphere
73	3300006173	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG	Metagenome	Rhizosphere
74	3300006175	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG	Metagenome	Rhizosphere
75	3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2)	Metagenome	Rhizosphere
76	3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Metagenome	Rhizosphere
77	3300006852	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Metagenome	Rhizosphere
78	3300006871	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Metagenome	Rhizosphere
79	3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Metagenome	Rhizosphere
80	3300006914	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5	Metagenome	Rhizosphere
81	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
82	3300007076	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4	Metagenome	Rhizosphere
83	3300007265	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1	Metagenome	Rhizosphere
84	3300007788	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2	Metagenome	Rhizosphere
85	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
86	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
87	3300009101	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG	Metagenome	Rhizosphere
88	3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Metagenome	Rhizosphere
89	3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Metagenome	Rhizosphere
90	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
91	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
92	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
93	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
94	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
95	3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Metagenome	Rhizosphere
96	3300013100	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG	Metagenome	Rhizosphere
97	3300013102	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG	Metagenome	Rhizosphere
98	3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Metagenome	Rhizosphere
99	3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Metagenome	Rhizosphere
100	3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Metagenome	Rhizosphere
101	3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Metagenome	Rhizosphere
102	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
103	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
104	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
105	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
106	3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Metagenome	Rhizosphere
107	3300014745	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG	Metagenome	Rhizosphere
108	3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Metagenome	Rhizosphere
109	3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Metagenome	Rhizosphere
110	3300015261	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG	Metagenome	Rhizosphere
111	3300015262	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG	Metagenome	Rhizosphere
112	3300021384	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9	Metagenome	Unclassified
113	3300022732	Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU1	Metagenome	Rhizosphere
114	3300024225	Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5	Metagenome	Rhizosphere
115	3300024227	Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4	Metagenome	Rhizosphere
116	3300025321	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
117	3300025885	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
118	3300025898	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
119	3300025899	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
120	3300025901	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2)	Metagenome	Rhizosphere
121	3300025904	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2)	Metagenome	Rhizosphere
122	3300025905	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
123	3300025906	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
124	3300025907	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
125	3300025908	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
126	3300025909	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
127	3300025910	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
128	3300025911	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
129	3300025912	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
130	3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
131	3300025914	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
132	3300025915	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
133	3300025916	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
134	3300025917	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
135	3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
136	3300025920	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
137	3300025921	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
138	3300025922	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
139	3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
140	3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
141	3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
142	3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
143	3300025928	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
144	3300025929	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
145	3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
146	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
147	3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
148	3300025939	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
149	3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
150	3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
151	3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
152	3300025944	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
153	3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
154	3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
155	3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
156	3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
157	3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
158	3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
159	3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
160	3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
161	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
162	3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
163	3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
164	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
165	3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
166	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
167	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
168	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
169	3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
170	3300028017	Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4	Metagenome	Rhizosphere
171	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
172	3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
173	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
174	3300028800	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG	Metagenome	Rhizosphere
175	3300030760	Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
176	3300030878	Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
177	3300030889	Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI2 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
178	3300031090	Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
179	3300035083	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17	Metagenome	Rhizosphere
180	3300035086	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4	Metagenome	Rhizosphere
181	3300035111	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11	Metagenome	Rhizosphere
182	3300035113	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12	Metagenome	Rhizosphere
183	3300035116	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3	Metagenome	Rhizosphere
184	3300035117	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1	Metagenome	Rhizosphere
185	3300035119	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4	Metagenome	Rhizosphere
186	3300035120	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5	Metagenome	Rhizosphere
187	3300035170	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1	Metagenome	Rhizosphere
188	3300035171	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4	Metagenome	Rhizosphere
189	3300035172	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3	Metagenome	Rhizosphere
190	3300035241	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4	Metagenome	Rhizosphere
191	3300035410	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12	Metagenome	Rhizosphere
192	3300035691	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4	Metagenome	Rhizosphere
193	3300035692	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11	Metagenome	Rhizosphere
194	3300035695	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19	Metagenome	Rhizosphere
195	3300035724	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1	Metagenome	Rhizosphere
196	3300035725	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8	Metagenome	Rhizosphere
197	3300036401	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16	Metagenome	Rhizosphere
198	3300037068	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16	Metagenome	Rhizosphere
199	3300039437	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2	Metagenome	Unclassified
200	3300039453	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2	Metagenome	Rhizosphere
201	3300044706	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R	Metagenome	Rhizosphere
202	3300045051	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED	Metagenome	Rhizosphere
203	3300045836	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R	Metagenome	Rhizosphere
204	3300046454	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere	Metagenome	Rhizosphere
205	3300046455	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere	Metagenome	Rhizosphere
206	3300046459	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere	Metagenome	Rhizosphere
207	3300046462	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere	Metagenome	Rhizosphere
208	3300046463	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere	Metagenome	Rhizosphere
209	3300046472	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere	Metagenome	Rhizosphere
210	3300046473	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere	Metagenome	Rhizosphere
211	3300046475	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere	Metagenome	Rhizosphere
212	3300046477	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere	Metagenome	Rhizosphere
213	3300046511	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere	Metagenome	Rhizosphere
214	3300046514	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere	Metagenome	Rhizosphere
215	3300046516	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere	Metagenome	Rhizosphere
216	3300046517	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere	Metagenome	Rhizosphere
217	3300046529	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere	Metagenome	Rhizosphere
218	3300046536	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere	Metagenome	Rhizosphere
219	3300046559	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere	Metagenome	Rhizosphere
220	3300046663	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere	Metagenome	Rhizosphere
221	3300046678	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere	Metagenome	Rhizosphere
222	3300046679	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere	Metagenome	Rhizosphere
223	3300046683	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere	Metagenome	Rhizosphere
224	3300046690	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere	Metagenome	Rhizosphere
225	3300046809	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere	Metagenome	Rhizosphere
226	3300047315	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere	Metagenome	Rhizosphere
227	3300047317	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere	Metagenome	Rhizosphere
228	3300047319	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere	Metagenome	Rhizosphere
229	3300047321	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere	Metagenome	Rhizosphere
230	3300047322	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere	Metagenome	Rhizosphere
231	3300047471	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere	Metagenome	Rhizosphere
232	3300048088	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere	Metagenome	Rhizosphere
233	3300048089	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere	Metagenome	Rhizosphere
234	3300048903	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled	Metagenome	Rhizoplane
235	3300048904	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled	Metagenome	Rhizoplane
236	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
237	3300048906	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15	Metagenome	Rhizoplane
238	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
239	3300048908	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15	Metagenome	Rhizoplane
240	3300048910	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15	Metagenome	Rhizoplane
241	3300048911	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled	Metagenome	Rhizoplane
242	3300048912	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled	Metagenome	Rhizoplane
243	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
244	3300048914	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15	Metagenome	Rhizoplane
245	3300048915	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15	Metagenome	Rhizoplane
246	3300048916	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15	Metagenome	Rhizoplane
247	3300048917	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15	Metagenome	Rhizoplane
248	3300048918	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15	Metagenome	Rhizoplane
249	3300050512	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation	Metagenome	Rhizosphere
250	3300050513	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation	Metagenome	Rhizosphere
251	3300050514	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation	Metagenome	Rhizosphere
252	3300050515	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation	Metagenome	Rhizosphere
253	3300053077	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere	Metagenome	Rhizosphere
254	3300053085	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere	Metagenome	Rhizosphere

Type Distribution

Type	Percentage (%)
Metagenomes	98.33
Metatranscriptomes	1.67
Isolates	0

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	0
Nodule	0
Rhizoplane	5.18
Rhizosphere	94.49
Stem	0
Stem Tuber	0
Unclassified	0.33

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	MBSR1b_contig_19785	2162886012	Unclassified	2786
2	MBSR1b_contig_5659833	2162886012	Unclassified	2844
3	LJNas_1000240	3300000546	Bacteria	9450
4	JGI24752J21851_1000553	3300001976	Unclassified	4972
5	JGI24743J22301_10002354	3300001991	Unclassified	2829
6	JGI24751J29686_10003835	3300002459	Unclassified	3036
7	Ga0065715_10099407	3300005293	Bacteria	3416
8	Ga0065715_10136627	3300005293	Bacteria	1919
9	Ga0070658_10023861	3300005327	Bacteria	4906
10	Ga0070676_10016059	3300005328	Bacteria	4136
11	Ga0070676_10250111	3300005328	Bacteria	1182
12	Ga0070683_100019063	3300005329	Bacteria	6087
13	Ga0070683_100020893	3300005329	Bacteria	5837
14	Ga0070683_100072474	3300005329	Bacteria	3215
15	Ga0070690_100092088	3300005330	Bacteria	1998
16	Ga0070690_100119918	3300005330	Bacteria	1764
17	Ga0070670_100007241	3300005331	Bacteria	9401
18	Ga0070670_100067638	3300005331	Bacteria	3065
19	Ga0070670_100115885	3300005331	Bacteria	2310
20	Ga0070670_100146262	3300005331	Bacteria	2045
21	Ga0070677_10011876	3300005333	Bacteria	3014
22	Ga0068869_100024771	3300005334	Bacteria	4159
23	Ga0070666_10097744	3300005335	Bacteria	2021
24	Ga0070680_100067302	3300005336	Bacteria	2938
25	Ga0070680_100084520	3300005336	Unclassified	2621
26	Ga0070682_100013140	3300005337	Bacteria	4756
27	Ga0068868_100002841	3300005338	Bacteria	11998
28	Ga0068868_100008075	3300005338	Bacteria	7528
29	Ga0068868_100010737	3300005338	Bacteria	6639
30	Ga0068868_100173788	3300005338	Bacteria	1784
31	Ga0070660_100127485	3300005339	Bacteria	2034
32	Ga0070691_10034745	3300005341	Bacteria	2374
33	Ga0070661_100004534	3300005344	Bacteria	9557
34	Ga0070661_100068477	3300005344	Bacteria	2608
35	Ga0070661_100156408	3300005344	Bacteria	1725
36	Ga0070675_100102024	3300005354	Bacteria	2417
37	Ga0070671_100457403	3300005355	Bacteria	1095
38	Ga0070688_100007188	3300005365	Bacteria	5996
39	Ga0070659_100020040	3300005366	Bacteria	5078
40	Ga0070667_100007558	3300005367	Bacteria	9015
41	Ga0070667_100219507	3300005367	Bacteria	1692
42	Ga0070703_10004797	3300005406	Unclassified	3781
43	Ga0070709_10020545	3300005434	Bacteria	3832
44	Ga0070709_10044560	3300005434	Unclassified	2748
45	Ga0070709_10046062	3300005434	Bacteria	2710
46	Ga0070709_10049605	3300005434	Bacteria	2626
47	Ga0070714_100000074	3300005435	Bacteria	86593
48	Ga0070714_100012653	3300005435	Bacteria	6739
49	Ga0070714_100042711	3300005435	Bacteria	3831
50	Ga0070714_100061969	3300005435	Bacteria	3214
51	Ga0070714_100119581	3300005435	Bacteria	2342
52	Ga0070713_100007877	3300005436	Bacteria	7516
53	Ga0070713_100037904	3300005436	Bacteria	3900
54	Ga0070713_100107395	3300005436	Unclassified	2428
55	Ga0070713_100139622	3300005436	Bacteria	2145
56	Ga0070713_100434589	3300005436	Unclassified	1230
57	Ga0070710_10003782	3300005437	Bacteria	7158
58	Ga0070710_10115998	3300005437	Bacteria	1615
59	Ga0070710_10256339	3300005437	Unclassified	1126
60	Ga0070711_100000531	3300005439	Bacteria	19818
61	Ga0070711_100001779	3300005439	Bacteria	11997
62	Ga0070711_100422777	3300005439	Unclassified	1086
63	Ga0070705_100002589	3300005440	Bacteria	9064
64	Ga0070705_100017404	3300005440	Bacteria	3752
65	Ga0070694_100012321	3300005444	Bacteria	5312
66	Ga0070708_100000137	3300005445	Bacteria	50233
67	Ga0070708_100000598	3300005445	Bacteria	27157
68	Ga0070708_100001275	3300005445	Bacteria	19393
69	Ga0070708_100007154	3300005445	Bacteria	8907
70	Ga0070708_100038338	3300005445	Unclassified	4187
71	Ga0070708_100181791	3300005445	Bacteria	1966
72	Ga0070708_100471012	3300005445	Unclassified	1185
73	Ga0070663_100011255	3300005455	Bacteria	5609
74	Ga0070663_100015527	3300005455	Bacteria	4920
75	Ga0070662_100027939	3300005457	Bacteria	3922
76	Ga0070662_100079150	3300005457	Bacteria	2443
77	Ga0070681_10000113	3300005458	Bacteria	59985
78	Ga0070681_10014011	3300005458	Bacteria	7979
79	Ga0070681_10321558	3300005458	Bacteria	1457
80	Ga0068867_100013267	3300005459	Bacteria	5837
81	Ga0068867_100194743	3300005459	Bacteria	1619
82	Ga0070685_10015430	3300005466	Bacteria	4058
83	Ga0070685_10086270	3300005466	Bacteria	1892
84	Ga0070706_100000278	3300005467	Bacteria	62365
85	Ga0070706_100000595	3300005467	Bacteria	41856
86	Ga0070706_100009361	3300005467	Bacteria	9121
87	Ga0070706_100016580	3300005467	Bacteria	6805
88	Ga0070706_100203806	3300005467	Bacteria	1848
89	Ga0070707_100000651	3300005468	Bacteria	34704
90	Ga0070707_100009656	3300005468	Bacteria	8967
91	Ga0070707_100070918	3300005468	Unclassified	3356
92	Ga0070698_100000133	3300005471	Bacteria	65381
93	Ga0070698_100000902	3300005471	Bacteria	32626
94	Ga0070698_100357614	3300005471	Unclassified	1392
95	Ga0070699_100000439	3300005518	Bacteria	39981
96	Ga0070699_100029206	3300005518	Unclassified	4755
97	Ga0070699_100038400	3300005518	Bacteria	4146
98	Ga0070699_100053336	3300005518	Unclassified	3500
99	Ga0070699_100083091	3300005518	Bacteria	2793
100	Ga0070679_100008386	3300005530	Bacteria	9724
101	Ga0070679_100053541	3300005530	Unclassified	4017
102	Ga0070679_100208352	3300005530	Bacteria	1919
103	Ga0070684_100080621	3300005535	Bacteria	2879
104	Ga0070684_100092922	3300005535	Bacteria	2685
105	Ga0070684_100387666	3300005535	Bacteria	1287
106	Ga0070697_100000049	3300005536	Bacteria	90362
107	Ga0070697_100000113	3300005536	Bacteria	63284
108	Ga0070697_100000265	3300005536	Bacteria	42493
109	Ga0070697_100014361	3300005536	Bacteria	6220
110	Ga0070697_100024273	3300005536	Unclassified	4826
111	Ga0070697_100035805	3300005536	Unclassified	4006
112	Ga0070697_100139655	3300005536	Bacteria	2037
113	Ga0070697_100271907	3300005536	Bacteria	1452
114	Ga0068853_100205582	3300005539	Bacteria	1793
115	Ga0068853_100292897	3300005539	Bacteria	1503
116	Ga0070672_100017824	3300005543	Bacteria	5118
117	Ga0070686_100043155	3300005544	Bacteria	2828
118	Ga0070686_100112444	3300005544	Bacteria	1857
119	Ga0070695_100022298	3300005545	Bacteria	3884
120	Ga0070696_100002816	3300005546	Bacteria	11551
121	Ga0070696_100199993	3300005546	Unclassified	1491
122	Ga0070693_100000105	3300005547	Bacteria	37510
123	Ga0070693_100018297	3300005547	Bacteria	3657
124	Ga0070693_100020826	3300005547	Bacteria	3466
125	Ga0070693_100052302	3300005547	Bacteria	2341
126	Ga0070665_100100580	3300005548	Bacteria	2895
127	Ga0068855_100006228	3300005563	Bacteria	14540
128	Ga0068855_100006821	3300005563	Bacteria	13853
129	Ga0068855_100026793	3300005563	Bacteria	6896
130	Ga0068855_100031118	3300005563	Bacteria	6375
131	Ga0068855_100041923	3300005563	Bacteria	5425
132	Ga0068855_100077769	3300005563	Unclassified	3850
133	Ga0068855_100180576	3300005563	Unclassified	2386
134	Ga0070664_100000942	3300005564	Bacteria	22742
135	Ga0070664_100119086	3300005564	Bacteria	2310
136	Ga0070664_100218367	3300005564	Bacteria	1705
137	Ga0068857_100001399	3300005577	Bacteria	19043
138	Ga0068857_100013822	3300005577	Bacteria	7030
139	Ga0068857_100015816	3300005577	Bacteria	6601
140	Ga0068857_100041092	3300005577	Bacteria	4100
141	Ga0068854_100010678	3300005578	Bacteria	5961
142	Ga0068854_100011596	3300005578	Bacteria	5745
143	Ga0068856_100000320	3300005614	Bacteria	52874
144	Ga0068856_100003923	3300005614	Bacteria	14910
145	Ga0068856_100008041	3300005614	Bacteria	10297
146	Ga0068856_100010906	3300005614	Bacteria	8820
147	Ga0068856_100012860	3300005614	Bacteria	8100
148	Ga0068856_100033640	3300005614	Bacteria	5020
149	Ga0068856_100095990	3300005614	Bacteria	2953
150	Ga0068856_100151737	3300005614	Bacteria	2326
151	Ga0070702_100034763	3300005615	Bacteria	2780
152	Ga0070702_100101432	3300005615	Bacteria	1766
153	Ga0068852_100002183	3300005616	Bacteria	13418
154	Ga0068852_100033720	3300005616	Unclassified	4254
155	Ga0068852_100121514	3300005616	Bacteria	2392
156	Ga0068859_100080020	3300005617	Bacteria	3308
157	Ga0068859_100249431	3300005617	Bacteria	1866
158	Ga0068864_100018410	3300005618	Bacteria	5836
159	Ga0068864_100124297	3300005618	Bacteria	2310
160	Ga0068866_10011554	3300005718	Bacteria	3824
161	Ga0068866_10016363	3300005718	Bacteria	3316
162	Ga0068861_100149892	3300005719	Bacteria	1913
163	Ga0068851_10019550	3300005834	Bacteria	3273
164	Ga0068851_10043678	3300005834	Bacteria	2259
165	Ga0068851_10129996	3300005834	Unclassified	1361
166	Ga0068870_10006762	3300005840	Bacteria	5080
167	Ga0068863_100007165	3300005841	Bacteria	10939
168	Ga0068863_100012874	3300005841	Bacteria	8068
169	Ga0068863_100015362	3300005841	Bacteria	7359
170	Ga0068863_100176520	3300005841	Unclassified	2050
171	Ga0068858_100007558	3300005842	Bacteria	10501
172	Ga0068858_100022440	3300005842	Bacteria	5891
173	Ga0068858_100024970	3300005842	Bacteria	5562
174	Ga0068858_100123744	3300005842	Bacteria	2420
175	Ga0068860_100039164	3300005843	Bacteria	4534
176	Ga0068860_100063548	3300005843	Bacteria	3505
177	Ga0068860_100175688	3300005843	Bacteria	2070
178	Ga0068860_100232357	3300005843	Unclassified	1792
179	Ga0068862_100071338	3300005844	Bacteria	2999
180	Ga0070717_10003539	3300006028	Bacteria	11199
181	Ga0070717_10009588	3300006028	Bacteria	7283
182	Ga0070717_10017100	3300006028	Bacteria	5635
183	Ga0070717_10019930	3300006028	Bacteria	5267
184	Ga0070717_10037070	3300006028	Bacteria	3958
185	Ga0070717_10047018	3300006028	Unclassified	3534
186	Ga0070717_10075989	3300006028	Unclassified	2810
187	Ga0070717_10089158	3300006028	Unclassified	2601
188	Ga0070717_10126075	3300006028	Bacteria	2198
189	Ga0070717_10233999	3300006028	Bacteria	1618
190	Ga0070717_10568542	3300006028	Unclassified	1027
191	Ga0070715_10000761	3300006163	Bacteria	8721
192	Ga0070715_10010989	3300006163	Bacteria	3245
193	Ga0070715_10011527	3300006163	Bacteria	3186
194	Ga0070716_100036205	3300006173	Bacteria	2720
195	Ga0070716_100137424	3300006173	Bacteria	1554
196	Ga0070712_100000604	3300006175	Bacteria	21049
197	Ga0070712_100006642	3300006175	Bacteria	7192
198	Ga0070712_100031170	3300006175	Bacteria	3590
199	Ga0097621_100000243	3300006237	Bacteria	36567
200	Ga0097621_100002887	3300006237	Bacteria	11800
201	Ga0097621_100022360	3300006237	Bacteria	4908
202	Ga0097621_100070408	3300006237	Bacteria	2888
203	Ga0097621_100182610	3300006237	Bacteria	1813
204	Ga0068871_100000207	3300006358	Bacteria	40846
205	Ga0068871_100001769	3300006358	Bacteria	14540
206	Ga0068871_100005518	3300006358	Bacteria	8871
207	Ga0068871_100044631	3300006358	Bacteria	3566
208	Ga0075433_10005520	3300006852	Bacteria	9931
209	Ga0075433_10033760	3300006852	Bacteria	4388
210	Ga0075434_100000069	3300006871	Bacteria	53659
211	Ga0075434_100002915	3300006871	Bacteria	15194
212	Ga0068865_100030528	3300006881	Bacteria	3586
213	Ga0068865_100084496	3300006881	Bacteria	2287
214	Ga0075436_100001352	3300006914	Bacteria	16679
215	Ga0075436_100003911	3300006914	Bacteria	10207
216	Ga0075436_100005052	3300006914	Bacteria	9078
217	Ga0075436_100012762	3300006914	Bacteria	5760
218	Ga0075436_100015655	3300006914	Bacteria	5192
219	Ga0075436_100064623	3300006914	Unclassified	2530
220	Ga0075436_100285256	3300006914	Bacteria	1181
221	Ga0097620_100080028	3300006931	Bacteria	3308
222	Ga0097620_100249407	3300006931	Bacteria	1866
223	Ga0075435_100024362	3300007076	Unclassified	4696
224	Ga0075435_100034994	3300007076	Bacteria	3984
225	Ga0075435_100242485	3300007076	Unclassified	1533
226	Ga0099794_10000577	3300007265	Bacteria	12289
227	Ga0099794_10005853	3300007265	Bacteria	4959
228	Ga0099794_10025781	3300007265	Bacteria	2712
229	Ga0099794_10037438	3300007265	Unclassified	2296
230	Ga0099794_10088380	3300007265	Unclassified	1536
231	Ga0099795_10038282	3300007788	Unclassified	1692
232	Ga0099795_10039618	3300007788	Unclassified	1669
233	Ga0105240_10041047	3300009093	Bacteria	5910
234	Ga0105240_10042960	3300009093	Bacteria	5757
235	Ga0105240_10047697	3300009093	Bacteria	5419
236	Ga0105240_10068023	3300009093	Bacteria	4413
237	Ga0105240_10090532	3300009093	Bacteria	3739
238	Ga0105240_10138622	3300009093	Bacteria	2911
239	Ga0105240_10251730	3300009093	Unclassified	2042
240	Ga0105245_10011712	3300009098	Bacteria	7632
241	Ga0105245_10243540	3300009098	Bacteria	1744
242	Ga0105247_10073430	3300009101	Bacteria	2143
243	Ga0105241_10010172	3300009174	Bacteria	6909
244	Ga0105241_10011679	3300009174	Bacteria	6447
245	Ga0105241_10021518	3300009174	Bacteria	4768
246	Ga0105241_10024343	3300009174	Unclassified	4495
247	Ga0105242_10003236	3300009176	Bacteria	12699
248	Ga0105248_10001179	3300009177	Bacteria	29217
249	Ga0105248_10377732	3300009177	Bacteria	1595
250	Ga0105237_10004926	3300009545	Bacteria	15267
251	Ga0105237_10089155	3300009545	Bacteria	3074
252	Ga0105237_10282470	3300009545	Bacteria	1662
253	Ga0105238_10003878	3300009551	Bacteria	14845
254	Ga0105238_10007126	3300009551	Bacteria	11186
255	Ga0105238_10024197	3300009551	Bacteria	6192
256	Ga0105238_10193920	3300009551	Bacteria	2007
257	Ga0105249_10047140	3300009553	Bacteria	3926
258	Ga0105239_10013406	3300010375	Bacteria	9108
259	Ga0105239_10045709	3300010375	Bacteria	4799
260	Ga0105246_10003819	3300011119	Bacteria	9131
261	Ga0157373_10056110	3300013100	Bacteria	2797
262	Ga0157373_10132669	3300013100	Unclassified	1751
263	Ga0157371_10003824	3300013102	Bacteria	13439
264	Ga0157370_10008092	3300013104	Bacteria	11383
265	Ga0157370_10296209	3300013104	Bacteria	1494
266	Ga0157369_10000481	3300013105	Bacteria	52974
267	Ga0157369_10016674	3300013105	Bacteria	8259
268	Ga0157369_10024702	3300013105	Bacteria	6678
269	Ga0157369_10032125	3300013105	Bacteria	5773
270	Ga0157369_10156475	3300013105	Bacteria	2407
271	Ga0157369_10263890	3300013105	Bacteria	1796
272	Ga0157374_10001617	3300013296	Bacteria	18892
273	Ga0157374_10002231	3300013296	Bacteria	16324
274	Ga0157374_10002669	3300013296	Bacteria	15022
275	Ga0157374_10018662	3300013296	Bacteria	6125
276	Ga0157374_10159207	3300013296	Bacteria	2199
277	Ga0157378_10000062	3300013297	Bacteria	94916
278	Ga0157378_10002136	3300013297	Bacteria	17559
279	Ga0157378_10005302	3300013297	Bacteria	11327
280	Ga0157378_10013909	3300013297	Bacteria	7039
281	Ga0157378_10113234	3300013297	Unclassified	2490
282	Ga0163162_10000471	3300013306	Bacteria	37412
283	Ga0163162_10123477	3300013306	Bacteria	2694
284	Ga0157372_10000756	3300013307	Bacteria	35031
285	Ga0157372_10002367	3300013307	Bacteria	20401
286	Ga0157372_10002657	3300013307	Bacteria	19372
287	Ga0157372_10021571	3300013307	Bacteria	6960
288	Ga0157372_10042975	3300013307	Bacteria	5002
289	Ga0157372_10051189	3300013307	Bacteria	4595
290	Ga0157372_10121186	3300013307	Bacteria	3004
291	Ga0157372_10123959	3300013307	Bacteria	2970
292	Ga0157372_10318066	3300013307	Bacteria	1812
293	Ga0157372_10456298	3300013307	Unclassified	1489
294	Ga0157372_10971379	3300013307	Bacteria	984
295	Ga0157375_10373421	3300013308	Bacteria	1592
296	Ga0157375_10405705	3300013308	Bacteria	1529
297	Ga0163163_10002845	3300014325	Bacteria	14632
298	Ga0163163_10117338	3300014325	Bacteria	2693
299	Ga0157380_10014889	3300014326	Bacteria	5700
300	Ga0157377_10022200	3300014745	Bacteria	3348
301	Ga0157379_10004043	3300014968	Bacteria	12507
302	Ga0157379_10012385	3300014968	Bacteria	7451
303	Ga0157379_10016949	3300014968	Bacteria	6411
304	Ga0157376_10000828	3300014969	Bacteria	20258
305	Ga0157376_10010823	3300014969	Bacteria	6696
306	Ga0157376_10171722	3300014969	Bacteria	1975
307	Ga0157376_10430214	3300014969	Bacteria	1283
308	Ga0182006_1031798	3300015261	Bacteria	2125
309	Ga0182007_10024081	3300015262	Bacteria	2134
310	Ga0213876_10052947	3300021384	Unclassified	2144
311	Ga0224569_100077	3300022732	Bacteria	6487
312	Ga0224572_1011071	3300024225	Unclassified	1704
313	Ga0228598_1000336	3300024227	Bacteria	9229
314	Ga0228598_1000547	3300024227	Bacteria	7835
315	Ga0207656_10002834	3300025321	Bacteria	5901
316	Ga0207653_10003797	3300025885	Bacteria	4756
317	Ga0207692_10041557	3300025898	Bacteria	2277
318	Ga0207642_10006034	3300025899	Bacteria	4003
319	Ga0207688_10000700	3300025901	Bacteria	16539
320	Ga0207647_10023458	3300025904	Bacteria	4079
321	Ga0207647_10047873	3300025904	Bacteria	2657
322	Ga0207685_10003338	3300025905	Unclassified	3890
323	Ga0207685_10058486	3300025905	Bacteria	1517
324	Ga0207699_10006881	3300025906	Bacteria	5530
325	Ga0207699_10026055	3300025906	Bacteria	3218
326	Ga0207645_10000042	3300025907	Bacteria	85817
327	Ga0207643_10000133	3300025908	Bacteria	50506
328	Ga0207705_10043893	3300025909	Bacteria	3212
329	Ga0207684_10000283	3300025910	Bacteria	73904
330	Ga0207684_10000811	3300025910	Bacteria	36097
331	Ga0207684_10014264	3300025910	Bacteria	6855
332	Ga0207684_10041558	3300025910	Bacteria	3897
333	Ga0207684_10052933	3300025910	Bacteria	3446
334	Ga0207654_10005477	3300025911	Bacteria	6421
335	Ga0207654_10031517	3300025911	Unclassified	2921
336	Ga0207707_10000530	3300025912	Bacteria	39027
337	Ga0207707_10258101	3300025912	Bacteria	1513
338	Ga0207707_10306987	3300025912	Unclassified	1371
339	Ga0207695_10015836	3300025913	Bacteria	8857
340	Ga0207695_10019358	3300025913	Bacteria	7839
341	Ga0207695_10050057	3300025913	Bacteria	4398
342	Ga0207695_10163952	3300025913	Bacteria	2152
343	Ga0207671_10021740	3300025914	Bacteria	4862
344	Ga0207693_10000402	3300025915	Bacteria	39488
345	Ga0207693_10001029	3300025915	Bacteria	24949
346	Ga0207693_10001883	3300025915	Bacteria	18348
347	Ga0207693_10007259	3300025915	Bacteria	9118
348	Ga0207663_10001737	3300025916	Bacteria	10238
349	Ga0207663_10003723	3300025916	Bacteria	7510
350	Ga0207663_10239970	3300025916	Unclassified	1329
351	Ga0207660_10102066	3300025917	Bacteria	2144
352	Ga0207660_10192307	3300025917	Unclassified	1590
353	Ga0207660_10224879	3300025917	Bacteria	1474
354	Ga0207657_10000423	3300025919	Bacteria	44845
355	Ga0207657_10009169	3300025919	Bacteria	9980
356	Ga0207649_10000241	3300025920	Bacteria	44222
357	Ga0207652_10036319	3300025921	Unclassified	4166
358	Ga0207646_10000494	3300025922	Bacteria	52791
359	Ga0207646_10003114	3300025922	Bacteria	19045
360	Ga0207646_10099784	3300025922	Bacteria	2602
361	Ga0207681_10185559	3300025923	Bacteria	1587
362	Ga0207694_10000214	3300025924	Bacteria	56464
363	Ga0207694_10239327	3300025924	Bacteria	1483
364	Ga0207650_10000119	3300025925	Bacteria	104105
365	Ga0207650_10050835	3300025925	Bacteria	3066
366	Ga0207650_10153804	3300025925	Unclassified	1817
367	Ga0207687_10001365	3300025927	Bacteria	16702
368	Ga0207700_10006581	3300025928	Bacteria	7036
369	Ga0207700_10033796	3300025928	Bacteria	3663
370	Ga0207700_10065485	3300025928	Unclassified	2772
371	Ga0207700_10125165	3300025928	Unclassified	2090
372	Ga0207700_10137363	3300025928	Unclassified	2004
373	Ga0207700_10187800	3300025928	Bacteria	1735
374	Ga0207664_10000582	3300025929	Bacteria	25512
375	Ga0207664_10021691	3300025929	Unclassified	4783
376	Ga0207664_10465291	3300025929	Bacteria	1130
377	Ga0207690_10013956	3300025932	Bacteria	4841
378	Ga0207706_10000251	3300025933	Bacteria	58605
379	Ga0207706_10000389	3300025933	Bacteria	47573
380	Ga0207704_10386444	3300025938	Bacteria	1100
381	Ga0207665_10005107	3300025939	Bacteria	8765
382	Ga0207665_10036079	3300025939	Bacteria	3286
383	Ga0207665_10039098	3300025939	Unclassified	3161
384	Ga0207691_10000213	3300025940	Bacteria	56331
385	Ga0207711_10007197	3300025941	Bacteria	9326
386	Ga0207711_10035922	3300025941	Bacteria	4202
387	Ga0207689_10000322	3300025942	Bacteria	44503
388	Ga0207689_10016777	3300025942	Bacteria	6199
389	Ga0207661_10000689	3300025944	Bacteria	21915
390	Ga0207661_10082506	3300025944	Bacteria	2658
391	Ga0207661_10223391	3300025944	Bacteria	1665
392	Ga0207679_10000084	3300025945	Bacteria	82946
393	Ga0207679_10026810	3300025945	Bacteria	3978
394	Ga0207679_10085102	3300025945	Bacteria	2428
395	Ga0207667_10003515	3300025949	Bacteria	19377
396	Ga0207667_10004265	3300025949	Bacteria	17547
397	Ga0207667_10023827	3300025949	Bacteria	6737
398	Ga0207667_10213148	3300025949	Unclassified	1979
399	Ga0207651_10015128	3300025960	Bacteria	4474
400	Ga0207712_10496465	3300025961	Bacteria	1043
401	Ga0207640_10003201	3300025981	Bacteria	8816
402	Ga0207640_10058193	3300025981	Bacteria	2545
403	Ga0207640_10062407	3300025981	Unclassified	2472
404	Ga0207677_10004439	3300026023	Bacteria	7534
405	Ga0207677_10023391	3300026023	Bacteria	3816
406	Ga0207677_10229892	3300026023	Bacteria	1493
407	Ga0207703_10007594	3300026035	Bacteria	8598
408	Ga0207703_10025321	3300026035	Unclassified	4667
409	Ga0207703_10115041	3300026035	Bacteria	2301
410	Ga0207639_10037422	3300026041	Bacteria	3603
411	Ga0207639_10067490	3300026041	Bacteria	2783
412	Ga0207639_10101763	3300026041	Unclassified	2324
413	Ga0207678_10000070	3300026067	Bacteria	81153
414	Ga0207678_10003306	3300026067	Bacteria	14534
415	Ga0207702_10000144	3300026078	Bacteria	84274
416	Ga0207702_10001499	3300026078	Bacteria	23079
417	Ga0207702_10001741	3300026078	Bacteria	21398
418	Ga0207702_10149630	3300026078	Bacteria	2122
419	Ga0207641_10000006	3300026088	Bacteria	442569
420	Ga0207641_10008216	3300026088	Bacteria	8624
421	Ga0207641_10131961	3300026088	Unclassified	2244
422	Ga0207648_10000108	3300026089	Bacteria	80690
423	Ga0207648_10099038	3300026089	Bacteria	2553
424	Ga0207676_10000132	3300026095	Bacteria	65936
425	Ga0207676_10041094	3300026095	Bacteria	3547
426	Ga0207674_10000502	3300026116	Bacteria	51641
427	Ga0207674_10000556	3300026116	Bacteria	48859
428	Ga0207674_10020472	3300026116	Bacteria	7147
429	Ga0207674_10034852	3300026116	Bacteria	5256
430	Ga0207675_100001966	3300026118	Bacteria	20492
431	Ga0207675_100081946	3300026118	Bacteria	3025
432	Ga0207683_10000811	3300026121	Bacteria	28611
433	Ga0207683_10026989	3300026121	Unclassified	4962
434	Ga0207698_10006245	3300026142	Bacteria	7419
435	Ga0207698_10304032	3300026142	Bacteria	1486
436	Ga0265356_1002287	3300028017	Bacteria	2589
437	Ga0268266_10011297	3300028379	Bacteria	7772
438	Ga0268266_10032181	3300028379	Bacteria	4456
439	Ga0268265_10043058	3300028380	Bacteria	3353
440	Ga0268265_10099542	3300028380	Bacteria	2344
441	Ga0268264_10003401	3300028381	Bacteria	13737
442	Ga0268264_10014616	3300028381	Bacteria	6450
443	Ga0268264_10123067	3300028381	Bacteria	2289
444	Ga0268264_10181548	3300028381	Bacteria	1912
445	Ga0265338_10067058	3300028800	Bacteria	3102
446	Ga0265762_1000261	3300030760	Bacteria	8744
447	Ga0265762_1002076	3300030760	Unclassified	3649
448	Ga0265762_1006370	3300030760	Bacteria	2109
449	Ga0265762_1010142	3300030760	Bacteria	1683
450	Ga0265762_1011616	3300030760	Unclassified	1574
451	Ga0265770_1004336	3300030878	Unclassified	1935
452	Ga0265761_100320	3300030889	Viruses	1797
453	Ga0265760_10001017	3300031090	Bacteria	8132
454	Ga0265760_10001358	3300031090	Bacteria	7178
455	Ga0265760_10006199	3300031090	Bacteria	3419
456	Ga0373926_0000584	3300035083	Bacteria	9830
457	Ga0373926_0059627	3300035083	Bacteria	1389
458	Ga0373934_0001131	3300035086	Bacteria	9698
459	Ga0373934_0014486	3300035086	Bacteria	2989
460	Ga0373923_0028089	3300035111	Unclassified	2248
461	Ga0373936_0000757	3300035113	Bacteria	11340
462	Ga0373945_0002651	3300035116	Bacteria	5607
463	Ga0373953_0040562	3300035117	Bacteria	1849
464	Ga0373953_0050400	3300035117	Bacteria	1681
465	Ga0373956_0006005	3300035119	Unclassified	4860
466	Ga0373957_0002064	3300035120	Bacteria	5634
467	Ga0373957_0030734	3300035120	Bacteria	1969
468	Ga0373943_0000046	3300035170	Bacteria	41661
469	Ga0373943_0096226	3300035170	Bacteria	1541
470	Ga0373946_0010682	3300035171	Unclassified	3406
471	Ga0373955_0002394	3300035172	Bacteria	8173
472	Ga0373961_0024367	3300035241	Unclassified	1637
473	Ga0373924_0010498	3300035410	Bacteria	3417
474	Ga0373931_0022921	3300035691	Bacteria	3147
475	Ga0373931_0128137	3300035691	Bacteria	1458
476	Ga0373935_0006013	3300035692	Bacteria	7207
477	Ga0373935_0072852	3300035692	Bacteria	2218
478	Ga0373935_0179098	3300035692	Bacteria	1454
479	Ga0373927_0000203	3300035695	Bacteria	47593
480	Ga0373927_0000292	3300035695	Bacteria	39594
481	Ga0373927_0061365	3300035695	Bacteria	2432
482	Ga0373927_0218050	3300035695	Unclassified	1253
483	Ga0373933_0014017	3300035724	Bacteria	4449
484	Ga0373933_0025778	3300035724	Unclassified	3374
485	Ga0373947_0004351	3300035725	Bacteria	8310
486	Ga0373947_0014578	3300035725	Bacteria	4509
487	Ga0373947_0048064	3300035725	Bacteria	2559
488	Ga0373947_0231075	3300035725	Bacteria	1218
489	Ga0373937_0002199	3300036401	Bacteria	16293
490	Ga0373937_0063697	3300036401	Bacteria	3391
491	Ga0373937_0121739	3300036401	Unclassified	2432
492	Ga0373937_0142459	3300036401	Bacteria	2243
493	Ga0373925_0000172	3300037068	Bacteria	70000
494	Ga0373925_0001535	3300037068	Bacteria	19685
495	Ga0373925_0001989	3300037068	Bacteria	16928
496	Ga0373925_0106025	3300037068	Bacteria	2166
497	Ga0373925_0133429	3300037068	Bacteria	1938
498	Ga0373925_0178862	3300037068	Unclassified	1678
499	Ga0436365_1065032	3300039437	Unclassified	3935
500	Ga0436362_0978732	3300039453	Plasmid	4061
501	Ga0466964_0048937	3300044706	Bacteria	1730
502	Ga0451576_0150440	3300045051	Unclassified	2428
503	Ga0466958_0083590	3300045836	Bacteria	1968
504	Ga0495592_0110798	3300046454	Bacteria	1943
505	Ga0495603_0003611	3300046455	Bacteria	9198
506	Ga0495629_0037082	3300046459	Bacteria	3436
507	Ga0495629_0059867	3300046459	Unclassified	2662
508	Ga0495651_0030425	3300046462	Unclassified	4210
509	Ga0495653_0241478	3300046463	Unclassified	1204
510	Ga0495580_0011550	3300046472	Bacteria	6831
511	Ga0495580_0014783	3300046472	Bacteria	5914
512	Ga0495580_0034055	3300046472	Bacteria	3668
513	Ga0495580_0096266	3300046472	Bacteria	2058
514	Ga0495580_0126797	3300046472	Unclassified	1771
515	Ga0495580_0142488	3300046472	Bacteria	1661
516	Ga0495582_0001740	3300046473	Bacteria	12286
517	Ga0495582_0005189	3300046473	Bacteria	7286
518	Ga0495582_0021687	3300046473	Unclassified	3514
519	Ga0495582_0107611	3300046473	Unclassified	1565
520	Ga0495639_0005165	3300046475	Bacteria	5608
521	Ga0495664_0016170	3300046477	Bacteria	4249
522	Ga0495608_0047771	3300046511	Bacteria	2844
523	Ga0495608_0311370	3300046511	Unclassified	974
524	Ga0495618_0140824	3300046514	Bacteria	1543
525	Ga0495628_0010822	3300046516	Bacteria	7724
526	Ga0495628_0034128	3300046516	Bacteria	4096
527	Ga0495630_0099137	3300046517	Bacteria	2204
528	Ga0495652_0188329	3300046529	Unclassified	1577
529	Ga0495587_0009760	3300046536	Bacteria	6135
530	Ga0495667_0248811	3300046559	Unclassified	1131
531	Ga0495635_0295160	3300046663	Unclassified	1087
532	Ga0495599_0285598	3300046678	Unclassified	998
533	Ga0495623_0023541	3300046679	Unclassified	3975
534	Ga0495658_0016851	3300046683	Bacteria	3765
535	Ga0495624_0064686	3300046690	Bacteria	2286
536	Ga0495624_0136983	3300046690	Unclassified	1500
537	Ga0495600_0121372	3300046809	Unclassified	1699
538	Ga0495581_0028000	3300047315	Bacteria	3267
539	Ga0495581_0096250	3300047315	Unclassified	1719
540	Ga0495581_0224395	3300047315	Unclassified	1099
541	Ga0495604_0001581	3300047317	Bacteria	18770
542	Ga0495604_0246601	3300047317	Unclassified	1219
543	Ga0495674_0019864	3300047319	Bacteria	6227
544	Ga0495674_0338359	3300047319	Unclassified	1223
545	Ga0495676_0025129	3300047321	Bacteria	5146
546	Ga0495680_0042887	3300047322	Unclassified	3586
547	Ga0495684_0259516	3300047471	Unclassified	1261
548	Ga0495602_0034127	3300048088	Bacteria	4764
549	Ga0495602_0183392	3300048088	Bacteria	1612
550	Ga0495614_0015676	3300048089	Bacteria	3302
551	Ga0496100_0003791	3300048903	Bacteria	7916
552	Ga0496101_0172915	3300048904	Unclassified	1661
553	Ga0496102_0007919	3300048905	Bacteria	9083
554	Ga0496102_0045931	3300048905	Bacteria	3966
555	Ga0496102_0075266	3300048905	Bacteria	3104
556	Ga0496102_0089871	3300048905	Bacteria	2842
557	Ga0496102_0221838	3300048905	Bacteria	1782
558	Ga0496102_0269329	3300048905	Unclassified	1606
559	Ga0496102_0498548	3300048905	Unclassified	1140
560	Ga0496103_0001229	3300048906	Bacteria	17563
561	Ga0496103_0092564	3300048906	Bacteria	1908
562	Ga0496103_0224781	3300048906	Bacteria	1207
563	Ga0496104_0017560	3300048907	Bacteria	6519
564	Ga0496104_0117427	3300048907	Bacteria	2553
565	Ga0496105_0160660	3300048908	Bacteria	1845
566	Ga0496107_0025859	3300048910	Bacteria	4159
567	Ga0496107_0196055	3300048910	Bacteria	1501
568	Ga0496108_0000495	3300048911	Bacteria	31371
569	Ga0496109_0000149	3300048912	Bacteria	68979
570	Ga0496110_0001488	3300048913	Bacteria	16972
571	Ga0496111_0041957	3300048914	Bacteria	3284
572	Ga0496112_0000163	3300048915	Bacteria	42332
573	Ga0496112_0034686	3300048915	Bacteria	4911
574	Ga0496112_0037132	3300048915	Bacteria	4756
575	Ga0496112_0461197	3300048915	Bacteria	1208
576	Ga0496113_0000189	3300048916	Bacteria	27944
577	Ga0496113_0241607	3300048916	Bacteria	1441
578	Ga0496114_0025076	3300048917	Unclassified	4871
579	Ga0496114_0514879	3300048917	Unclassified	1058
580	Ga0496115_0007315	3300048918	Bacteria	8120
581	Ga0496115_0066801	3300048918	Bacteria	2907
582	nmdc:mga0n895_510_c1	3300050512	Bacteria	26386
583	nmdc:mga0n895_514_c1	3300050512	Bacteria	26317
584	nmdc:mga0rr50_364363_c1	3300050513	Unclassified	1217
585	nmdc:mga0rr50_38730_c1	3300050513	Bacteria	3452
586	nmdc:mga0rr50_7484_c1	3300050513	Bacteria	6739
587	nmdc:mga08x19_108519_c1	3300050514	Bacteria	1849
588	nmdc:mga08x19_311274_c1	3300050514	Bacteria	1095
589	nmdc:mga08x19_3595_c1	3300050514	Bacteria	9226
590	nmdc:mga08x19_5030_c1	3300050514	Bacteria	7820
591	nmdc:mga08x19_51628_c1	3300050514	Bacteria	2642
592	nmdc:mga08x19_6727_c1	3300050514	Bacteria	6824
593	nmdc:mga08x19_6881_c1	3300050514	Bacteria	6751
594	nmdc:mga08x19_77461_c1	3300050514	Bacteria	2177
595	nmdc:mga0a205_1302_c2	3300050515	Bacteria	11472
596	nmdc:mga0a205_35680_c1	3300050515	Bacteria	4775
597	Ga0495601_0299259	3300053077	Unclassified	1048
598	Ga0495619_0019389	3300053085	Bacteria	4323
599	Ga0495619_0066892	3300053085	Bacteria	2399

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300046529	Ga0495652_0188329	Ga0495652_0188329_41_841	266
2	3300046559	Ga0495667_0248811	Ga0495667_0248811_25_825	266
3	3300025939	Ga0207665_10036079	Ga0207665_100360792	270
4	3300028017	Ga0265356_1002287	Ga0265356_10022872	286
5	3300030760	Ga0265762_1002076	Ga0265762_10020761	286
6	3300006028	Ga0070717_10017100	Ga0070717_100171002	287
7	3300022732	Ga0224569_100077	Ga0224569_1000775	288
8	3300030760	Ga0265762_1010142	Ga0265762_10101422	289
9	3300005467	Ga0070706_100203806	Ga0070706_1002038061	291
10	3300005468	Ga0070707_100009656	Ga0070707_1000096564	291
11	3300005518	Ga0070699_100038400	Ga0070699_1000384004	291
12	3300006028	Ga0070717_10037070	Ga0070717_100370704	291
13	3300025910	Ga0207684_10041558	Ga0207684_100415582	291
14	3300031090	Ga0265760_10006199	Ga0265760_100061992	291
15	3300024225	Ga0224572_1011071	Ga0224572_10110711	294
16	3300045051	Ga0451576_0150440	Ga0451576_0150440_15_899	294
17	3300031090	Ga0265760_10001017	Ga0265760_100010175	295
18	3300006028	Ga0070717_10019930	Ga0070717_100199305	297
19	3300007265	Ga0099794_10025781	Ga0099794_100257811	298
20	3300005435	Ga0070714_100061969	Ga0070714_1000619691	299
21	3300006914	Ga0075436_100012762	Ga0075436_1000127626	300
22	3300006914	Ga0075436_100015655	Ga0075436_1000156556	300
23	3300007265	Ga0099794_10000577	Ga0099794_1000057711	300
24	3300007265	Ga0099794_10005853	Ga0099794_100058532	300
25	3300007265	Ga0099794_10037438	Ga0099794_100374382	300
26	3300030889	Ga0265761_100320	Ga0265761_1003202	300
27	3300035083	Ga0373926_0000584	Ga0373926_0000584_4975_5877	300
28	3300035695	Ga0373927_0000203	Ga0373927_0000203_5252_6154	300
29	3300035725	Ga0373947_0048064	Ga0373947_0048064_606_1508	300
30	3300037068	Ga0373925_0000172	Ga0373925_0000172_7744_8646	300
31	3300046690	Ga0495624_0064686	Ga0495624_0064686_930_1832	300
32	3300050514	nmdc:mga08x19_51628_c1	nmdc:mga08x19_51628_c1_1054_1956	300
33	3300005434	Ga0070709_10049605	Ga0070709_100496052	301
34	3300005435	Ga0070714_100000074	Ga0070714_1000000747	301
35	3300005436	Ga0070713_100007877	Ga0070713_1000078776	301
36	3300005437	Ga0070710_10003782	Ga0070710_100037824	301
37	3300005437	Ga0070710_10115998	Ga0070710_101159982	301
38	3300005439	Ga0070711_100000531	Ga0070711_1000005319	301
39	3300006028	Ga0070717_10003539	Ga0070717_100035394	301
40	3300006163	Ga0070715_10010989	Ga0070715_100109891	301
41	3300006163	Ga0070715_10011527	Ga0070715_100115272	301
42	3300006175	Ga0070712_100031170	Ga0070712_1000311702	301
43	3300021384	Ga0213876_10052947	Ga0213876_100529472	301
44	3300025905	Ga0207685_10058486	Ga0207685_100584862	301
45	3300025915	Ga0207693_10001029	Ga0207693_100010298	301
46	3300025916	Ga0207663_10003723	Ga0207663_100037237	301
47	3300025928	Ga0207700_10006581	Ga0207700_100065818	301
48	3300025929	Ga0207664_10000582	Ga0207664_100005828	301
49	3300030878	Ga0265770_1004336	Ga0265770_10043361	301
50	3300035083	Ga0373926_0059627	Ga0373926_0059627_198_1121	301
51	3300035086	Ga0373934_0001131	Ga0373934_0001131_2560_3465	301
52	3300035086	Ga0373934_0014486	Ga0373934_0014486_591_1514	301
53	3300035111	Ga0373923_0028089	Ga0373923_0028089_588_1511	301
54	3300035113	Ga0373936_0000757	Ga0373936_0000757_1328_2251	301
55	3300035116	Ga0373945_0002651	Ga0373945_0002651_1973_2893	301
56	3300035117	Ga0373953_0040562	Ga0373953_0040562_43_966	301
57	3300035117	Ga0373953_0050400	Ga0373953_0050400_401_1306	301
58	3300035119	Ga0373956_0006005	Ga0373956_0006005_1872_2777	301
59	3300035120	Ga0373957_0002064	Ga0373957_0002064_2046_2951	301
60	3300035120	Ga0373957_0030734	Ga0373957_0030734_1004_1927	301
61	3300035170	Ga0373943_0000046	Ga0373943_0000046_36625_37548	301
62	3300035171	Ga0373946_0010682	Ga0373946_0010682_761_1684	301
63	3300035172	Ga0373955_0002394	Ga0373955_0002394_1391_2296	301
64	3300035410	Ga0373924_0010498	Ga0373924_0010498_749_1672	301
65	3300035692	Ga0373935_0006013	Ga0373935_0006013_6202_7125	301
66	3300035692	Ga0373935_0072852	Ga0373935_0072852_33_953	301
67	3300035695	Ga0373927_0000292	Ga0373927_0000292_26003_26926	301
68	3300035695	Ga0373927_0218050	Ga0373927_0218050_29_949	301
69	3300035724	Ga0373933_0014017	Ga0373933_0014017_2044_2967	301
70	3300035724	Ga0373933_0025778	Ga0373933_0025778_2233_3138	301
71	3300035725	Ga0373947_0004351	Ga0373947_0004351_2693_3616	301
72	3300036401	Ga0373937_0002199	Ga0373937_0002199_2837_3742	301
73	3300036401	Ga0373937_0063697	Ga0373937_0063697_1689_2612	301
74	3300036401	Ga0373937_0121739	Ga0373937_0121739_797_1702	301
75	3300036401	Ga0373937_0142459	Ga0373937_0142459_203_1108	301
76	3300037068	Ga0373925_0001535	Ga0373925_0001535_12550_13473	301
77	3300039437	Ga0436365_1065032	Ga0436365_1065032_1114_2019	301
78	3300046454	Ga0495592_0110798	Ga0495592_0110798_532_1437	301
79	3300046459	Ga0495629_0037082	Ga0495629_0037082_1279_2199	301
80	3300046462	Ga0495651_0030425	Ga0495651_0030425_3185_4090	301
81	3300046472	Ga0495580_0011550	Ga0495580_0011550_537_1457	301
82	3300046473	Ga0495582_0021687	Ga0495582_0021687_1987_2907	301
83	3300046477	Ga0495664_0016170	Ga0495664_0016170_2237_3160	301
84	3300046511	Ga0495608_0047771	Ga0495608_0047771_107_1012	301
85	3300046511	Ga0495608_0311370	Ga0495608_0311370_31_954	301
86	3300046514	Ga0495618_0140824	Ga0495618_0140824_490_1395	301
87	3300046516	Ga0495628_0010822	Ga0495628_0010822_3813_4718	301
88	3300046516	Ga0495628_0034128	Ga0495628_0034128_1276_2181	301
89	3300046536	Ga0495587_0009760	Ga0495587_0009760_5138_6043	301
90	3300046663	Ga0495635_0295160	Ga0495635_0295160_125_1030	301
91	3300046678	Ga0495599_0285598	Ga0495599_0285598_71_976	301
92	3300046679	Ga0495623_0023541	Ga0495623_0023541_380_1285	301
93	3300046690	Ga0495624_0136983	Ga0495624_0136983_366_1289	301
94	3300046809	Ga0495600_0121372	Ga0495600_0121372_148_1053	301
95	3300047315	Ga0495581_0224395	Ga0495581_0224395_140_1060	301
96	3300047317	Ga0495604_0001581	Ga0495604_0001581_8001_8906	301
97	3300047317	Ga0495604_0246601	Ga0495604_0246601_167_1072	301
98	3300047319	Ga0495674_0019864	Ga0495674_0019864_3879_4802	301
99	3300047322	Ga0495680_0042887	Ga0495680_0042887_1627_2532	301
100	3300048088	Ga0495602_0034127	Ga0495602_0034127_2979_3884	301
101	3300048088	Ga0495602_0183392	Ga0495602_0183392_599_1504	301
102	3300048917	Ga0496114_0514879	Ga0496114_0514879_25_945	301
103	3300048918	Ga0496115_0007315	Ga0496115_0007315_5124_6044	301
104	3300053077	Ga0495601_0299259	Ga0495601_0299259_24_944	301
105	3300053085	Ga0495619_0019389	Ga0495619_0019389_3403_4308	301
106	3300005329	Ga0070683_100020893	Ga0070683_1000208936	302
107	3300005331	Ga0070670_100007241	Ga0070670_1000072416	302
108	3300005336	Ga0070680_100084520	Ga0070680_1000845201	302
109	3300005406	Ga0070703_10004797	Ga0070703_100047972	302
110	3300005440	Ga0070705_100002589	Ga0070705_1000025898	302
111	3300005444	Ga0070694_100012321	Ga0070694_1000123215	302
112	3300005445	Ga0070708_100000598	Ga0070708_10000059820	302
113	3300005467	Ga0070706_100009361	Ga0070706_1000093615	302
114	3300005530	Ga0070679_100053541	Ga0070679_1000535413	302
115	3300005536	Ga0070697_100024273	Ga0070697_1000242732	302
116	3300005546	Ga0070696_100002816	Ga0070696_1000028169	302
117	3300005547	Ga0070693_100000105	Ga0070693_10000010510	302
118	3300005563	Ga0068855_100180576	Ga0068855_1001805762	302
119	3300006175	Ga0070712_100006642	Ga0070712_1000066425	302
120	3300006358	Ga0068871_100044631	Ga0068871_1000446313	302
121	3300013307	Ga0157372_10021571	Ga0157372_100215713	302
122	3300014969	Ga0157376_10000828	Ga0157376_100008285	302
123	3300025885	Ga0207653_10003797	Ga0207653_100037972	302
124	3300025910	Ga0207684_10052933	Ga0207684_100529334	302
125	3300025912	Ga0207707_10306987	Ga0207707_103069872	302
126	3300025915	Ga0207693_10007259	Ga0207693_100072593	302
127	3300025917	Ga0207660_10192307	Ga0207660_101923071	302
128	3300025921	Ga0207652_10036319	Ga0207652_100363193	302
129	3300025949	Ga0207667_10213148	Ga0207667_102131482	302
130	3300028800	Ga0265338_10067058	Ga0265338_100670582	302
131	3300037068	Ga0373925_0133429	Ga0373925_0133429_308_1216	302
132	3300037068	Ga0373925_0178862	Ga0373925_0178862_118_1026	302
133	3300046455	Ga0495603_0003611	Ga0495603_0003611_3706_4614	302
134	3300046459	Ga0495629_0059867	Ga0495629_0059867_341_1249	302
135	3300046463	Ga0495653_0241478	Ga0495653_0241478_190_1098	302
136	3300046472	Ga0495580_0034055	Ga0495580_0034055_1949_2857	302
137	3300046473	Ga0495582_0005189	Ga0495582_0005189_651_1559	302
138	3300046475	Ga0495639_0005165	Ga0495639_0005165_2353_3261	302
139	3300046517	Ga0495630_0099137	Ga0495630_0099137_342_1250	302
140	3300046683	Ga0495658_0016851	Ga0495658_0016851_2456_3364	302
141	3300047315	Ga0495581_0028000	Ga0495581_0028000_83_991	302
142	3300047319	Ga0495674_0338359	Ga0495674_0338359_173_1102	302
143	3300047321	Ga0495676_0025129	Ga0495676_0025129_277_1185	302
144	3300047471	Ga0495684_0259516	Ga0495684_0259516_178_1086	302
145	3300048089	Ga0495614_0015676	Ga0495614_0015676_1278_2186	302
146	3300048917	Ga0496114_0025076	Ga0496114_0025076_3795_4703	302
147	3300005436	Ga0070713_100037904	Ga0070713_1000379044	303
148	3300005547	Ga0070693_100052302	Ga0070693_1000523022	303
149	3300007265	Ga0099794_10088380	Ga0099794_100883802	303
150	3300007788	Ga0099795_10039618	Ga0099795_100396182	303
151	3300005445	Ga0070708_100000137	Ga0070708_10000013748	306
152	3300005467	Ga0070706_100016580	Ga0070706_1000165802	306
153	3300005468	Ga0070707_100000651	Ga0070707_10000065129	306
154	3300005471	Ga0070698_100000902	Ga0070698_10000090225	306
155	3300005518	Ga0070699_100000439	Ga0070699_10000043931	306
156	3300005536	Ga0070697_100000265	Ga0070697_10000026518	306
157	3300007788	Ga0099795_10038282	Ga0099795_100382822	306
158	3300025910	Ga0207684_10000811	Ga0207684_1000081121	306
159	3300025922	Ga0207646_10000494	Ga0207646_1000049431	306
160	3300030760	Ga0265762_1000261	Ga0265762_10002617	306
161	3300000546	LJNas_1000240	LJNas_10002404	307
162	3300005329	Ga0070683_100072474	Ga0070683_1000724741	307
163	3300005331	Ga0070670_100067638	Ga0070670_1000676383	307
164	3300005336	Ga0070680_100067302	Ga0070680_1000673022	307
165	3300005338	Ga0068868_100008075	Ga0068868_1000080753	307
166	3300005338	Ga0068868_100010737	Ga0068868_1000107376	307
167	3300005344	Ga0070661_100156408	Ga0070661_1001564081	307
168	3300005434	Ga0070709_10020545	Ga0070709_100205452	307
169	3300005435	Ga0070714_100012653	Ga0070714_1000126533	307
170	3300005435	Ga0070714_100042711	Ga0070714_1000427113	307
171	3300005435	Ga0070714_100119581	Ga0070714_1001195813	307
172	3300005436	Ga0070713_100139622	Ga0070713_1001396222	307
173	3300005436	Ga0070713_100434589	Ga0070713_1004345891	307
174	3300005439	Ga0070711_100422777	Ga0070711_1004227771	307
175	3300005458	Ga0070681_10000113	Ga0070681_100001137	307
176	3300005458	Ga0070681_10014011	Ga0070681_100140114	307
177	3300005458	Ga0070681_10321558	Ga0070681_103215582	307
178	3300005466	Ga0070685_10086270	Ga0070685_100862702	307
179	3300005518	Ga0070699_100083091	Ga0070699_1000830913	307
180	3300005530	Ga0070679_100008386	Ga0070679_1000083864	307
181	3300005530	Ga0070679_100208352	Ga0070679_1002083522	307
182	3300005535	Ga0070684_100092922	Ga0070684_1000929221	307
183	3300005535	Ga0070684_100387666	Ga0070684_1003876662	307
184	3300005536	Ga0070697_100000113	Ga0070697_10000011352	307
185	3300005539	Ga0068853_100205582	Ga0068853_1002055822	307
186	3300005539	Ga0068853_100292897	Ga0068853_1002928971	307
187	3300005547	Ga0070693_100018297	Ga0070693_1000182972	307
188	3300005547	Ga0070693_100020826	Ga0070693_1000208263	307
189	3300005563	Ga0068855_100006228	Ga0068855_1000062286	307
190	3300005563	Ga0068855_100006821	Ga0068855_1000068216	307
191	3300005563	Ga0068855_100026793	Ga0068855_1000267933	307
192	3300005563	Ga0068855_100041923	Ga0068855_1000419235	307
193	3300005563	Ga0068855_100077769	Ga0068855_1000777691	307
194	3300005564	Ga0070664_100000942	Ga0070664_10000094213	307
195	3300005577	Ga0068857_100013822	Ga0068857_1000138224	307
196	3300005577	Ga0068857_100015816	Ga0068857_1000158166	307
197	3300005578	Ga0068854_100010678	Ga0068854_1000106781	307
198	3300005614	Ga0068856_100000320	Ga0068856_10000032044	307
199	3300005614	Ga0068856_100003923	Ga0068856_1000039236	307
200	3300005614	Ga0068856_100012860	Ga0068856_1000128603	307
201	3300005614	Ga0068856_100033640	Ga0068856_1000336405	307
202	3300005614	Ga0068856_100095990	Ga0068856_1000959902	307
203	3300005614	Ga0068856_100151737	Ga0068856_1001517373	307
204	3300005615	Ga0070702_100101432	Ga0070702_1001014322	307
205	3300005616	Ga0068852_100121514	Ga0068852_1001215143	307
206	3300005618	Ga0068864_100018410	Ga0068864_1000184104	307
207	3300005718	Ga0068866_10016363	Ga0068866_100163632	307
208	3300005834	Ga0068851_10129996	Ga0068851_101299962	307
209	3300005841	Ga0068863_100007165	Ga0068863_1000071655	307
210	3300005841	Ga0068863_100012874	Ga0068863_1000128744	307
211	3300005842	Ga0068858_100007558	Ga0068858_1000075586	307
212	3300005842	Ga0068858_100024970	Ga0068858_1000249706	307
213	3300005843	Ga0068860_100039164	Ga0068860_1000391644	307
214	3300005843	Ga0068860_100175688	Ga0068860_1001756883	307
215	3300006028	Ga0070717_10047018	Ga0070717_100470184	307
216	3300006028	Ga0070717_10075989	Ga0070717_100759891	307
217	3300006237	Ga0097621_100000243	Ga0097621_10000024327	307
218	3300006237	Ga0097621_100002887	Ga0097621_1000028877	307
219	3300006237	Ga0097621_100182610	Ga0097621_1001826102	307
220	3300006358	Ga0068871_100000207	Ga0068871_10000020710	307
221	3300006358	Ga0068871_100001769	Ga0068871_1000017697	307
222	3300006852	Ga0075433_10033760	Ga0075433_100337603	307
223	3300006871	Ga0075434_100002915	Ga0075434_10000291517	307
224	3300006881	Ga0068865_100030528	Ga0068865_1000305282	307
225	3300006914	Ga0075436_100285256	Ga0075436_1002852561	307
226	3300007076	Ga0075435_100034994	Ga0075435_1000349942	307
227	3300009093	Ga0105240_10041047	Ga0105240_100410477	307
228	3300009093	Ga0105240_10042960	Ga0105240_100429601	307
229	3300009093	Ga0105240_10047697	Ga0105240_100476974	307
230	3300009093	Ga0105240_10068023	Ga0105240_100680233	307
231	3300009093	Ga0105240_10138622	Ga0105240_101386222	307
232	3300009174	Ga0105241_10024343	Ga0105241_100243433	307
233	3300009177	Ga0105248_10001179	Ga0105248_100011795	307
234	3300009545	Ga0105237_10004926	Ga0105237_100049264	307
235	3300009545	Ga0105237_10089155	Ga0105237_100891552	307
236	3300009545	Ga0105237_10282470	Ga0105237_102824702	307
237	3300009551	Ga0105238_10003878	Ga0105238_100038787	307
238	3300009551	Ga0105238_10007126	Ga0105238_100071267	307
239	3300009551	Ga0105238_10193920	Ga0105238_101939203	307
240	3300010375	Ga0105239_10045709	Ga0105239_100457094	307
241	3300013100	Ga0157373_10056110	Ga0157373_100561102	307
242	3300013100	Ga0157373_10132669	Ga0157373_101326692	307
243	3300013104	Ga0157370_10008092	Ga0157370_100080927	307
244	3300013105	Ga0157369_10000481	Ga0157369_100004817	307
245	3300013105	Ga0157369_10032125	Ga0157369_100321253	307
246	3300013105	Ga0157369_10156475	Ga0157369_101564751	307
247	3300013105	Ga0157369_10263890	Ga0157369_102638902	307
248	3300013296	Ga0157374_10001617	Ga0157374_100016179	307
249	3300013296	Ga0157374_10002231	Ga0157374_100022318	307
250	3300013296	Ga0157374_10002669	Ga0157374_100026696	307
251	3300013297	Ga0157378_10000062	Ga0157378_1000006235	307
252	3300013297	Ga0157378_10002136	Ga0157378_100021369	307
253	3300013297	Ga0157378_10005302	Ga0157378_100053027	307
254	3300013307	Ga0157372_10000756	Ga0157372_1000075625	307
255	3300013307	Ga0157372_10002367	Ga0157372_100023675	307
256	3300013307	Ga0157372_10002657	Ga0157372_100026576	307
257	3300013307	Ga0157372_10042975	Ga0157372_100429752	307
258	3300013307	Ga0157372_10051189	Ga0157372_100511891	307
259	3300013307	Ga0157372_10123959	Ga0157372_101239591	307
260	3300013307	Ga0157372_10456298	Ga0157372_104562982	307
261	3300013307	Ga0157372_10971379	Ga0157372_109713791	307
262	3300013308	Ga0157375_10373421	Ga0157375_103734212	307
263	3300014969	Ga0157376_10010823	Ga0157376_100108235	307
264	3300024227	Ga0228598_1000336	Ga0228598_10003363	307
265	3300025899	Ga0207642_10006034	Ga0207642_100060343	307
266	3300025904	Ga0207647_10047873	Ga0207647_100478732	307
267	3300025912	Ga0207707_10000530	Ga0207707_100005303	307
268	3300025912	Ga0207707_10258101	Ga0207707_102581011	307
269	3300025913	Ga0207695_10015836	Ga0207695_100158363	307
270	3300025913	Ga0207695_10019358	Ga0207695_100193587	307
271	3300025913	Ga0207695_10163952	Ga0207695_101639524	307
272	3300025914	Ga0207671_10021740	Ga0207671_100217402	307
273	3300025916	Ga0207663_10239970	Ga0207663_102399701	307
274	3300025917	Ga0207660_10102066	Ga0207660_101020662	307
275	3300025924	Ga0207694_10000214	Ga0207694_1000021439	307
276	3300025924	Ga0207694_10239327	Ga0207694_102393271	307
277	3300025925	Ga0207650_10050835	Ga0207650_100508352	307
278	3300025928	Ga0207700_10125165	Ga0207700_101251651	307
279	3300025928	Ga0207700_10137363	Ga0207700_101373633	307
280	3300025928	Ga0207700_10187800	Ga0207700_101878002	307
281	3300025929	Ga0207664_10021691	Ga0207664_100216913	307
282	3300025941	Ga0207711_10035922	Ga0207711_100359221	307
283	3300025944	Ga0207661_10223391	Ga0207661_102233912	307
284	3300025945	Ga0207679_10085102	Ga0207679_100851023	307
285	3300025949	Ga0207667_10004265	Ga0207667_100042657	307
286	3300025949	Ga0207667_10023827	Ga0207667_100238276	307
287	3300025981	Ga0207640_10003201	Ga0207640_100032017	307
288	3300025981	Ga0207640_10062407	Ga0207640_100624072	307
289	3300026023	Ga0207677_10023391	Ga0207677_100233913	307
290	3300026035	Ga0207703_10007594	Ga0207703_100075945	307
291	3300026035	Ga0207703_10025321	Ga0207703_100253215	307
292	3300026035	Ga0207703_10115041	Ga0207703_101150412	307
293	3300026041	Ga0207639_10067490	Ga0207639_100674902	307
294	3300026041	Ga0207639_10101763	Ga0207639_101017633	307
295	3300026078	Ga0207702_10000144	Ga0207702_1000014413	307
296	3300026078	Ga0207702_10001499	Ga0207702_1000149917	307
297	3300026078	Ga0207702_10001741	Ga0207702_1000174113	307
298	3300026078	Ga0207702_10149630	Ga0207702_101496301	307
299	3300026088	Ga0207641_10008216	Ga0207641_100082163	307
300	3300026095	Ga0207676_10041094	Ga0207676_100410943	307
301	3300026116	Ga0207674_10000502	Ga0207674_1000050227	307
302	3300026116	Ga0207674_10020472	Ga0207674_100204726	307
303	3300028381	Ga0268264_10003401	Ga0268264_100034018	307
304	3300028381	Ga0268264_10123067	Ga0268264_101230673	307
305	3300031090	Ga0265760_10001358	Ga0265760_100013583	307
306	3300035691	Ga0373931_0128137	Ga0373931_0128137_108_1046	307
307	3300039453	Ga0436362_0978732	Ga0436362_0978732_1606_2547	307
308	3300044706	Ga0466964_0048937	Ga0466964_0048937_126_1055	307
309	3300045836	Ga0466958_0083590	Ga0466958_0083590_401_1330	307
310	3300048904	Ga0496101_0172915	Ga0496101_0172915_32_970	307
311	3300048905	Ga0496102_0221838	Ga0496102_0221838_327_1265	307
312	3300048906	Ga0496103_0224781	Ga0496103_0224781_82_1020	307
313	3300048907	Ga0496104_0017560	Ga0496104_0017560_3982_4920	307
314	3300048915	Ga0496112_0034686	Ga0496112_0034686_3813_4751	307
315	3300048915	Ga0496112_0037132	Ga0496112_0037132_3443_4381	307
316	3300048916	Ga0496113_0241607	Ga0496113_0241607_267_1208	307
317	3300050512	nmdc:mga0n895_510_c1	nmdc:mga0n895_510_c1_5982_6905	307
318	3300050513	nmdc:mga0rr50_38730_c1	nmdc:mga0rr50_38730_c1_89_1015	307
319	3300050514	nmdc:mga08x19_311274_c1	nmdc:mga08x19_311274_c1_56_985	307
320	3300050514	nmdc:mga08x19_6881_c1	nmdc:mga08x19_6881_c1_2819_3745	307
321	3300050515	nmdc:mga0a205_35680_c1	nmdc:mga0a205_35680_c1_1789_2712	307
322	2162886012	MBSR1b_contig_19785	MBSR1b_0799.00001080	308
323	2162886012	MBSR1b_contig_5659833	MBSR1b_0420.00007490	308
324	3300001976	JGI24752J21851_1000553	JGI24752J21851_10005536	308
325	3300001991	JGI24743J22301_10002354	JGI24743J22301_100023541	308
326	3300002459	JGI24751J29686_10003835	JGI24751J29686_100038352	308
327	3300005293	Ga0065715_10099407	Ga0065715_100994072	308
328	3300005293	Ga0065715_10136627	Ga0065715_101366272	308
329	3300005327	Ga0070658_10023861	Ga0070658_100238612	308
330	3300005328	Ga0070676_10016059	Ga0070676_100160592	308
331	3300005328	Ga0070676_10250111	Ga0070676_102501111	308
332	3300005329	Ga0070683_100019063	Ga0070683_1000190637	308
333	3300005330	Ga0070690_100092088	Ga0070690_1000920882	308
334	3300005330	Ga0070690_100119918	Ga0070690_1001199181	308
335	3300005331	Ga0070670_100115885	Ga0070670_1001158851	308
336	3300005331	Ga0070670_100146262	Ga0070670_1001462623	308
337	3300005333	Ga0070677_10011876	Ga0070677_100118764	308
338	3300005334	Ga0068869_100024771	Ga0068869_1000247713	308
339	3300005335	Ga0070666_10097744	Ga0070666_100977442	308
340	3300005337	Ga0070682_100013140	Ga0070682_1000131404	308
341	3300005338	Ga0068868_100002841	Ga0068868_1000028414	308
342	3300005338	Ga0068868_100173788	Ga0068868_1001737883	308
343	3300005339	Ga0070660_100127485	Ga0070660_1001274852	308
344	3300005341	Ga0070691_10034745	Ga0070691_100347452	308
345	3300005344	Ga0070661_100004534	Ga0070661_1000045349	308
346	3300005344	Ga0070661_100068477	Ga0070661_1000684773	308
347	3300005354	Ga0070675_100102024	Ga0070675_1001020242	308
348	3300005355	Ga0070671_100457403	Ga0070671_1004574031	308
349	3300005365	Ga0070688_100007188	Ga0070688_1000071887	308
350	3300005366	Ga0070659_100020040	Ga0070659_1000200401	308
351	3300005367	Ga0070667_100007558	Ga0070667_1000075585	308
352	3300005367	Ga0070667_100219507	Ga0070667_1002195072	308
353	3300005434	Ga0070709_10044560	Ga0070709_100445602	308
354	3300005434	Ga0070709_10046062	Ga0070709_100460622	308
355	3300005436	Ga0070713_100107395	Ga0070713_1001073953	308
356	3300005437	Ga0070710_10256339	Ga0070710_102563391	308
357	3300005439	Ga0070711_100001779	Ga0070711_1000017799	308
358	3300005440	Ga0070705_100017404	Ga0070705_1000174044	308
359	3300005445	Ga0070708_100001275	Ga0070708_10000127515	308
360	3300005445	Ga0070708_100007154	Ga0070708_1000071548	308
361	3300005445	Ga0070708_100038338	Ga0070708_1000383383	308
362	3300005445	Ga0070708_100181791	Ga0070708_1001817911	308
363	3300005445	Ga0070708_100471012	Ga0070708_1004710121	308
364	3300005455	Ga0070663_100011255	Ga0070663_1000112551	308
365	3300005455	Ga0070663_100015527	Ga0070663_1000155271	308
366	3300005457	Ga0070662_100027939	Ga0070662_1000279392	308
367	3300005457	Ga0070662_100079150	Ga0070662_1000791502	308
368	3300005459	Ga0068867_100013267	Ga0068867_1000132673	308
369	3300005459	Ga0068867_100194743	Ga0068867_1001947432	308
370	3300005466	Ga0070685_10015430	Ga0070685_100154305	308
371	3300005467	Ga0070706_100000278	Ga0070706_10000027873	308
372	3300005467	Ga0070706_100000595	Ga0070706_10000059521	308
373	3300005468	Ga0070707_100070918	Ga0070707_1000709182	308
374	3300005471	Ga0070698_100000133	Ga0070698_10000013340	308
375	3300005471	Ga0070698_100357614	Ga0070698_1003576142	308
376	3300005518	Ga0070699_100029206	Ga0070699_1000292062	308
377	3300005518	Ga0070699_100053336	Ga0070699_1000533363	308
378	3300005535	Ga0070684_100080621	Ga0070684_1000806214	308
379	3300005536	Ga0070697_100000049	Ga0070697_10000004933	308
380	3300005536	Ga0070697_100014361	Ga0070697_1000143614	308
381	3300005536	Ga0070697_100035805	Ga0070697_1000358052	308
382	3300005536	Ga0070697_100139655	Ga0070697_1001396552	308
383	3300005536	Ga0070697_100271907	Ga0070697_1002719072	308
384	3300005543	Ga0070672_100017824	Ga0070672_1000178243	308
385	3300005544	Ga0070686_100043155	Ga0070686_1000431553	308
386	3300005544	Ga0070686_100112444	Ga0070686_1001124441	308
387	3300005545	Ga0070695_100022298	Ga0070695_1000222983	308
388	3300005546	Ga0070696_100199993	Ga0070696_1001999932	308
389	3300005548	Ga0070665_100100580	Ga0070665_1001005804	308
390	3300005563	Ga0068855_100031118	Ga0068855_10003111810	308
391	3300005564	Ga0070664_100119086	Ga0070664_1001190861	308
392	3300005564	Ga0070664_100218367	Ga0070664_1002183671	308
393	3300005577	Ga0068857_100001399	Ga0068857_1000013998	308
394	3300005577	Ga0068857_100041092	Ga0068857_1000410923	308
395	3300005578	Ga0068854_100011596	Ga0068854_1000115967	308
396	3300005614	Ga0068856_100008041	Ga0068856_1000080416	308
397	3300005614	Ga0068856_100010906	Ga0068856_1000109063	308
398	3300005615	Ga0070702_100034763	Ga0070702_1000347634	308
399	3300005616	Ga0068852_100002183	Ga0068852_1000021839	308
400	3300005616	Ga0068852_100033720	Ga0068852_1000337202	308
401	3300005617	Ga0068859_100080020	Ga0068859_1000800204	308
402	3300005617	Ga0068859_100249431	Ga0068859_1002494311	308
403	3300005618	Ga0068864_100124297	Ga0068864_1001242971	308
404	3300005718	Ga0068866_10011554	Ga0068866_100115543	308
405	3300005719	Ga0068861_100149892	Ga0068861_1001498922	308
406	3300005834	Ga0068851_10019550	Ga0068851_100195505	308
407	3300005834	Ga0068851_10043678	Ga0068851_100436782	308
408	3300005840	Ga0068870_10006762	Ga0068870_100067625	308
409	3300005841	Ga0068863_100015362	Ga0068863_1000153629	308
410	3300005841	Ga0068863_100176520	Ga0068863_1001765201	308
411	3300005842	Ga0068858_100022440	Ga0068858_1000224405	308
412	3300005842	Ga0068858_100123744	Ga0068858_1001237441	308
413	3300005843	Ga0068860_100063548	Ga0068860_1000635484	308
414	3300005843	Ga0068860_100232357	Ga0068860_1002323572	308
415	3300005844	Ga0068862_100071338	Ga0068862_1000713385	308
416	3300006028	Ga0070717_10009588	Ga0070717_100095883	308
417	3300006028	Ga0070717_10089158	Ga0070717_100891582	308
418	3300006028	Ga0070717_10126075	Ga0070717_101260753	308
419	3300006028	Ga0070717_10233999	Ga0070717_102339992	308
420	3300006028	Ga0070717_10568542	Ga0070717_105685421	308
421	3300006163	Ga0070715_10000761	Ga0070715_100007614	308
422	3300006173	Ga0070716_100036205	Ga0070716_1000362053	308
423	3300006173	Ga0070716_100137424	Ga0070716_1001374241	308
424	3300006175	Ga0070712_100000604	Ga0070712_10000060423	308
425	3300006237	Ga0097621_100022360	Ga0097621_1000223601	308
426	3300006237	Ga0097621_100070408	Ga0097621_1000704083	308
427	3300006358	Ga0068871_100005518	Ga0068871_1000055186	308
428	3300006852	Ga0075433_10005520	Ga0075433_100055203	308
429	3300006871	Ga0075434_100000069	Ga0075434_10000006912	308
430	3300006881	Ga0068865_100084496	Ga0068865_1000844963	308
431	3300006914	Ga0075436_100001352	Ga0075436_1000013524	308
432	3300006914	Ga0075436_100003911	Ga0075436_1000039116	308
433	3300006914	Ga0075436_100005052	Ga0075436_1000050526	308
434	3300006914	Ga0075436_100064623	Ga0075436_1000646232	308
435	3300006931	Ga0097620_100080028	Ga0097620_1000800282	308
436	3300006931	Ga0097620_100249407	Ga0097620_1002494071	308
437	3300007076	Ga0075435_100024362	Ga0075435_1000243622	308
438	3300007076	Ga0075435_100242485	Ga0075435_1002424852	308
439	3300009093	Ga0105240_10090532	Ga0105240_100905323	308
440	3300009093	Ga0105240_10251730	Ga0105240_102517302	308
441	3300009098	Ga0105245_10011712	Ga0105245_100117124	308
442	3300009098	Ga0105245_10243540	Ga0105245_102435402	308
443	3300009101	Ga0105247_10073430	Ga0105247_100734302	308
444	3300009174	Ga0105241_10010172	Ga0105241_100101724	308
445	3300009174	Ga0105241_10011679	Ga0105241_100116795	308
446	3300009174	Ga0105241_10021518	Ga0105241_100215186	308
447	3300009176	Ga0105242_10003236	Ga0105242_1000323614	308
448	3300009177	Ga0105248_10377732	Ga0105248_103777322	308
449	3300009551	Ga0105238_10024197	Ga0105238_100241972	308
450	3300009553	Ga0105249_10047140	Ga0105249_100471405	308
451	3300010375	Ga0105239_10013406	Ga0105239_100134069	308
452	3300011119	Ga0105246_10003819	Ga0105246_100038196	308
453	3300013102	Ga0157371_10003824	Ga0157371_100038248	308
454	3300013104	Ga0157370_10296209	Ga0157370_102962092	308
455	3300013105	Ga0157369_10016674	Ga0157369_100166748	308
456	3300013105	Ga0157369_10024702	Ga0157369_100247022	308
457	3300013296	Ga0157374_10018662	Ga0157374_100186625	308
458	3300013296	Ga0157374_10159207	Ga0157374_101592073	308
459	3300013297	Ga0157378_10013909	Ga0157378_100139094	308
460	3300013297	Ga0157378_10113234	Ga0157378_101132341	308
461	3300013306	Ga0163162_10000471	Ga0163162_1000047122	308
462	3300013306	Ga0163162_10123477	Ga0163162_101234773	308
463	3300013307	Ga0157372_10121186	Ga0157372_101211861	308
464	3300013307	Ga0157372_10318066	Ga0157372_103180663	308
465	3300013308	Ga0157375_10405705	Ga0157375_104057051	308
466	3300014325	Ga0163163_10002845	Ga0163163_100028459	308
467	3300014325	Ga0163163_10117338	Ga0163163_101173382	308
468	3300014326	Ga0157380_10014889	Ga0157380_100148895	308
469	3300014745	Ga0157377_10022200	Ga0157377_100222004	308
470	3300014968	Ga0157379_10004043	Ga0157379_100040434	308
471	3300014968	Ga0157379_10012385	Ga0157379_100123856	308
472	3300014968	Ga0157379_10016949	Ga0157379_100169497	308
473	3300014969	Ga0157376_10171722	Ga0157376_101717222	308
474	3300014969	Ga0157376_10430214	Ga0157376_104302142	308
475	3300015261	Ga0182006_1031798	Ga0182006_10317983	308
476	3300015262	Ga0182007_10024081	Ga0182007_100240812	308
477	3300024227	Ga0228598_1000547	Ga0228598_10005474	308
478	3300025321	Ga0207656_10002834	Ga0207656_100028344	308
479	3300025898	Ga0207692_10041557	Ga0207692_100415572	308
480	3300025901	Ga0207688_10000700	Ga0207688_100007003	308
481	3300025904	Ga0207647_10023458	Ga0207647_100234585	308
482	3300025905	Ga0207685_10003338	Ga0207685_100033384	308
483	3300025906	Ga0207699_10006881	Ga0207699_100068814	308
484	3300025906	Ga0207699_10026055	Ga0207699_100260552	308
485	3300025907	Ga0207645_10000042	Ga0207645_1000004260	308
486	3300025908	Ga0207643_10000133	Ga0207643_1000013332	308
487	3300025909	Ga0207705_10043893	Ga0207705_100438933	308
488	3300025910	Ga0207684_10000283	Ga0207684_1000028317	308
489	3300025910	Ga0207684_10014264	Ga0207684_100142645	308
490	3300025911	Ga0207654_10005477	Ga0207654_100054778	308
491	3300025911	Ga0207654_10031517	Ga0207654_100315173	308
492	3300025913	Ga0207695_10050057	Ga0207695_100500573	308
493	3300025915	Ga0207693_10000402	Ga0207693_1000040230	308
494	3300025915	Ga0207693_10001883	Ga0207693_1000188313	308
495	3300025916	Ga0207663_10001737	Ga0207663_100017374	308
496	3300025917	Ga0207660_10224879	Ga0207660_102248792	308
497	3300025919	Ga0207657_10000423	Ga0207657_1000042322	308
498	3300025919	Ga0207657_10009169	Ga0207657_100091698	308
499	3300025920	Ga0207649_10000241	Ga0207649_100002415	308
500	3300025922	Ga0207646_10003114	Ga0207646_1000311415	308
501	3300025922	Ga0207646_10099784	Ga0207646_100997841	308
502	3300025923	Ga0207681_10185559	Ga0207681_101855592	308
503	3300025925	Ga0207650_10000119	Ga0207650_1000011920	308
504	3300025925	Ga0207650_10153804	Ga0207650_101538041	308
505	3300025927	Ga0207687_10001365	Ga0207687_1000136512	308
506	3300025928	Ga0207700_10033796	Ga0207700_100337962	308
507	3300025928	Ga0207700_10065485	Ga0207700_100654853	308
508	3300025929	Ga0207664_10465291	Ga0207664_104652911	308
509	3300025932	Ga0207690_10013956	Ga0207690_100139566	308
510	3300025933	Ga0207706_10000251	Ga0207706_100002513	308
511	3300025933	Ga0207706_10000389	Ga0207706_1000038931	308
512	3300025938	Ga0207704_10386444	Ga0207704_103864441	308
513	3300025939	Ga0207665_10005107	Ga0207665_100051073	308
514	3300025939	Ga0207665_10039098	Ga0207665_100390982	308
515	3300025940	Ga0207691_10000213	Ga0207691_1000021327	308
516	3300025941	Ga0207711_10007197	Ga0207711_100071973	308
517	3300025942	Ga0207689_10000322	Ga0207689_1000032228	308
518	3300025942	Ga0207689_10016777	Ga0207689_100167773	308
519	3300025944	Ga0207661_10000689	Ga0207661_100006899	308
520	3300025944	Ga0207661_10082506	Ga0207661_100825062	308
521	3300025945	Ga0207679_10000084	Ga0207679_1000008465	308
522	3300025945	Ga0207679_10026810	Ga0207679_100268101	308
523	3300025949	Ga0207667_10003515	Ga0207667_1000351518	308
524	3300025960	Ga0207651_10015128	Ga0207651_100151286	308
525	3300025961	Ga0207712_10496465	Ga0207712_104964651	308
526	3300025981	Ga0207640_10058193	Ga0207640_100581932	308
527	3300026023	Ga0207677_10004439	Ga0207677_100044395	308
528	3300026023	Ga0207677_10229892	Ga0207677_102298922	308
529	3300026041	Ga0207639_10037422	Ga0207639_100374223	308
530	3300026067	Ga0207678_10000070	Ga0207678_1000007058	308
531	3300026067	Ga0207678_10003306	Ga0207678_1000330610	308
532	3300026088	Ga0207641_10000006	Ga0207641_10000006119	308
533	3300026088	Ga0207641_10131961	Ga0207641_101319613	308
534	3300026089	Ga0207648_10000108	Ga0207648_1000010823	308
535	3300026089	Ga0207648_10099038	Ga0207648_100990382	308
536	3300026095	Ga0207676_10000132	Ga0207676_1000013242	308
537	3300026116	Ga0207674_10000556	Ga0207674_1000055631	308
538	3300026116	Ga0207674_10034852	Ga0207674_100348522	308
539	3300026118	Ga0207675_100001966	Ga0207675_10000196620	308
540	3300026118	Ga0207675_100081946	Ga0207675_1000819463	308
541	3300026121	Ga0207683_10000811	Ga0207683_1000081124	308
542	3300026121	Ga0207683_10026989	Ga0207683_100269892	308
543	3300026142	Ga0207698_10006245	Ga0207698_100062455	308
544	3300026142	Ga0207698_10304032	Ga0207698_103040321	308
545	3300028379	Ga0268266_10011297	Ga0268266_100112978	308
546	3300028379	Ga0268266_10032181	Ga0268266_100321811	308
547	3300028380	Ga0268265_10043058	Ga0268265_100430581	308
548	3300028380	Ga0268265_10099542	Ga0268265_100995422	308
549	3300028381	Ga0268264_10014616	Ga0268264_100146162	308
550	3300028381	Ga0268264_10181548	Ga0268264_101815482	308
551	3300030760	Ga0265762_1006370	Ga0265762_10063702	308
552	3300030760	Ga0265762_1011616	Ga0265762_10116161	308
553	3300035170	Ga0373943_0096226	Ga0373943_0096226_15_947	308
554	3300035241	Ga0373961_0024367	Ga0373961_0024367_319_1251	308
555	3300035691	Ga0373931_0022921	Ga0373931_0022921_1314_2246	308
556	3300035692	Ga0373935_0179098	Ga0373935_0179098_56_988	308
557	3300035695	Ga0373927_0061365	Ga0373927_0061365_1188_2306	308
558	3300035725	Ga0373947_0014578	Ga0373947_0014578_3193_4311	308
559	3300035725	Ga0373947_0231075	Ga0373947_0231075_63_995	308
560	3300037068	Ga0373925_0001989	Ga0373925_0001989_998_2116	308
561	3300037068	Ga0373925_0106025	Ga0373925_0106025_1076_2008	308
562	3300046472	Ga0495580_0014783	Ga0495580_0014783_4509_5441	308
563	3300046472	Ga0495580_0096266	Ga0495580_0096266_189_1124	308
564	3300046472	Ga0495580_0126797	Ga0495580_0126797_795_1760	308
565	3300046472	Ga0495580_0142488	Ga0495580_0142488_650_1594	308
566	3300046473	Ga0495582_0001740	Ga0495582_0001740_94_1212	308
567	3300046473	Ga0495582_0107611	Ga0495582_0107611_454_1386	308
568	3300047315	Ga0495581_0096250	Ga0495581_0096250_663_1634	308
569	3300048903	Ga0496100_0003791	Ga0496100_0003791_2079_3011	308
570	3300048905	Ga0496102_0007919	Ga0496102_0007919_5140_6072	308
571	3300048905	Ga0496102_0045931	Ga0496102_0045931_1126_2052	308
572	3300048905	Ga0496102_0075266	Ga0496102_0075266_1397_2329	308
573	3300048905	Ga0496102_0089871	Ga0496102_0089871_793_1749	308
574	3300048905	Ga0496102_0269329	Ga0496102_0269329_35_964	308
575	3300048905	Ga0496102_0498548	Ga0496102_0498548_100_1026	308
576	3300048906	Ga0496103_0001229	Ga0496103_0001229_5526_6458	308
577	3300048906	Ga0496103_0092564	Ga0496103_0092564_693_1625	308
578	3300048907	Ga0496104_0117427	Ga0496104_0117427_809_1741	308
579	3300048908	Ga0496105_0160660	Ga0496105_0160660_309_1235	308
580	3300048910	Ga0496107_0025859	Ga0496107_0025859_1065_1997	308
581	3300048910	Ga0496107_0196055	Ga0496107_0196055_386_1312	308
582	3300048911	Ga0496108_0000495	Ga0496108_0000495_2957_3883	308
583	3300048912	Ga0496109_0000149	Ga0496109_0000149_65481_66407	308
584	3300048913	Ga0496110_0001488	Ga0496110_0001488_8629_9555	308
585	3300048914	Ga0496111_0041957	Ga0496111_0041957_518_1444	308
586	3300048915	Ga0496112_0000163	Ga0496112_0000163_29703_30629	308
587	3300048915	Ga0496112_0461197	Ga0496112_0461197_161_1117	308
588	3300048916	Ga0496113_0000189	Ga0496113_0000189_23575_24501	308
589	3300048918	Ga0496115_0066801	Ga0496115_0066801_1748_2674	308
590	3300050512	nmdc:mga0n895_514_c1	nmdc:mga0n895_514_c1_6986_7927	308
591	3300050513	nmdc:mga0rr50_364363_c1	nmdc:mga0rr50_364363_c1_110_1054	308
592	3300050513	nmdc:mga0rr50_7484_c1	nmdc:mga0rr50_7484_c1_3713_4654	308
593	3300050514	nmdc:mga08x19_108519_c1	nmdc:mga08x19_108519_c1_110_1039	308
594	3300050514	nmdc:mga08x19_3595_c1	nmdc:mga08x19_3595_c1_3921_4862	308
595	3300050514	nmdc:mga08x19_5030_c1	nmdc:mga08x19_5030_c1_3089_4018	308
596	3300050514	nmdc:mga08x19_6727_c1	nmdc:mga08x19_6727_c1_636_1754	308
597	3300050514	nmdc:mga08x19_77461_c1	nmdc:mga08x19_77461_c1_197_1129	308
598	3300050515	nmdc:mga0a205_1302_c2	nmdc:mga0a205_1302_c2_3957_4898	308
599	3300053085	Ga0495619_0066892	Ga0495619_0066892_960_1892	308

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13407

Peripla_BP_4

Periplasmic binding protein domain

38

306

0.89 PF00532

Peripla_BP_1

Periplasmic binding proteins and sugar binding domain of LacI family

33

254

0.79 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
1dbp-assembly1.cif.gz_A	identical mutations at corresponding positions in two homologous proteins with non-identical effects	0.8529	3	293
4ry0-assembly1.cif.gz_A	crystal structure of ribose transporter solute binding protein rhe_pf00037 from rhizobium etli cfn 42, target efi-511357, in complex with d-ribose	0.8521	2	290
1drj-assembly1.cif.gz_A	probing protein-protein interactions: the ribose-binding protein in bacterial transport and chemotaxis	0.8517	3	293
4zjp-assembly1.cif.gz_A	structure of an abc-transporter solute binding protein (sbp_ipr025997) from actinobacillus succinogenes (asuc_0197, target efi-511067) with bound beta-d-ribopyranose	0.8498	2	293
3l6u-assembly1.cif.gz_B	crystal structure of abc-type sugar transport system, periplasmic component from exiguobacterium sibiricum	0.8482	6	290

ID	Description	Score	Start	End	Superfamily
4kq9A01	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator	0.8987	3	98	3.40.50.2300
2vk2A01	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator	0.8866	4	99	3.40.50.2300
af_P39325_23_126_3.30.420.40	Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain	0.8824	4	99	3.30.420.40
6dspB01	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator	0.8779	4	99	3.40.50.2300
5hqjA01	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator	0.8728	2	97	3.40.50.2300

ID	Description	Score	Start	End	GO Terms
AF-A0A2V9PUX6-F1-model_v4	Periplasmic binding protein domain-containing protein	0.9839	77	307	GO:0030246 GO:0030313
AF-A0A7V8SZH1-F1-model_v4	Substrate-binding domain-containing protein	0.9808	121	297	GO:0030246 GO:0030313
AF-A0A2V8XA07-F1-model_v4	Periplasmic binding protein domain-containing protein	0.9672	1	113
AF-A0A2V9QVZ1-F1-model_v4	Periplasmic binding protein domain-containing protein	0.9636	109	258	GO:0030246 GO:0030313
AF-A0A2W0BGM7-F1-model_v4	Periplasmic binding protein domain-containing protein	0.9611	113	300	GO:0030246 GO:0030313

Feature Viewer

pLDDT	pTM	Quality
93.41	0.89	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F467858

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF13407

Peripla_BP_4

Periplasmic binding protein domain

38

306

0.89

PF00532

Peripla_BP_1

Periplasmic binding proteins and sugar binding domain of LacI family

33

254

0.79

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map