F467850

General Info

Members Datasets Scaffolds Average Seq Length
599 247 1198 282

Family's Representative Sequence

Representative Sequence 3300005577|Ga0068857_100148043|Ga0068857_1001480432
Length 319
Sequence MWTLSSLRPMQCRSKPRKGPEGVGRAPSPAAFYLDLLMFSRAYRNAITVPPLLWVAVFLLAPYALLFCYSFWSLSSSQEIVHSWTLENYRQLINVNVYWQTLLRSMWIAARVTIFSLLLGYPLAYYLSFHAGRRKNLFYQLVIIPLWVSYLVRAYAWKTILGSDGVLNTLLQYVHLTSHPLDFLLYSPFAVVLTLTHIYTPFTFLPIYAVLEHIPRNLVEASHDLGASPFQTFWRVVFPLSIPGVLSGATFAFVLSLGDFLAPLLLGGPSGIMISNIVVSLFGAAYNWPLGAAISFCMLALVLALLFLSERLEKKWSFR

Samples

Sample ID Description Type Environment
1 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
2 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
4 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
5 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
29 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
30 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
31 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
32 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
33 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
34 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
39 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
40 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
41 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
42 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
43 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
44 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
45 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
46 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
47 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
48 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
49 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
50 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
51 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
52 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
53 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
54 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
55 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
56 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
57 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
58 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
59 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
60 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
61 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
62 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
63 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
64 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
65 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
66 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
67 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
68 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
69 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
70 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
71 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
72 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
73 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
74 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
76 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
77 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
78 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
79 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
80 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
82 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
83 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
84 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
85 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
86 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
87 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
88 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
89 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
90 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
91 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
92 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
93 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
94 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
95 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
96 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
97 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
98 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
99 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
100 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
101 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
102 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
103 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
104 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
105 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
106 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
107 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
108 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
109 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
110 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
111 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
112 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
113 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
114 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
115 3300022730 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU2 Metagenome Rhizosphere
116 3300022732 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU1 Metagenome Rhizosphere
117 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
118 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
119 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300028010 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA6 Metagenome Rhizosphere
177 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
178 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
179 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
183 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
184 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
185 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
186 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
187 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
188 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
189 3300033545 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 Metagenome Unclassified
190 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
191 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
192 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
193 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
194 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
195 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
196 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
197 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
198 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
199 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
200 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
201 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
202 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
203 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
204 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
205 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
206 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
207 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
208 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
209 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
210 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
211 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
212 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
213 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
214 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
215 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
216 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
217 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
218 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
219 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
220 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
221 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
222 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
223 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
224 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
225 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
226 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
227 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
228 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
229 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
230 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
231 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
232 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
233 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
234 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
235 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
236 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
237 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
238 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
239 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
240 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
241 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
242 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
243 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
244 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
245 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
246 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
247 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.83
Metatranscriptomes 1.17
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.17
Rhizosphere 95.49
Stem 0
Stem Tuber 0
Unclassified 9.85

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068857_100148043 3300005577 Bacteria 2125
2 MRS1b_contig_2051578 2162886011 Bacteria 2006
3 JGI24743J22301_10015174 3300001991 Unclassified 1426
4 JGI24034J26672_10018639 3300002239 Unclassified 1079
5 JGI24751J29686_10002410 3300002459 Bacteria 3769
6 Ga0065712_10095528 3300005290 Bacteria 2216
7 Ga0065715_10090913 3300005293 Bacteria 6306
8 Ga0065707_10098140 3300005295 Bacteria 3109
9 Ga0070658_10058679 3300005327 Bacteria 3133
10 Ga0070676_10013859 3300005328 Bacteria 4423
11 Ga0070676_10013893 3300005328 Bacteria 4417
12 Ga0070683_100001812 3300005329 Bacteria 16654
13 Ga0070690_100058808 3300005330 Bacteria 2470
14 Ga0070690_100279410 3300005330 Unclassified 1190
15 Ga0070670_100019493 3300005331 Bacteria 5821
16 Ga0068869_100007007 3300005334 Bacteria 7178
17 Ga0068869_100068911 3300005334 Bacteria 2614
18 Ga0070666_10004600 3300005335 Bacteria 8413
19 Ga0070666_10036039 3300005335 Bacteria 3281
20 Ga0070682_100011072 3300005337 Bacteria 5144
21 Ga0070682_100175607 3300005337 Bacteria 1492
22 Ga0068868_100014747 3300005338 Bacteria 5766
23 Ga0068868_100076459 3300005338 Bacteria 2677
24 Ga0068868_100087167 3300005338 Bacteria 2510
25 Ga0068868_100360545 3300005338 Bacteria 1247
26 Ga0070660_100025302 3300005339 Unclassified 4411
27 Ga0070660_100031169 3300005339 Bacteria 4003
28 Ga0070689_100002745 3300005340 Bacteria 11545
29 Ga0070687_100004703 3300005343 Bacteria 5462
30 Ga0070661_100004154 3300005344 Bacteria 9988
31 Ga0070668_100001619 3300005347 Bacteria 16277
32 Ga0070668_100123048 3300005347 Bacteria 2075
33 Ga0070669_100027731 3300005353 Bacteria 4076
34 Ga0070675_100249009 3300005354 Bacteria 1554
35 Ga0070673_100006403 3300005364 Bacteria 7653
36 Ga0070688_100001450 3300005365 Bacteria 11795
37 Ga0070688_100288838 3300005365 Bacteria 1181
38 Ga0070659_100010855 3300005366 Bacteria 6715
39 Ga0070659_100071444 3300005366 Bacteria 2759
40 Ga0070709_10250652 3300005434 Bacteria 1275
41 Ga0070709_10269670 3300005434 Bacteria 1233
42 Ga0070709_10329188 3300005434 Bacteria 1123
43 Ga0070709_10407186 3300005434 Bacteria 1017
44 Ga0070714_100000054 3300005435 Bacteria 104948
45 Ga0070714_100002700 3300005435 Bacteria 13070
46 Ga0070714_100267962 3300005435 Bacteria 1583
47 Ga0070713_100000188 3300005436 Bacteria 40867
48 Ga0070713_100013628 3300005436 Bacteria 6012
49 Ga0070713_100033214 3300005436 Bacteria 4131
50 Ga0070713_100037918 3300005436 Bacteria 3900
51 Ga0070713_100107742 3300005436 Bacteria 2425
52 Ga0070713_100123057 3300005436 Bacteria 2277
53 Ga0070713_100152806 3300005436 Bacteria 2055
54 Ga0070713_100208514 3300005436 Bacteria 1768
55 Ga0070710_10017033 3300005437 Bacteria 3711
56 Ga0070710_10017416 3300005437 Bacteria 3676
57 Ga0070710_10020302 3300005437 Bacteria 3445
58 Ga0070710_10062019 3300005437 Unclassified 2131
59 Ga0070711_100008563 3300005439 Bacteria 6271
60 Ga0070711_100009334 3300005439 Bacteria 6038
61 Ga0070711_100128762 3300005439 Bacteria 1882
62 Ga0070705_100296236 3300005440 Bacteria 1157
63 Ga0070708_100000730 3300005445 Bacteria 24932
64 Ga0070708_100007427 3300005445 Bacteria 8772
65 Ga0070708_100009939 3300005445 Bacteria 7691
66 Ga0070708_100015025 3300005445 Bacteria 6386
67 Ga0070708_100029701 3300005445 Bacteria 4717
68 Ga0070708_100047812 3300005445 Bacteria 3780
69 Ga0070708_100104433 3300005445 Bacteria 2598
70 Ga0070708_100241260 3300005445 Bacteria 1697
71 Ga0070708_100538123 3300005445 Bacteria 1102
72 Ga0070663_100009470 3300005455 Bacteria 6033
73 Ga0070663_100015588 3300005455 Bacteria 4912
74 Ga0070678_100079138 3300005456 Bacteria 2485
75 Ga0070678_100095795 3300005456 Bacteria 2288
76 Ga0070662_100170403 3300005457 Bacteria 1709
77 Ga0070681_10009751 3300005458 Bacteria 9450
78 Ga0070681_10017997 3300005458 Bacteria 7060
79 Ga0070681_10031785 3300005458 Bacteria 5298
80 Ga0070681_10146949 3300005458 Bacteria 2286
81 Ga0068867_100016014 3300005459 Bacteria 5323
82 Ga0068867_100031403 3300005459 Plasmid 3834
83 Ga0070685_10136346 3300005466 Bacteria 1540
84 Ga0070706_100002945 3300005467 Bacteria 16899
85 Ga0070706_100007336 3300005467 Bacteria 10341
86 Ga0070706_100010890 3300005467 Bacteria 8441
87 Ga0070706_100013671 3300005467 Bacteria 7504
88 Ga0070706_100036317 3300005467 Bacteria 4551
89 Ga0070706_100039937 3300005467 Bacteria 4332
90 Ga0070706_100292033 3300005467 Bacteria 1521
91 Ga0070706_100327604 3300005467 Bacteria 1428
92 Ga0070706_100606580 3300005467 Bacteria 1017
93 Ga0070707_100003616 3300005468 Bacteria 14582
94 Ga0070707_100009652 3300005468 Bacteria 8969
95 Ga0070707_100056952 3300005468 Bacteria 3750
96 Ga0070707_100059004 3300005468 Bacteria 3680
97 Ga0070707_100464390 3300005468 Bacteria 1227
98 Ga0070698_100000148 3300005471 Bacteria 63449
99 Ga0070698_100087452 3300005471 Bacteria 3102
100 Ga0070698_100144228 3300005471 Bacteria 2331
101 Ga0070699_100002194 3300005518 Bacteria 17666
102 Ga0070699_100004195 3300005518 Bacteria 12751
103 Ga0070699_100105248 3300005518 Bacteria 2475
104 Ga0070699_100114315 3300005518 Bacteria 2371
105 Ga0070679_100283496 3300005530 Bacteria 1609
106 Ga0070684_100003934 3300005535 Bacteria 11252
107 Ga0070697_100000039 3300005536 Bacteria 95513
108 Ga0070697_100002043 3300005536 Bacteria 15464
109 Ga0070697_100004221 3300005536 Bacteria 11009
110 Ga0070697_100006833 3300005536 Bacteria 8857
111 Ga0070697_100007244 3300005536 Bacteria 8627
112 Ga0070697_100008831 3300005536 Bacteria 7862
113 Ga0070697_100010375 3300005536 Bacteria 7268
114 Ga0070697_100020736 3300005536 Bacteria 5203
115 Ga0070697_100030939 3300005536 Bacteria 4301
116 Ga0070697_100124001 3300005536 Bacteria 2163
117 Ga0070697_100278931 3300005536 Bacteria 1433
118 Ga0070697_100306728 3300005536 Unclassified 1365
119 Ga0070697_100381548 3300005536 Unclassified 1221
120 Ga0070697_100436060 3300005536 Unclassified 1140
121 Ga0068853_100040056 3300005539 Unclassified 3996
122 Ga0068853_100096505 3300005539 Bacteria 2608
123 Ga0068853_100138612 3300005539 Unclassified 2182
124 Ga0070672_100003007 3300005543 Bacteria 10861
125 Ga0070686_100018758 3300005544 Bacteria 4067
126 Ga0070686_100089156 3300005544 Bacteria 2060
127 Ga0070695_100029108 3300005545 Bacteria 3431
128 Ga0070695_100345500 3300005545 Bacteria 1113
129 Ga0070696_100130905 3300005546 Bacteria 1825
130 Ga0070693_100010458 3300005547 Bacteria 4650
131 Ga0070693_100045930 3300005547 Bacteria 2478
132 Ga0070693_100178209 3300005547 Bacteria 1366
133 Ga0070665_100003382 3300005548 Bacteria 17066
134 Ga0070665_100105948 3300005548 Bacteria 2814
135 Ga0068855_100239601 3300005563 Bacteria 2027
136 Ga0070664_100017892 3300005564 Bacteria 5819
137 Ga0068857_100002703 3300005577 Bacteria 14548
138 Ga0068854_100031158 3300005578 Bacteria 3704
139 Ga0068854_100046248 3300005578 Bacteria 3098
140 Ga0068856_100051512 3300005614 Bacteria 4058
141 Ga0068856_100094688 3300005614 Bacteria 2973
142 Ga0068856_100766882 3300005614 Bacteria 984
143 Ga0068852_100009510 3300005616 Bacteria 7224
144 Ga0068852_100030604 3300005616 Bacteria 4434
145 Ga0068852_100581254 3300005616 Unclassified 1123
146 Ga0068859_100004309 3300005617 Bacteria 14508
147 Ga0068859_100162380 3300005617 Bacteria 2313
148 Ga0068864_100008182 3300005618 Bacteria 8623
149 Ga0068864_100209160 3300005618 Bacteria 1796
150 Ga0068866_10005454 3300005718 Bacteria 5249
151 Ga0068866_10012141 3300005718 Unclassified 3748
152 Ga0068866_10105595 3300005718 Bacteria 1562
153 Ga0068861_100470144 3300005719 Bacteria 1130
154 Ga0068851_10005289 3300005834 Bacteria 5857
155 Ga0068870_10006731 3300005840 Bacteria 5088
156 Ga0068863_100023996 3300005841 Bacteria 5821
157 Ga0068863_100067013 3300005841 Bacteria 3396
158 Ga0068863_100562263 3300005841 Bacteria 1127
159 Ga0068858_100033851 3300005842 Bacteria 4739
160 Ga0068858_100038693 3300005842 Bacteria 4424
161 Ga0068858_100068812 3300005842 Bacteria 3281
162 Ga0068860_100117482 3300005843 Bacteria 2545
163 Ga0068860_100120035 3300005843 Bacteria 2517
164 Ga0068860_100614513 3300005843 Bacteria 1093
165 Ga0068862_100012812 3300005844 Bacteria 6937
166 Ga0068862_100114239 3300005844 Bacteria 2373
167 Ga0070717_10000248 3300006028 Bacteria 37042
168 Ga0070717_10003342 3300006028 Bacteria 11460
169 Ga0070717_10012122 3300006028 Bacteria 6570
170 Ga0070717_10034507 3300006028 Bacteria 4090
171 Ga0070717_10059223 3300006028 Bacteria 3168
172 Ga0070717_10099809 3300006028 Bacteria 2464
173 Ga0070717_10099959 3300006028 Bacteria 2462
174 Ga0070717_10132841 3300006028 Bacteria 2142
175 Ga0070717_10215282 3300006028 Bacteria 1687
176 Ga0070715_10036351 3300006163 Bacteria 2031
177 Ga0070716_100000300 3300006173 Bacteria 19983
178 Ga0070716_100000576 3300006173 Bacteria 15388
179 Ga0070716_100010396 3300006173 Bacteria 4663
180 Ga0070716_100189973 3300006173 Bacteria 1356
181 Ga0070712_100000093 3300006175 Bacteria 45026
182 Ga0070712_100000797 3300006175 Bacteria 18674
183 Ga0070712_100010201 3300006175 Bacteria 5921
184 Ga0070712_100012460 3300006175 Bacteria 5406
185 Ga0070712_100067962 3300006175 Bacteria 2537
186 Ga0070712_100109640 3300006175 Bacteria 2058
187 Ga0070712_100217447 3300006175 Bacteria 1511
188 Ga0070712_100392732 3300006175 Bacteria 1144
189 Ga0097621_100073382 3300006237 Bacteria 2832
190 Ga0097621_100089993 3300006237 Bacteria 2567
191 Ga0068871_100005766 3300006358 Bacteria 8698
192 Ga0068871_100108537 3300006358 Bacteria 2333
193 Ga0068871_100272709 3300006358 Bacteria 1478
194 Ga0075433_10026498 3300006852 Bacteria 4908
195 Ga0075433_10033870 3300006852 Bacteria 4382
196 Ga0075434_100000035 3300006871 Bacteria 61439
197 Ga0075434_100001469 3300006871 Bacteria 19840
198 Ga0075434_100005703 3300006871 Bacteria 11370
199 Ga0075434_100312367 3300006871 Bacteria 1592
200 Ga0075434_100338095 3300006871 Bacteria 1526
201 Ga0068865_100049331 3300006881 Bacteria 2901
202 Ga0068865_100080185 3300006881 Bacteria 2340
203 Ga0075436_100007889 3300006914 Bacteria 7286
204 Ga0075436_100014814 3300006914 Bacteria 5342
205 Ga0075436_100135427 3300006914 Bacteria 1729
206 Ga0097620_100004309 3300006931 Bacteria 14508
207 Ga0097620_100162377 3300006931 Bacteria 2313
208 Ga0075435_100004622 3300007076 Bacteria 9479
209 Ga0075435_100012095 3300007076 Bacteria 6379
210 Ga0075435_100066847 3300007076 Unclassified 2926
211 Ga0099794_10130724 3300007265 Bacteria 1268
212 Ga0105240_10010032 3300009093 Bacteria 13338
213 Ga0105240_10033170 3300009093 Bacteria 6674
214 Ga0105240_10043615 3300009093 Bacteria 5705
215 Ga0105240_10092820 3300009093 Bacteria 3685
216 Ga0105240_10210093 3300009093 Bacteria 2275
217 Ga0105240_10519363 3300009093 Unclassified 1322
218 Ga0105245_10004304 3300009098 Bacteria 12603
219 Ga0105245_10204324 3300009098 Bacteria 1898
220 Ga0105247_10009259 3300009101 Bacteria 5983
221 Ga0105247_10010685 3300009101 Bacteria 5542
222 Ga0105247_10022919 3300009101 Bacteria 3760
223 Ga0114129_10227333 3300009147 Bacteria 2514
224 Ga0105241_10002597 3300009174 Bacteria 13545
225 Ga0105241_10003642 3300009174 Bacteria 11436
226 Ga0105241_10013320 3300009174 Bacteria 6027
227 Ga0105241_10037614 3300009174 Bacteria 3646
228 Ga0105241_10064403 3300009174 Bacteria 2830
229 Ga0105241_10313368 3300009174 Bacteria 1350
230 Ga0105242_10075729 3300009176 Bacteria 2803
231 Ga0105248_10088652 3300009177 Unclassified 3482
232 Ga0105248_10108668 3300009177 Bacteria 3127
233 Ga0105248_10159096 3300009177 Bacteria 2548
234 Ga0105248_10474527 3300009177 Unclassified 1410
235 Ga0105237_10009578 3300009545 Bacteria 10371
236 Ga0105237_10038140 3300009545 Bacteria 4853
237 Ga0105237_10078286 3300009545 Bacteria 3295
238 Ga0105237_10526247 3300009545 Unclassified 1189
239 Ga0105238_10041257 3300009551 Unclassified 4675
240 Ga0105238_10051660 3300009551 Bacteria 4134
241 Ga0105249_10007834 3300009553 Bacteria 9301
242 Ga0099796_10083151 3300010159 Unclassified 1177
243 Ga0105239_10017057 3300010375 Bacteria 8027
244 Ga0105239_10057313 3300010375 Plasmid 4273
245 Ga0157373_10000997 3300013100 Bacteria 21893
246 Ga0157371_10009043 3300013102 Bacteria 7875
247 Ga0157371_10028491 3300013102 Bacteria 4044
248 Ga0157370_10231221 3300013104 Bacteria 1711
249 Ga0157370_10474163 3300013104 Bacteria 1150
250 Ga0157369_10006423 3300013105 Bacteria 13627
251 Ga0157369_10023806 3300013105 Bacteria 6818
252 Ga0157369_10111546 3300013105 Bacteria 2906
253 Ga0157369_10274895 3300013105 Bacteria 1755
254 Ga0157374_10002303 3300013296 Bacteria 16088
255 Ga0157374_10006723 3300013296 Bacteria 9773
256 Ga0157374_10009493 3300013296 Bacteria 8355
257 Ga0157374_10050455 3300013296 Bacteria 3868
258 Ga0157374_10093736 3300013296 Bacteria 2868
259 Ga0157374_10098257 3300013296 Unclassified 2803
260 Ga0157374_10243094 3300013296 Bacteria 1770
261 Ga0157374_10628235 3300013296 Bacteria 1085
262 Ga0157378_10000353 3300013297 Bacteria 45114
263 Ga0157378_10034835 3300013297 Unclassified 4451
264 Ga0157378_10132742 3300013297 Bacteria 2306
265 Ga0163162_10000451 3300013306 Bacteria 38093
266 Ga0163162_10004222 3300013306 Bacteria 13814
267 Ga0163162_10237200 3300013306 Bacteria 1954
268 Ga0163162_10277470 3300013306 Bacteria 1808
269 Ga0157372_10005475 3300013307 Bacteria 13490
270 Ga0157372_10009260 3300013307 Bacteria 10472
271 Ga0157372_10018315 3300013307 Bacteria 7527
272 Ga0157372_10027436 3300013307 Bacteria 6202
273 Ga0157372_10062302 3300013307 Bacteria 4179
274 Ga0157372_10086882 3300013307 Bacteria 3548
275 Ga0157372_10163083 3300013307 Bacteria 2576
276 Ga0157375_10079450 3300013308 Bacteria 3316
277 Ga0157375_10158981 3300013308 Bacteria 2400
278 Ga0157375_10453821 3300013308 Unclassified 1447
279 Ga0163163_10001664 3300014325 Bacteria 18732
280 Ga0163163_10072701 3300014325 Unclassified 3428
281 Ga0163163_10083256 3300014325 Bacteria 3204
282 Ga0163163_10569221 3300014325 Bacteria 1196
283 Ga0157380_10584433 3300014326 Bacteria 1102
284 Ga0182008_10026264 3300014497 Bacteria 2953
285 Ga0157379_10006063 3300014968 Bacteria 10411
286 Ga0157379_10045653 3300014968 Bacteria 3910
287 Ga0157379_10086686 3300014968 Bacteria 2807
288 Ga0157379_10386339 3300014968 Bacteria 1285
289 Ga0157376_10022459 3300014969 Bacteria 4919
290 Ga0157376_10086167 3300014969 Bacteria 2708
291 Ga0157376_10095528 3300014969 Bacteria 2585
292 Ga0157376_10198270 3300014969 Bacteria 1845
293 Ga0182006_1021003 3300015261 Bacteria 2728
294 Ga0182006_1028227 3300015261 Unclassified 2284
295 Ga0182007_10001416 3300015262 Bacteria 12882
296 Ga0182005_1022280 3300015265 Bacteria 1736
297 Ga0182005_1047966 3300015265 Bacteria 1161
298 Ga0163161_10012942 3300017792 Bacteria 5795
299 Ga0213874_10006143 3300021377 Bacteria 2831
300 Ga0213874_10016247 3300021377 Bacteria 1978
301 Ga0213875_10010600 3300021388 Bacteria 4612
302 Ga0224570_101163 3300022730 Bacteria 2047
303 Ga0224569_100264 3300022732 Bacteria 4363
304 Ga0224569_102944 3300022732 Bacteria 1355
305 Ga0224572_1002700 3300024225 Bacteria 2909
306 Ga0224572_1005918 3300024225 Bacteria 2199
307 Ga0224572_1009061 3300024225 Bacteria 1851
308 Ga0224572_1009858 3300024225 Bacteria 1789
309 Ga0224572_1030362 3300024225 Bacteria 1032
310 Ga0228598_1000059 3300024227 Bacteria 16015
311 Ga0228598_1000496 3300024227 Bacteria 8138
312 Ga0228598_1001279 3300024227 Bacteria 5535
313 Ga0228598_1002212 3300024227 Bacteria 4250
314 Ga0207697_10013962 3300025315 Bacteria 3343
315 Ga0207656_10007011 3300025321 Bacteria 4090
316 Ga0207692_10003179 3300025898 Bacteria 6378
317 Ga0207692_10016731 3300025898 Unclassified 3256
318 Ga0207692_10057475 3300025898 Bacteria 2001
319 Ga0207642_10013481 3300025899 Bacteria 2984
320 Ga0207642_10017898 3300025899 Bacteria 2707
321 Ga0207642_10066362 3300025899 Bacteria 1699
322 Ga0207710_10009900 3300025900 Bacteria 4008
323 Ga0207710_10075444 3300025900 Bacteria 1554
324 Ga0207688_10031716 3300025901 Bacteria 2919
325 Ga0207688_10087106 3300025901 Unclassified 1790
326 Ga0207680_10039809 3300025903 Bacteria 2730
327 Ga0207680_10195552 3300025903 Unclassified 1375
328 Ga0207647_10004222 3300025904 Bacteria 10651
329 Ga0207647_10004616 3300025904 Bacteria 10204
330 Ga0207699_10041703 3300025906 Bacteria 2653
331 Ga0207699_10086451 3300025906 Bacteria 1958
332 Ga0207645_10000330 3300025907 Bacteria 39597
333 Ga0207643_10002946 3300025908 Bacteria 9182
334 Ga0207684_10000447 3300025910 Bacteria 54429
335 Ga0207684_10002057 3300025910 Bacteria 20692
336 Ga0207684_10017379 3300025910 Bacteria 6172
337 Ga0207684_10073862 3300025910 Bacteria 2896
338 Ga0207684_10188233 3300025910 Bacteria 1780
339 Ga0207684_10191405 3300025910 Bacteria 1765
340 Ga0207684_10272746 3300025910 Bacteria 1459
341 Ga0207684_10491455 3300025910 Unclassified 1052
342 Ga0207654_10001303 3300025911 Bacteria 13298
343 Ga0207654_10012491 3300025911 Bacteria 4352
344 Ga0207654_10112597 3300025911 Bacteria 1696
345 Ga0207654_10112748 3300025911 Bacteria 1695
346 Ga0207654_10227892 3300025911 Unclassified 1239
347 Ga0207654_10366496 3300025911 Unclassified 995
348 Ga0207707_10156204 3300025912 Bacteria 1995
349 Ga0207695_10027638 3300025913 Bacteria 6313
350 Ga0207695_10131128 3300025913 Bacteria 2464
351 Ga0207695_10238147 3300025913 Bacteria 1722
352 Ga0207695_10414937 3300025913 Bacteria 1230
353 Ga0207695_10531562 3300025913 Bacteria 1057
354 Ga0207695_10543928 3300025913 Unclassified 1043
355 Ga0207671_10026965 3300025914 Bacteria 4298
356 Ga0207671_10120052 3300025914 Bacteria 2009
357 Ga0207671_10207850 3300025914 Bacteria 1530
358 Ga0207671_10215868 3300025914 Bacteria 1502
359 Ga0207671_10462381 3300025914 Unclassified 1011
360 Ga0207693_10000803 3300025915 Bacteria 28075
361 Ga0207693_10001563 3300025915 Bacteria 20206
362 Ga0207693_10002401 3300025915 Bacteria 16261
363 Ga0207693_10009010 3300025915 Bacteria 8144
364 Ga0207693_10020554 3300025915 Bacteria 5249
365 Ga0207693_10067467 3300025915 Bacteria 2801
366 Ga0207663_10007521 3300025916 Bacteria 5654
367 Ga0207663_10011595 3300025916 Bacteria 4739
368 Ga0207663_10018939 3300025916 Bacteria 3867
369 Ga0207663_10025871 3300025916 Bacteria 3400
370 Ga0207663_10087354 3300025916 Bacteria 2059
371 Ga0207663_10090317 3300025916 Bacteria 2031
372 Ga0207662_10000490 3300025918 Bacteria 17660
373 Ga0207657_10000458 3300025919 Bacteria 43216
374 Ga0207657_10002016 3300025919 Bacteria 21946
375 Ga0207657_10007263 3300025919 Bacteria 11379
376 Ga0207649_10001023 3300025920 Bacteria 17250
377 Ga0207652_10302149 3300025921 Bacteria 1444
378 Ga0207646_10001577 3300025922 Bacteria 27856
379 Ga0207646_10005629 3300025922 Bacteria 13157
380 Ga0207646_10131397 3300025922 Bacteria 2253
381 Ga0207646_10204713 3300025922 Bacteria 1783
382 Ga0207646_10221413 3300025922 Bacteria 1710
383 Ga0207646_10377396 3300025922 Bacteria 1281
384 Ga0207681_10210021 3300025923 Bacteria 1500
385 Ga0207650_10000058 3300025925 Bacteria 153056
386 Ga0207659_10011810 3300025926 Bacteria 5529
387 Ga0207687_10048880 3300025927 Bacteria 2939
388 Ga0207687_10095359 3300025927 Bacteria 2179
389 Ga0207687_10104436 3300025927 Unclassified 2091
390 Ga0207687_10152518 3300025927 Bacteria 1765
391 Ga0207700_10002134 3300025928 Bacteria 11318
392 Ga0207700_10003854 3300025928 Bacteria 8759
393 Ga0207700_10011819 3300025928 Bacteria 5590
394 Ga0207700_10013972 3300025928 Bacteria 5248
395 Ga0207700_10016493 3300025928 Bacteria 4910
396 Ga0207700_10145394 3300025928 Bacteria 1953
397 Ga0207700_10156417 3300025928 Bacteria 1889
398 Ga0207700_10495128 3300025928 Bacteria 1081
399 Ga0207700_10671412 3300025928 Unclassified 924
400 Ga0207664_10000954 3300025929 Bacteria 19503
401 Ga0207664_10025951 3300025929 Bacteria 4422
402 Ga0207664_10050710 3300025929 Bacteria 3273
403 Ga0207664_10054156 3300025929 Bacteria 3178
404 Ga0207664_10104773 3300025929 Bacteria 2343
405 Ga0207664_10348107 3300025929 Bacteria 1311
406 Ga0207644_10166288 3300025931 Bacteria 1718
407 Ga0207690_10013459 3300025932 Bacteria 4916
408 Ga0207706_10000245 3300025933 Bacteria 59509
409 Ga0207706_10000676 3300025933 Bacteria 35793
410 Ga0207706_10004480 3300025933 Bacteria 13126
411 Ga0207686_10012015 3300025934 Bacteria 4754
412 Ga0207686_10117688 3300025934 Bacteria 1803
413 Ga0207686_10132493 3300025934 Bacteria 1711
414 Ga0207670_10013770 3300025936 Bacteria 4781
415 Ga0207669_10410932 3300025937 Unclassified 1063
416 Ga0207704_10116159 3300025938 Bacteria 1820
417 Ga0207665_10000049 3300025939 Bacteria 76350
418 Ga0207665_10034888 3300025939 Bacteria 3338
419 Ga0207665_10143926 3300025939 Unclassified 1702
420 Ga0207691_10003681 3300025940 Bacteria 14868
421 Ga0207711_10003468 3300025941 Bacteria 13652
422 Ga0207711_10030077 3300025941 Bacteria 4580
423 Ga0207711_10590516 3300025941 Bacteria 1036
424 Ga0207689_10000734 3300025942 Bacteria 31550
425 Ga0207689_10008843 3300025942 Bacteria 8746
426 Ga0207661_10000551 3300025944 Bacteria 23963
427 Ga0207661_10317537 3300025944 Unclassified 1400
428 Ga0207679_10000170 3300025945 Bacteria 53584
429 Ga0207667_10004028 3300025949 Bacteria 18049
430 Ga0207667_10457787 3300025949 Unclassified 1296
431 Ga0207651_10058332 3300025960 Bacteria 2667
432 Ga0207712_10093242 3300025961 Bacteria 2222
433 Ga0207712_10126629 3300025961 Unclassified 1940
434 Ga0207640_10240242 3300025981 Bacteria 1399
435 Ga0207677_10002534 3300026023 Bacteria 9578
436 Ga0207677_10134336 3300026023 Unclassified 1884
437 Ga0207677_10322050 3300026023 Bacteria 1285
438 Ga0207703_10010179 3300026035 Bacteria 7370
439 Ga0207703_10022742 3300026035 Bacteria 4924
440 Ga0207703_10094882 3300026035 Bacteria 2516
441 Ga0207639_10023644 3300026041 Bacteria 4438
442 Ga0207639_10383825 3300026041 Bacteria 1262
443 Ga0207678_10003324 3300026067 Bacteria 14500
444 Ga0207678_10140726 3300026067 Unclassified 2059
445 Ga0207708_10353581 3300026075 Bacteria 1206
446 Ga0207702_10010598 3300026078 Bacteria 7703
447 Ga0207702_10221740 3300026078 Bacteria 1762
448 Ga0207641_10000141 3300026088 Bacteria 104338
449 Ga0207641_10060214 3300026088 Bacteria 3236
450 Ga0207641_10176999 3300026088 Unclassified 1951
451 Ga0207641_10474387 3300026088 Bacteria 1212
452 Ga0207641_10679386 3300026088 Bacteria 1013
453 Ga0207648_10001360 3300026089 Bacteria 27048
454 Ga0207648_10010043 3300026089 Bacteria 9004
455 Ga0207648_10046254 3300026089 Bacteria 3815
456 Ga0207648_10131456 3300026089 Bacteria 2203
457 Ga0207676_10000163 3300026095 Bacteria 58243
458 Ga0207674_10000164 3300026116 Bacteria 79381
459 Ga0207674_10237409 3300026116 Bacteria 1770
460 Ga0207683_10004226 3300026121 Bacteria 12404
461 Ga0265358_100640 3300028010 Bacteria 913
462 Ga0265354_1005310 3300028016 Bacteria 1312
463 Ga0265356_1000327 3300028017 Bacteria 8756
464 Ga0265356_1002927 3300028017 Bacteria 2198
465 Ga0268266_10007066 3300028379 Bacteria 10193
466 Ga0268266_10121304 3300028379 Bacteria 2327
467 Ga0268266_10243891 3300028379 Bacteria 1659
468 Ga0268265_10107835 3300028380 Bacteria 2266
469 Ga0268265_10182435 3300028380 Bacteria 1804
470 Ga0268264_10031485 3300028381 Bacteria 4348
471 Ga0268264_10074977 3300028381 Bacteria 2875
472 Ga0268264_10189206 3300028381 Bacteria 1875
473 Ga0268264_10465939 3300028381 Bacteria 1227
474 Ga0265338_10003141 3300028800 Bacteria 23587
475 Ga0265338_10033665 3300028800 Bacteria 4967
476 Ga0265338_10059225 3300028800 Bacteria 3374
477 Ga0265338_10088041 3300028800 Bacteria 2578
478 Ga0265762_1000371 3300030760 Bacteria 7682
479 Ga0265762_1001228 3300030760 Bacteria 4652
480 Ga0265762_1006234 3300030760 Bacteria 2137
481 Ga0265760_10000073 3300031090 Bacteria 25519
482 Ga0265760_10005836 3300031090 Bacteria 3519
483 Ga0265760_10011778 3300031090 Unclassified 2499
484 Ga0265760_10063591 3300031090 Unclassified 1124
485 Ga0265340_10025081 3300031247 Bacteria 3024
486 Ga0265316_10037796 3300031344 Bacteria 3893
487 Ga0265314_10002796 3300031711 Bacteria 17414
488 Ga0307416_100034860 3300032002 Bacteria 3836
489 Ga0316214_1005175 3300033545 Bacteria 1703
490 Ga0373926_0056423 3300035083 Bacteria 1425
491 Ga0373944_0028719 3300035089 Unclassified 1657
492 Ga0373936_0001640 3300035113 Bacteria 8205
493 Ga0373936_0086141 3300035113 Unclassified 1312
494 Ga0373945_0006887 3300035116 Bacteria 3674
495 Ga0373953_0030295 3300035117 Bacteria 2097
496 Ga0373953_0147984 3300035117 Unclassified 1006
497 Ga0373954_0002981 3300035118 Bacteria 7143
498 Ga0373956_0006030 3300035119 Bacteria 4853
499 Ga0373957_0005342 3300035120 Bacteria 3977
500 Ga0373943_0000045 3300035170 Bacteria 42005
501 Ga0373943_0212319 3300035170 Bacteria 1075
502 Ga0373946_0003798 3300035171 Bacteria 5360
503 Ga0373955_0038597 3300035172 Unclassified 2545
504 Ga0373955_0242433 3300035172 Unclassified 1080
505 Ga0373942_0016368 3300035207 Bacteria 1818
506 Ga0373931_0045248 3300035691 Bacteria 2324
507 Ga0373931_0047123 3300035691 Unclassified 2281
508 Ga0373931_0072840 3300035691 Bacteria 1879
509 Ga0373931_0200477 3300035691 Bacteria 1192
510 Ga0373935_0009200 3300035692 Bacteria 5912
511 Ga0373935_0067691 3300035692 Bacteria 2297
512 Ga0373935_0476707 3300035692 Unclassified 904
513 Ga0373927_0000094 3300035695 Bacteria 66764
514 Ga0373927_0018936 3300035695 Bacteria 4517
515 Ga0373927_0106893 3300035695 Bacteria 1822
516 Ga0373933_0040227 3300035724 Bacteria 2753
517 Ga0373933_0159688 3300035724 Bacteria 1431
518 Ga0373947_0004458 3300035725 Bacteria 8214
519 Ga0373947_0040421 3300035725 Bacteria 2778
520 Ga0373947_0125478 3300035725 Bacteria 1634
521 Ga0373937_0025631 3300036401 Bacteria 5325
522 Ga0373937_0028269 3300036401 Bacteria 5072
523 Ga0373937_0053735 3300036401 Bacteria 3695
524 Ga0373937_0066002 3300036401 Bacteria 3332
525 Ga0373925_0000297 3300037068 Bacteria 52136
526 Ga0373925_0012247 3300037068 Bacteria 6206
527 Ga0373925_0017550 3300037068 Bacteria 5190
528 Ga0373925_0021085 3300037068 Bacteria 4747
529 Ga0373925_0058465 3300037068 Bacteria 2891
530 Ga0373925_0066819 3300037068 Bacteria 2711
531 Ga0436364_0922125 3300037853 Bacteria 53089
532 Ga0436361_0136863 3300039447 Unclassified 1509
533 Ga0436363_0403927 3300039450 Bacteria 3679
534 Ga0436363_0999339 3300039450 Bacteria 5829
535 Ga0436363_1713814 3300039450 Bacteria 2586
536 Ga0436362_0715210 3300039453 Bacteria 6681
537 Ga0466964_0231551 3300044706 Bacteria 902
538 Ga0451576_0457735 3300045051 Bacteria 1340
539 Ga0466967_0245191 3300045976 Bacteria 1710
540 Ga0495629_0018013 3300046459 Bacteria 5062
541 Ga0495653_0083013 3300046463 Bacteria 2364
542 Ga0495580_0000954 3300046472 Bacteria 25313
543 Ga0495580_0000981 3300046472 Bacteria 25029
544 Ga0495580_0012724 3300046472 Bacteria 6450
545 Ga0495580_0019299 3300046472 Bacteria 5065
546 Ga0495580_0020393 3300046472 Bacteria 4904
547 Ga0495580_0049222 3300046472 Bacteria 2982
548 Ga0495580_0084236 3300046472 Bacteria 2215
549 Ga0495580_0214473 3300046472 Bacteria 1324
550 Ga0495582_0010404 3300046473 Bacteria 5117
551 Ga0495584_0114751 3300046491 Bacteria 1363
552 Ga0495618_0164287 3300046514 Bacteria 1414
553 Ga0495618_0213834 3300046514 Bacteria 1218
554 Ga0495628_0028207 3300046516 Bacteria 4563
555 Ga0495630_0234746 3300046517 Unclassified 1401
556 Ga0495665_0189509 3300046531 Unclassified 1067
557 Ga0495645_0160432 3300046543 Bacteria 1555
558 Ga0495659_0070420 3300046664 Bacteria 1309
559 Ga0495604_0287036 3300047317 Bacteria 1110
560 Ga0495674_0029967 3300047319 Bacteria 4950
561 Ga0495674_0042482 3300047319 Bacteria 4055
562 Ga0495602_0173664 3300048088 Bacteria 1670
563 Ga0496101_0139356 3300048904 Bacteria 1848
564 Ga0496102_0202130 3300048905 Bacteria 1873
565 Ga0496103_0028762 3300048906 Unclassified 3375
566 Ga0496104_0036430 3300048907 Bacteria 4600
567 Ga0496104_0079634 3300048907 Bacteria 3123
568 Ga0496104_0099206 3300048907 Bacteria 2788
569 Ga0496104_0317898 3300048907 Bacteria 1470
570 Ga0496104_0686552 3300048907 Unclassified 932
571 Ga0496105_0160299 3300048908 Bacteria 1847
572 Ga0496106_0011566 3300048909 Bacteria 6524
573 Ga0496106_0056108 3300048909 Bacteria 2978
574 Ga0496106_0065732 3300048909 Bacteria 2761
575 Ga0496107_0116451 3300048910 Bacteria 1967
576 Ga0496110_0015368 3300048913 Bacteria 6369
577 Ga0496112_0004567 3300048915 Bacteria 11765
578 Ga0496112_0011874 3300048915 Bacteria 7977
579 Ga0496112_0015202 3300048915 Bacteria 7175
580 Ga0496113_0104721 3300048916 Bacteria 2196
581 Ga0496115_0027354 3300048918 Bacteria 4459
582 nmdc:mga05p37_479503_c1 3300050507 Unclassified 1433
583 nmdc:mga0n895_267_c1 3300050512 Bacteria 33978
584 nmdc:mga0n895_328_c1 3300050512 Bacteria 31690
585 nmdc:mga0n895_330579_c1 3300050512 Bacteria 1544
586 nmdc:mga0n895_390237_c1 3300050512 Bacteria 1408
587 nmdc:mga0rr50_29287_c1 3300050513 Bacteria 3881
588 nmdc:mga0rr50_3103_c1 3300050513 Bacteria 9499
589 nmdc:mga0rr50_5107_c1 3300050513 Bacteria 6227
590 nmdc:mga08x19_10864_c1 3300050514 Bacteria 5476
591 nmdc:mga08x19_174769_c1 3300050514 Bacteria 1464
592 nmdc:mga08x19_1996_c1 3300050514 Bacteria 12491
593 nmdc:mga08x19_211966_c1 3300050514 Bacteria 1330
594 nmdc:mga08x19_4330_c1 3300050514 Bacteria 8410
595 nmdc:mga08x19_74481_c1 3300050514 Unclassified 2218
596 nmdc:mga0a205_121626_c1 3300050515 Bacteria 2510
597 nmdc:mga0a205_62622_c1 3300050515 Unclassified 3594
598 Ga0495601_0150324 3300053077 Bacteria 1520
599 Ga0495619_0424826 3300053085 Bacteria 917
600 Ga0068857_100148043
601 MRS1b_contig_2051578
602 JGI24743J22301_10015174
603 JGI24034J26672_10018639
604 JGI24751J29686_10002410
605 Ga0065712_10095528
606 Ga0065715_10090913
607 Ga0065707_10098140
608 Ga0070658_10058679
609 Ga0070676_10013859
610 Ga0070676_10013893
611 Ga0070683_100001812
612 Ga0070690_100058808
613 Ga0070690_100279410
614 Ga0070670_100019493
615 Ga0068869_100007007
616 Ga0068869_100068911
617 Ga0070666_10004600
618 Ga0070666_10036039
619 Ga0070682_100011072
620 Ga0070682_100175607
621 Ga0068868_100014747
622 Ga0068868_100076459
623 Ga0068868_100087167
624 Ga0068868_100360545
625 Ga0070660_100025302
626 Ga0070660_100031169
627 Ga0070689_100002745
628 Ga0070687_100004703
629 Ga0070661_100004154
630 Ga0070668_100001619
631 Ga0070668_100123048
632 Ga0070669_100027731
633 Ga0070675_100249009
634 Ga0070673_100006403
635 Ga0070688_100001450
636 Ga0070688_100288838
637 Ga0070659_100010855
638 Ga0070659_100071444
639 Ga0070709_10250652
640 Ga0070709_10269670
641 Ga0070709_10329188
642 Ga0070709_10407186
643 Ga0070714_100000054
644 Ga0070714_100002700
645 Ga0070714_100267962
646 Ga0070713_100000188
647 Ga0070713_100013628
648 Ga0070713_100033214
649 Ga0070713_100037918
650 Ga0070713_100107742
651 Ga0070713_100123057
652 Ga0070713_100152806
653 Ga0070713_100208514
654 Ga0070710_10017033
655 Ga0070710_10017416
656 Ga0070710_10020302
657 Ga0070710_10062019
658 Ga0070711_100008563
659 Ga0070711_100009334
660 Ga0070711_100128762
661 Ga0070705_100296236
662 Ga0070708_100000730
663 Ga0070708_100007427
664 Ga0070708_100009939
665 Ga0070708_100015025
666 Ga0070708_100029701
667 Ga0070708_100047812
668 Ga0070708_100104433
669 Ga0070708_100241260
670 Ga0070708_100538123
671 Ga0070663_100009470
672 Ga0070663_100015588
673 Ga0070678_100079138
674 Ga0070678_100095795
675 Ga0070662_100170403
676 Ga0070681_10009751
677 Ga0070681_10017997
678 Ga0070681_10031785
679 Ga0070681_10146949
680 Ga0068867_100016014
681 Ga0068867_100031403
682 Ga0070685_10136346
683 Ga0070706_100002945
684 Ga0070706_100007336
685 Ga0070706_100010890
686 Ga0070706_100013671
687 Ga0070706_100036317
688 Ga0070706_100039937
689 Ga0070706_100292033
690 Ga0070706_100327604
691 Ga0070706_100606580
692 Ga0070707_100003616
693 Ga0070707_100009652
694 Ga0070707_100056952
695 Ga0070707_100059004
696 Ga0070707_100464390
697 Ga0070698_100000148
698 Ga0070698_100087452
699 Ga0070698_100144228
700 Ga0070699_100002194
701 Ga0070699_100004195
702 Ga0070699_100105248
703 Ga0070699_100114315
704 Ga0070679_100283496
705 Ga0070684_100003934
706 Ga0070697_100000039
707 Ga0070697_100002043
708 Ga0070697_100004221
709 Ga0070697_100006833
710 Ga0070697_100007244
711 Ga0070697_100008831
712 Ga0070697_100010375
713 Ga0070697_100020736
714 Ga0070697_100030939
715 Ga0070697_100124001
716 Ga0070697_100278931
717 Ga0070697_100306728
718 Ga0070697_100381548
719 Ga0070697_100436060
720 Ga0068853_100040056
721 Ga0068853_100096505
722 Ga0068853_100138612
723 Ga0070672_100003007
724 Ga0070686_100018758
725 Ga0070686_100089156
726 Ga0070695_100029108
727 Ga0070695_100345500
728 Ga0070696_100130905
729 Ga0070693_100010458
730 Ga0070693_100045930
731 Ga0070693_100178209
732 Ga0070665_100003382
733 Ga0070665_100105948
734 Ga0068855_100239601
735 Ga0070664_100017892
736 Ga0068857_100002703
737 Ga0068854_100031158
738 Ga0068854_100046248
739 Ga0068856_100051512
740 Ga0068856_100094688
741 Ga0068856_100766882
742 Ga0068852_100009510
743 Ga0068852_100030604
744 Ga0068852_100581254
745 Ga0068859_100004309
746 Ga0068859_100162380
747 Ga0068864_100008182
748 Ga0068864_100209160
749 Ga0068866_10005454
750 Ga0068866_10012141
751 Ga0068866_10105595
752 Ga0068861_100470144
753 Ga0068851_10005289
754 Ga0068870_10006731
755 Ga0068863_100023996
756 Ga0068863_100067013
757 Ga0068863_100562263
758 Ga0068858_100033851
759 Ga0068858_100038693
760 Ga0068858_100068812
761 Ga0068860_100117482
762 Ga0068860_100120035
763 Ga0068860_100614513
764 Ga0068862_100012812
765 Ga0068862_100114239
766 Ga0070717_10000248
767 Ga0070717_10003342
768 Ga0070717_10012122
769 Ga0070717_10034507
770 Ga0070717_10059223
771 Ga0070717_10099809
772 Ga0070717_10099959
773 Ga0070717_10132841
774 Ga0070717_10215282
775 Ga0070715_10036351
776 Ga0070716_100000300
777 Ga0070716_100000576
778 Ga0070716_100010396
779 Ga0070716_100189973
780 Ga0070712_100000093
781 Ga0070712_100000797
782 Ga0070712_100010201
783 Ga0070712_100012460
784 Ga0070712_100067962
785 Ga0070712_100109640
786 Ga0070712_100217447
787 Ga0070712_100392732
788 Ga0097621_100073382
789 Ga0097621_100089993
790 Ga0068871_100005766
791 Ga0068871_100108537
792 Ga0068871_100272709
793 Ga0075433_10026498
794 Ga0075433_10033870
795 Ga0075434_100000035
796 Ga0075434_100001469
797 Ga0075434_100005703
798 Ga0075434_100312367
799 Ga0075434_100338095
800 Ga0068865_100049331
801 Ga0068865_100080185
802 Ga0075436_100007889
803 Ga0075436_100014814
804 Ga0075436_100135427
805 Ga0097620_100004309
806 Ga0097620_100162377
807 Ga0075435_100004622
808 Ga0075435_100012095
809 Ga0075435_100066847
810 Ga0099794_10130724
811 Ga0105240_10010032
812 Ga0105240_10033170
813 Ga0105240_10043615
814 Ga0105240_10092820
815 Ga0105240_10210093
816 Ga0105240_10519363
817 Ga0105245_10004304
818 Ga0105245_10204324
819 Ga0105247_10009259
820 Ga0105247_10010685
821 Ga0105247_10022919
822 Ga0114129_10227333
823 Ga0105241_10002597
824 Ga0105241_10003642
825 Ga0105241_10013320
826 Ga0105241_10037614
827 Ga0105241_10064403
828 Ga0105241_10313368
829 Ga0105242_10075729
830 Ga0105248_10088652
831 Ga0105248_10108668
832 Ga0105248_10159096
833 Ga0105248_10474527
834 Ga0105237_10009578
835 Ga0105237_10038140
836 Ga0105237_10078286
837 Ga0105237_10526247
838 Ga0105238_10041257
839 Ga0105238_10051660
840 Ga0105249_10007834
841 Ga0099796_10083151
842 Ga0105239_10017057
843 Ga0105239_10057313
844 Ga0157373_10000997
845 Ga0157371_10009043
846 Ga0157371_10028491
847 Ga0157370_10231221
848 Ga0157370_10474163
849 Ga0157369_10006423
850 Ga0157369_10023806
851 Ga0157369_10111546
852 Ga0157369_10274895
853 Ga0157374_10002303
854 Ga0157374_10006723
855 Ga0157374_10009493
856 Ga0157374_10050455
857 Ga0157374_10093736
858 Ga0157374_10098257
859 Ga0157374_10243094
860 Ga0157374_10628235
861 Ga0157378_10000353
862 Ga0157378_10034835
863 Ga0157378_10132742
864 Ga0163162_10000451
865 Ga0163162_10004222
866 Ga0163162_10237200
867 Ga0163162_10277470
868 Ga0157372_10005475
869 Ga0157372_10009260
870 Ga0157372_10018315
871 Ga0157372_10027436
872 Ga0157372_10062302
873 Ga0157372_10086882
874 Ga0157372_10163083
875 Ga0157375_10079450
876 Ga0157375_10158981
877 Ga0157375_10453821
878 Ga0163163_10001664
879 Ga0163163_10072701
880 Ga0163163_10083256
881 Ga0163163_10569221
882 Ga0157380_10584433
883 Ga0182008_10026264
884 Ga0157379_10006063
885 Ga0157379_10045653
886 Ga0157379_10086686
887 Ga0157379_10386339
888 Ga0157376_10022459
889 Ga0157376_10086167
890 Ga0157376_10095528
891 Ga0157376_10198270
892 Ga0182006_1021003
893 Ga0182006_1028227
894 Ga0182007_10001416
895 Ga0182005_1022280
896 Ga0182005_1047966
897 Ga0163161_10012942
898 Ga0213874_10006143
899 Ga0213874_10016247
900 Ga0213875_10010600
901 Ga0224570_101163
902 Ga0224569_100264
903 Ga0224569_102944
904 Ga0224572_1002700
905 Ga0224572_1005918
906 Ga0224572_1009061
907 Ga0224572_1009858
908 Ga0224572_1030362
909 Ga0228598_1000059
910 Ga0228598_1000496
911 Ga0228598_1001279
912 Ga0228598_1002212
913 Ga0207697_10013962
914 Ga0207656_10007011
915 Ga0207692_10003179
916 Ga0207692_10016731
917 Ga0207692_10057475
918 Ga0207642_10013481
919 Ga0207642_10017898
920 Ga0207642_10066362
921 Ga0207710_10009900
922 Ga0207710_10075444
923 Ga0207688_10031716
924 Ga0207688_10087106
925 Ga0207680_10039809
926 Ga0207680_10195552
927 Ga0207647_10004222
928 Ga0207647_10004616
929 Ga0207699_10041703
930 Ga0207699_10086451
931 Ga0207645_10000330
932 Ga0207643_10002946
933 Ga0207684_10000447
934 Ga0207684_10002057
935 Ga0207684_10017379
936 Ga0207684_10073862
937 Ga0207684_10188233
938 Ga0207684_10191405
939 Ga0207684_10272746
940 Ga0207684_10491455
941 Ga0207654_10001303
942 Ga0207654_10012491
943 Ga0207654_10112597
944 Ga0207654_10112748
945 Ga0207654_10227892
946 Ga0207654_10366496
947 Ga0207707_10156204
948 Ga0207695_10027638
949 Ga0207695_10131128
950 Ga0207695_10238147
951 Ga0207695_10414937
952 Ga0207695_10531562
953 Ga0207695_10543928
954 Ga0207671_10026965
955 Ga0207671_10120052
956 Ga0207671_10207850
957 Ga0207671_10215868
958 Ga0207671_10462381
959 Ga0207693_10000803
960 Ga0207693_10001563
961 Ga0207693_10002401
962 Ga0207693_10009010
963 Ga0207693_10020554
964 Ga0207693_10067467
965 Ga0207663_10007521
966 Ga0207663_10011595
967 Ga0207663_10018939
968 Ga0207663_10025871
969 Ga0207663_10087354
970 Ga0207663_10090317
971 Ga0207662_10000490
972 Ga0207657_10000458
973 Ga0207657_10002016
974 Ga0207657_10007263
975 Ga0207649_10001023
976 Ga0207652_10302149
977 Ga0207646_10001577
978 Ga0207646_10005629
979 Ga0207646_10131397
980 Ga0207646_10204713
981 Ga0207646_10221413
982 Ga0207646_10377396
983 Ga0207681_10210021
984 Ga0207650_10000058
985 Ga0207659_10011810
986 Ga0207687_10048880
987 Ga0207687_10095359
988 Ga0207687_10104436
989 Ga0207687_10152518
990 Ga0207700_10002134
991 Ga0207700_10003854
992 Ga0207700_10011819
993 Ga0207700_10013972
994 Ga0207700_10016493
995 Ga0207700_10145394
996 Ga0207700_10156417
997 Ga0207700_10495128
998 Ga0207700_10671412
999 Ga0207664_10000954
1000 Ga0207664_10025951
1001 Ga0207664_10050710
1002 Ga0207664_10054156
1003 Ga0207664_10104773
1004 Ga0207664_10348107
1005 Ga0207644_10166288
1006 Ga0207690_10013459
1007 Ga0207706_10000245
1008 Ga0207706_10000676
1009 Ga0207706_10004480
1010 Ga0207686_10012015
1011 Ga0207686_10117688
1012 Ga0207686_10132493
1013 Ga0207670_10013770
1014 Ga0207669_10410932
1015 Ga0207704_10116159
1016 Ga0207665_10000049
1017 Ga0207665_10034888
1018 Ga0207665_10143926
1019 Ga0207691_10003681
1020 Ga0207711_10003468
1021 Ga0207711_10030077
1022 Ga0207711_10590516
1023 Ga0207689_10000734
1024 Ga0207689_10008843
1025 Ga0207661_10000551
1026 Ga0207661_10317537
1027 Ga0207679_10000170
1028 Ga0207667_10004028
1029 Ga0207667_10457787
1030 Ga0207651_10058332
1031 Ga0207712_10093242
1032 Ga0207712_10126629
1033 Ga0207640_10240242
1034 Ga0207677_10002534
1035 Ga0207677_10134336
1036 Ga0207677_10322050
1037 Ga0207703_10010179
1038 Ga0207703_10022742
1039 Ga0207703_10094882
1040 Ga0207639_10023644
1041 Ga0207639_10383825
1042 Ga0207678_10003324
1043 Ga0207678_10140726
1044 Ga0207708_10353581
1045 Ga0207702_10010598
1046 Ga0207702_10221740
1047 Ga0207641_10000141
1048 Ga0207641_10060214
1049 Ga0207641_10176999
1050 Ga0207641_10474387
1051 Ga0207641_10679386
1052 Ga0207648_10001360
1053 Ga0207648_10010043
1054 Ga0207648_10046254
1055 Ga0207648_10131456
1056 Ga0207676_10000163
1057 Ga0207674_10000164
1058 Ga0207674_10237409
1059 Ga0207683_10004226
1060 Ga0265358_100640
1061 Ga0265354_1005310
1062 Ga0265356_1000327
1063 Ga0265356_1002927
1064 Ga0268266_10007066
1065 Ga0268266_10121304
1066 Ga0268266_10243891
1067 Ga0268265_10107835
1068 Ga0268265_10182435
1069 Ga0268264_10031485
1070 Ga0268264_10074977
1071 Ga0268264_10189206
1072 Ga0268264_10465939
1073 Ga0265338_10003141
1074 Ga0265338_10033665
1075 Ga0265338_10059225
1076 Ga0265338_10088041
1077 Ga0265762_1000371
1078 Ga0265762_1001228
1079 Ga0265762_1006234
1080 Ga0265760_10000073
1081 Ga0265760_10005836
1082 Ga0265760_10011778
1083 Ga0265760_10063591
1084 Ga0265340_10025081
1085 Ga0265316_10037796
1086 Ga0265314_10002796
1087 Ga0307416_100034860
1088 Ga0316214_1005175
1089 Ga0373926_0056423
1090 Ga0373944_0028719
1091 Ga0373936_0001640
1092 Ga0373936_0086141
1093 Ga0373945_0006887
1094 Ga0373953_0030295
1095 Ga0373953_0147984
1096 Ga0373954_0002981
1097 Ga0373956_0006030
1098 Ga0373957_0005342
1099 Ga0373943_0000045
1100 Ga0373943_0212319
1101 Ga0373946_0003798
1102 Ga0373955_0038597
1103 Ga0373955_0242433
1104 Ga0373942_0016368
1105 Ga0373931_0045248
1106 Ga0373931_0047123
1107 Ga0373931_0072840
1108 Ga0373931_0200477
1109 Ga0373935_0009200
1110 Ga0373935_0067691
1111 Ga0373935_0476707
1112 Ga0373927_0000094
1113 Ga0373927_0018936
1114 Ga0373927_0106893
1115 Ga0373933_0040227
1116 Ga0373933_0159688
1117 Ga0373947_0004458
1118 Ga0373947_0040421
1119 Ga0373947_0125478
1120 Ga0373937_0025631
1121 Ga0373937_0028269
1122 Ga0373937_0053735
1123 Ga0373937_0066002
1124 Ga0373925_0000297
1125 Ga0373925_0012247
1126 Ga0373925_0017550
1127 Ga0373925_0021085
1128 Ga0373925_0058465
1129 Ga0373925_0066819
1130 Ga0436364_0922125
1131 Ga0436361_0136863
1132 Ga0436363_0403927
1133 Ga0436363_0999339
1134 Ga0436363_1713814
1135 Ga0436362_0715210
1136 Ga0466964_0231551
1137 Ga0451576_0457735
1138 Ga0466967_0245191
1139 Ga0495629_0018013
1140 Ga0495653_0083013
1141 Ga0495580_0000954
1142 Ga0495580_0000981
1143 Ga0495580_0012724
1144 Ga0495580_0019299
1145 Ga0495580_0020393
1146 Ga0495580_0049222
1147 Ga0495580_0084236
1148 Ga0495580_0214473
1149 Ga0495582_0010404
1150 Ga0495584_0114751
1151 Ga0495618_0164287
1152 Ga0495618_0213834
1153 Ga0495628_0028207
1154 Ga0495630_0234746
1155 Ga0495665_0189509
1156 Ga0495645_0160432
1157 Ga0495659_0070420
1158 Ga0495604_0287036
1159 Ga0495674_0029967
1160 Ga0495674_0042482
1161 Ga0495602_0173664
1162 Ga0496101_0139356
1163 Ga0496102_0202130
1164 Ga0496103_0028762
1165 Ga0496104_0036430
1166 Ga0496104_0079634
1167 Ga0496104_0099206
1168 Ga0496104_0317898
1169 Ga0496104_0686552
1170 Ga0496105_0160299
1171 Ga0496106_0011566
1172 Ga0496106_0056108
1173 Ga0496106_0065732
1174 Ga0496107_0116451
1175 Ga0496110_0015368
1176 Ga0496112_0004567
1177 Ga0496112_0011874
1178 Ga0496112_0015202
1179 Ga0496113_0104721
1180 Ga0496115_0027354
1181 nmdc:mga05p37_479503_c1
1182 nmdc:mga0n895_267_c1
1183 nmdc:mga0n895_328_c1
1184 nmdc:mga0n895_330579_c1
1185 nmdc:mga0n895_390237_c1
1186 nmdc:mga0rr50_29287_c1
1187 nmdc:mga0rr50_3103_c1
1188 nmdc:mga0rr50_5107_c1
1189 nmdc:mga08x19_10864_c1
1190 nmdc:mga08x19_174769_c1
1191 nmdc:mga08x19_1996_c1
1192 nmdc:mga08x19_211966_c1
1193 nmdc:mga08x19_4330_c1
1194 nmdc:mga08x19_74481_c1
1195 nmdc:mga0a205_121626_c1
1196 nmdc:mga0a205_62622_c1
1197 Ga0495601_0150324
1198 Ga0495619_0424826

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00528

BPD_transp_1

Binding-protein-dependent transport system inner membrane component

116

318

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
2onk-assembly2.cif.gz_I abc transporter modbc in complex with its binding protein moda 0.6538 13 271
7cad-assembly1.cif.gz_A mycobacterium smegmatis sugabc complex 0.6522 4 269
8hps-assembly1.cif.gz_A lpqy-sugabc in state 5 0.6516 4 271
8hpl-assembly1.cif.gz_A lpqy-sugabc in state 1 0.6509 4 269
2onk-assembly2.cif.gz_I abc transporter modbc in complex with its binding protein moda 0.6329 13 271
ID Description Score Start End Superfamily
af_Q2G2B0_2_264_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.7039 4 268 1.10.3720.10
af_P0AFK4_1_269_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.6871 13 275 1.10.3720.10
af_P77156_29_305_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.6852 8 272 1.10.3720.10
af_Q2G2B0_2_264_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.685 4 268 1.10.3720.10
af_P71745_27_277_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.6738 14 269 1.10.3720.10
ID Description Score Start End GO Terms
AF-A0A382Y7A1-F1-model_v4 ABC transmembrane type-1 domain-containing protein 0.892 59 223 GO:0005886
GO:0055085
AF-X1RM70-F1-model_v4 ABC transmembrane type-1 domain-containing protein 0.8875 1 227 GO:0005886
GO:0055085
AF-A0A382Y7A1-F1-model_v4 ABC transmembrane type-1 domain-containing protein 0.8772 59 223 GO:0005886
GO:0055085
AF-A0A1F8NN21-F1-model_v4 Spermidine/putrescine ABC transporter permease 0.8594 7 224 GO:0005886
GO:0055085
AF-A0A2V7HUW3-F1-model_v4 ABC transmembrane type-1 domain-containing protein 0.8561 31 228 GO:0005886
GO:0055085

Map