F467776

General Info

Members Datasets Scaffolds Average Seq Length
598 410 443 246

Family's Representative Sequence

Representative Sequence 3300009036|Ga0105244_10104706|Ga0105244_101047062
Length 279
Sequence VIATGQQGILPTAPQQHIMGKQPTPQGYQSMSRLQNKTALITGGTSGIGLETARQFIAEGARVAITGSSANSVAAARAELGDKAIVIQADAGNVAGQQVVAEAIKNAFGHLDILFVNAGVAEFGPVEQWTEAAFDKSIAINVKGPFFLIQALLPLFSKQAAIVLNTSINAHIGMPNSSVYSLTKGALLTLAKTLSGELIGRGIRVNAVSPGPIATPLYSKLGASEADSKAMADHIQSQIPVGRFGDAAEVAKTVIFLASDEAAYIVGSELVIDGGMSNL

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2501025501 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
3 2501025502 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
4 2501025504 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
5 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
6 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
7 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
8 2510917013 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
9 2510917014 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
10 2510917015 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
11 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
12 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
13 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
14 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
15 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
16 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
17 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
18 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
19 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
20 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
21 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
22 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
23 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
24 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
25 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
26 2515154189 Paraburkholderia nodosa DSM 21604 Isolate Unclassified
27 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
28 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
29 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
30 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
31 2519103095 Burkholderia sp. KJ006 Isolate Nodule
32 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
33 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
34 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
35 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
36 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
37 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
38 2582581311 Burkholderia sp. WP42 Isolate Rhizosphere
39 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
40 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
41 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
42 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
43 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
44 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
45 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
46 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
47 2599185239 Burkholderia sp. NFACC38-1 Isolate Rhizoplane
48 2599185240 Burkholderia sp. NFPP32 Isolate Rhizoplane
49 2599185355 Burkholderia sp. NFACC33-1 Isolate Rhizoplane
50 2643221585 Pelomonas sp. Root662 Isolate Unclassified
51 2643221599 Rhizobium sp. Root708 Isolate Unclassified
52 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
53 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
54 2643221656 Pelomonas sp. Root405 Isolate Unclassified
55 2675903129 Burkholderia pyrrocinia NFIX32 Isolate Rhizoplane
56 2721755763 Pandoraea thiooxydans ATSB16 Isolate Rhizosphere
57 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
58 2738541293 Rhizobium sp. GV031 Isolate Unclassified
59 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
60 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
61 2791354903 Mangrovibacter phragmitis MP23 Isolate Unclassified
62 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
63 2791355266 Rhizobium sp. L43 Isolate Nodule
64 2791355267 Rhizobium sp. L18 Isolate Nodule
65 2802429633 Rhizobium anhuiense J3 Isolate Nodule
66 2802429634 Rhizobium anhuiense S10 Isolate Nodule
67 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
68 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
69 2802429637 Rhizobium anhuiense C15 Isolate Nodule
70 2808606384 Burkholderia sp. SJZ089 Isolate Rhizosphere
71 2808606390 Burkholderia sp. SJZ115 Isolate Rhizosphere
72 2808606391 Burkholderia sp. SJZ091 Isolate Rhizosphere
73 2816332253 Burkholderia vietnamiensis HI2297 Isolate Unclassified
74 2816332256 Burkholderia vietnamiensis MSMB608WGS Isolate Unclassified
75 2816332286 Burkholderia vietnamiensis HI2221 Isolate Rhizosphere
76 2818991452 Burkholderia cepacia 561 Isolate Unclassified
77 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
78 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
79 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
80 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
81 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
82 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
83 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
84 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
85 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
86 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
87 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
88 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
89 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
90 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
91 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
92 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
93 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
94 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
95 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
96 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
97 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
98 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
99 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
100 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
101 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
102 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
103 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
104 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
105 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
106 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
107 2857357740 Paraburkholderia tropica BE15 Isolate Rhizosphere
108 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
109 2863421361 Burkholderia cenocepacia CACua-24 Isolate Rhizosphere
110 2870068957 Burkholderia sp. JP2-270 Isolate Unclassified
111 2904564687 Burkholderia sp. 571 Isolate Unclassified
112 2904571731 Burkholderia cenocepacia 574 Isolate Unclassified
113 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
114 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
115 2928157003 Burkholderia ambifaria 566 Isolate Unclassified
116 2928163908 Burkholderia sp. 567 Isolate Unclassified
117 2928170801 Burkholderia sp. 572 Isolate Unclassified
118 2928536128 Burkholderia sola 565 Isolate Unclassified
119 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
120 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
121 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
122 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
123 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
124 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
125 2981990288 Burkholderia sp. PvR073 Isolate Rhizosphere
126 2996887358 Rhizobium sp. R711 Isolate Nodule
127 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
128 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
129 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
130 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
131 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
132 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
133 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
134 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
135 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
136 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
137 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
138 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
139 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
140 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
141 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
142 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
143 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
144 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
145 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
146 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
147 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
148 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
149 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
150 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
151 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
152 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
153 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
154 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
155 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
156 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
157 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
158 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
159 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
160 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
161 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
162 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
163 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
164 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
165 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
166 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
167 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
168 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
169 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
170 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
171 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
172 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
173 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
174 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
175 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
176 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
177 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
178 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
179 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
180 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
181 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
182 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
183 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
184 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
185 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
186 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
187 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
188 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
189 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
190 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
191 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
192 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
193 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
194 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
195 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
196 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
197 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
198 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
199 3300015685 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 Metagenome Unclassified
200 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
201 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
202 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
203 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
204 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
205 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
206 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
207 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
208 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
209 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
210 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
211 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
212 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
213 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
214 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
215 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
216 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
217 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
218 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
219 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
220 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
221 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
222 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
223 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
224 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
235 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
237 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
238 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
239 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
240 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
241 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
242 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
243 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
244 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
245 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
246 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
247 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
248 3300030083 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JPPOOL-T1 Metagenome Unclassified
249 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
250 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
251 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
252 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
253 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
254 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
255 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
256 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
257 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
258 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
259 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
260 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
261 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
262 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
263 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
264 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
265 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
266 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
267 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
268 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
269 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
270 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
271 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
272 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
273 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
274 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
275 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
276 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
277 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
278 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
279 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
280 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
281 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
282 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
283 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
284 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
285 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
286 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
287 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
288 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
289 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
290 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
291 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
292 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
293 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
294 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
295 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
296 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
297 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
298 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
299 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
300 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
301 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
302 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
303 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
304 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
305 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
306 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
307 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
308 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
309 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
310 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
311 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
312 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
313 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
314 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
315 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
316 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
317 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
318 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
319 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
320 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
321 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
322 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
323 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
324 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
325 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
326 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
327 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
328 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
329 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
330 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
331 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
332 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
333 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
334 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
335 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
336 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
337 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
338 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
339 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
340 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
341 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
342 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
343 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
344 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
345 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
346 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
347 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
348 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
349 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
350 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
351 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
352 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
353 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
354 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
355 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
356 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
357 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
358 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
359 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
360 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
361 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
362 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
363 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
364 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
365 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
366 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
367 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
368 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
369 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
370 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
371 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
372 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
373 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
374 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
375 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
376 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
377 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
378 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
379 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
380 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
381 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
382 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
383 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
384 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
385 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
386 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
387 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
388 641736154 Burkholderia ambifaria IOP40-10 Isolate Rhizosphere
389 8005258706 Rhizobium sp. R693 Isolate Nodule
390 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
391 8005321885 Rhizobium sp. R72 Isolate Nodule
392 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
393 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
394 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
395 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
396 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
397 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
398 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
399 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
400 8018845410 Burkholderia reimsis BE51 Isolate Rhizosphere
401 8020807995 Burkholderia sp. B10 Isolate Rhizosphere
402 8020938398 Burkholderia sp. BE12 Isolate Rhizosphere
403 8020945358 Burkholderia sp. BE17 Isolate Rhizosphere
404 8020953355 Burkholderia sp. BE24 Isolate Rhizosphere
405 8021120328 Burkholderia sp. LS-044 Isolate Rhizosphere
406 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
407 8040167225 Burkholderia vietnamiensis RS1 Isolate Unclassified
408 8040173305 Burkholderia vietnamiensis BE10 Isolate Rhizosphere
409 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
410 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 74.08
Metatranscriptomes 0
Isolates 25.92

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 22.24
Nodule 13.71
Rhizoplane 3.34
Rhizosphere 43.31
Stem 0
Stem Tuber 0
Unclassified 17.39

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_2475022 2162886007 Bacteria 15440
2 JGI24740J21852_10034124 3300001979 Bacteria 1606
3 JGI24739J22299_10000239 3300001989 Bacteria 18515
4 JGI24739J22299_10023204 3300001989 Bacteria 2194
5 JGI25162J39368_1001134 3300002737 Bacteria 16033
6 JGI25158J39367_1000011 3300002739 Bacteria 50391
7 JGI25152J39213_1001231 3300002773 Bacteria 11700
8 JGI25152J39213_1002619 3300002773 Bacteria 6698
9 JGI25152J39213_1003698 3300002773 Bacteria 5132
10 JGI25150J39212_1000133 3300002774 Bacteria 41648
11 JGI25150J39212_1006065 3300002774 Bacteria 2528
12 JGI25159J45721_1000244 3300002987 Bacteria 25671
13 JGI25159J45721_1002544 3300002987 Bacteria 6862
14 JGI25151J46595_10000407 3300003187 Bacteria 44348
15 JGI25151J46595_10004226 3300003187 Bacteria 7641
16 JGI25165J46597_1000607 3300003214 Bacteria 30530
17 JGI25153J46596_10001273 3300003215 Bacteria 15147
18 JGI25153J46596_10001632 3300003215 Bacteria 13301
19 JGI25153J46596_10001698 3300003215 Bacteria 13067
20 JGI25153J46596_10005424 3300003215 Bacteria 6698
21 rootH1_10081334 3300003316 Bacteria 3666
22 rootH2_10005432 3300003320 Bacteria 62845
23 JGI25160J50197_1000012 3300003354 Bacteria 267582
24 JGI25160J50197_1019671 3300003354 Bacteria 2062
25 JGI25161J50226_1000002 3300003374 Bacteria 420324
26 JGI25161J50226_1000186 3300003374 Bacteria 40917
27 Ga0055532_1000131 3300003758 Bacteria 74083
28 Ga0055532_1000384 3300003758 Bacteria 22565
29 Ga0055532_1000429 3300003758 Bacteria 20037
30 Ga0055527_1000357 3300003760 Bacteria 21933
31 Ga0055527_1000870 3300003760 Bacteria 7836
32 Ga0055535_1000217 3300003761 Bacteria 60534
33 Ga0055535_1000815 3300003761 Bacteria 22469
34 Ga0055542_1000253 3300003762 Bacteria 60534
35 Ga0055529_1000183 3300003763 Bacteria 86414
36 Ga0055529_1003327 3300003763 Bacteria 2704
37 Ga0055526_1004194 3300003771 Bacteria 8758
38 Ga0055526_1048406 3300003771 Bacteria 990
39 Ga0055524_1002812 3300003775 Bacteria 8740
40 Ga0055524_1023168 3300003775 Bacteria 2006
41 Ga0055524_1037246 3300003775 Bacteria 1293
42 Ga0055528_1000564 3300003790 Bacteria 28157
43 Ga0055528_1000621 3300003790 Bacteria 26381
44 Ga0055528_1003277 3300003790 Bacteria 8238
45 Ga0055528_1022214 3300003790 Bacteria 1983
46 Ga0055528_1027062 3300003790 Bacteria 1626
47 Ga0055540_1000181 3300003792 Bacteria 61906
48 Ga0055540_1003355 3300003792 Bacteria 7777
49 Ga0058692_1004431 3300003856 Bacteria 4162
50 Ga0055543_1000011 3300004625 Bacteria 196089
51 Ga0055543_1000073 3300004625 Bacteria 88583
52 Ga0065165_1000082 3300005262 Bacteria 158536
53 Ga0065165_1005540 3300005262 Bacteria 7034
54 Ga0065165_1005775 3300005262 Bacteria 6770
55 Ga0065704_10070719 3300005289 Bacteria 17139
56 Ga0070660_100000071 3300005339 Bacteria 60600
57 Ga0070661_100290554 3300005344 Bacteria 1270
58 Ga0070668_100024464 3300005347 Bacteria 4577
59 Ga0070669_100185166 3300005353 Bacteria 1631
60 Ga0070671_100182555 3300005355 Bacteria 1776
61 Ga0070674_100015490 3300005356 Bacteria 4760
62 Ga0070659_100000187 3300005366 Bacteria 47538
63 Ga0070714_100099041 3300005435 Bacteria 2565
64 Ga0070714_100115519 3300005435 Bacteria 2382
65 Ga0070713_100169852 3300005436 Unclassified 1953
66 Ga0070713_100703198 3300005436 Bacteria 965
67 Ga0070694_100097599 3300005444 Bacteria 2073
68 Ga0070663_100000223 3300005455 Bacteria 28735
69 Ga0070663_100392771 3300005455 Bacteria 1132
70 Ga0068867_100185560 3300005459 Bacteria 1656
71 Ga0068855_100001605 3300005563 Bacteria 28379
72 Ga0068855_100074340 3300005563 Bacteria 3948
73 Ga0068856_100958307 3300005614 Bacteria 874
74 Ga0068852_100014531 3300005616 Bacteria 6066
75 Ga0068852_100102514 3300005616 Bacteria 2586
76 Ga0068864_100034823 3300005618 Bacteria 4285
77 Ga0068851_10170354 3300005834 Bacteria 1201
78 Ga0068863_100559119 3300005841 Bacteria 1130
79 Ga0075363_100040801 3300006048 Bacteria 2447
80 Ga0075367_10006589 3300006178 Bacteria 5881
81 Ga0075369_10031455 3300006186 Bacteria 2241
82 Ga0075370_10020608 3300006353 Bacteria 3607
83 Ga0075370_10052960 3300006353 Bacteria 2303
84 Ga0075428_100099585 3300006844 Bacteria 3169
85 Ga0075434_100195877 3300006871 Unclassified 2040
86 Ga0105251_10007781 3300009011 Bacteria 6530
87 Ga0105251_10009606 3300009011 Bacteria 5696
88 Ga0105244_10104706 3300009036 Bacteria 1381
89 Ga0105250_10000424 3300009092 Bacteria 30840
90 Ga0105240_10000397 3300009093 Bacteria 81058
91 Ga0105240_10000506 3300009093 Bacteria 71885
92 Ga0105240_10019860 3300009093 Bacteria 8973
93 Ga0105240_10127573 3300009093 Bacteria 3055
94 Ga0114129_10146776 3300009147 Bacteria 3231
95 Ga0105248_10051042 3300009177 Bacteria 4641
96 Ga0105237_10057564 3300009545 Bacteria 3889
97 Ga0105238_10007386 3300009551 Bacteria 11009
98 Ga0105238_10654166 3300009551 Bacteria 1061
99 Ga0123341_1005933 3300009765 Bacteria 10976
100 Ga0123342_1024443 3300009766 Bacteria 3782
101 Ga0157314_1001022 3300012500 Bacteria 2195
102 Ga0157370_10019887 3300013104 Bacteria 6717
103 Ga0157370_10054288 3300013104 Bacteria 3819
104 Ga0157370_10085667 3300013104 Bacteria 2960
105 Ga0157370_10106463 3300013104 Bacteria 2624
106 Ga0157369_10003280 3300013105 Bacteria 19268
107 Ga0157369_10018684 3300013105 Bacteria 7771
108 Ga0157369_10060475 3300013105 Bacteria 4085
109 Ga0157374_10230699 3300013296 Bacteria 1818
110 Ga0157374_10265265 3300013296 Bacteria 1692
111 Ga0157372_10003574 3300013307 Bacteria 16731
112 Ga0163163_10021705 3300014325 Bacteria 6064
113 Ga0163163_10223845 3300014325 Bacteria 1930
114 Ga0157379_10646366 3300014968 Bacteria 990
115 Ga0182006_1005959 3300015261 Bacteria 5725
116 Ga0182006_1017809 3300015261 Bacteria 3012
117 Ga0182007_10003805 3300015262 Bacteria 7028
118 Ga0183369_1003 3300015685 Bacteria 726443
119 Ga0209436_100048 3300025208 Bacteria 66177
120 Ga0209436_107837 3300025208 Bacteria 2188
121 Ga0209566_100217 3300025225 Bacteria 57424
122 Ga0209674_101720 3300025226 Bacteria 5389
123 Ga0209672_100012 3300025228 Bacteria 795742
124 Ga0209672_100030 3300025228 Bacteria 337051
125 Ga0209147_100007 3300025229 Bacteria 795684
126 Ga0209147_100036 3300025229 Bacteria 337052
127 Ga0209147_100076 3300025229 Bacteria 207570
128 Ga0209437_100056 3300025233 Bacteria 363071
129 Ga0209258_100014 3300025242 Bacteria 720132
130 Ga0209258_100056 3300025242 Bacteria 337051
131 Ga0207425_1000466 3300025245 Bacteria 25807
132 Ga0207425_1007175 3300025245 Bacteria 2970
133 Ga0207425_1028545 3300025245 Bacteria 1130
134 Ga0209148_1000178 3300025254 Bacteria 126383
135 Ga0209148_1000277 3300025254 Bacteria 79813
136 Ga0209759_1002312 3300025256 Bacteria 8561
137 Ga0209129_1000066 3300025258 Bacteria 226820
138 Ga0209129_1000308 3300025258 Bacteria 44371
139 Ga0209129_1001949 3300025258 Bacteria 10778
140 Ga0209129_1002123 3300025258 Bacteria 10083
141 Ga0209129_1004035 3300025258 Bacteria 6004
142 Ga0209129_1019889 3300025258 Bacteria 1259
143 Ga0209233_1000071 3300025261 Bacteria 363290
144 Ga0209565_1010305 3300025263 Bacteria 2322
145 Ga0209455_1000061 3300025272 Bacteria 337052
146 Ga0209455_1000590 3300025272 Bacteria 23490
147 Ga0209673_1000024 3300025273 Bacteria 409632
148 Ga0209673_1000046 3300025273 Bacteria 289907
149 Ga0209673_1003542 3300025273 Bacteria 9115
150 Ga0209673_1021864 3300025273 Bacteria 2224
151 Ga0209673_1022267 3300025273 Bacteria 2190
152 Ga0209673_1023030 3300025273 Bacteria 2132
153 Ga0209130_1000002 3300025284 Bacteria 722648
154 Ga0209130_1000028 3300025284 Bacteria 325668
155 Ga0209130_1022628 3300025284 Bacteria 1398
156 Ga0209025_1000919 3300025294 Bacteria 45324
157 Ga0209025_1003062 3300025294 Bacteria 16437
158 Ga0209025_1010422 3300025294 Bacteria 6296
159 Ga0209025_1026742 3300025294 Bacteria 2885
160 Ga0209025_1069250 3300025294 Bacteria 1262
161 Ga0209564_1001614 3300025295 Bacteria 21891
162 Ga0209564_1004395 3300025295 Bacteria 8639
163 Ga0209564_1007194 3300025295 Bacteria 5800
164 Ga0209564_1028520 3300025295 Bacteria 1782
165 Ga0209758_1000788 3300025297 Bacteria 45324
166 Ga0209758_1001309 3300025297 Bacteria 30362
167 Ga0209758_1001692 3300025297 Bacteria 24831
168 Ga0209758_1001755 3300025297 Bacteria 24062
169 Ga0209758_1015103 3300025297 Bacteria 4033
170 Ga0209758_1019553 3300025297 Bacteria 3260
171 Ga0209758_1059760 3300025297 Bacteria 1266
172 Ga0209050_1005821 3300025298 Bacteria 7560
173 Ga0209050_1036794 3300025298 Bacteria 1423
174 Ga0209256_1000667 3300025299 Bacteria 46381
175 Ga0209256_1004378 3300025299 Bacteria 8926
176 Ga0209256_1005435 3300025299 Bacteria 7340
177 Ga0209256_1010994 3300025299 Bacteria 3692
178 Ga0209256_1043550 3300025299 Bacteria 1126
179 Ga0207426_1000012 3300025302 Bacteria 730942
180 Ga0207426_1000013 3300025302 Bacteria 721897
181 Ga0207426_1003768 3300025302 Bacteria 7893
182 Ga0209051_1000228 3300025303 Bacteria 94166
183 Ga0209051_1014226 3300025303 Bacteria 3725
184 Ga0209051_1032941 3300025303 Bacteria 1968
185 Ga0209257_1007373 3300025304 Bacteria 6661
186 Ga0209257_1064132 3300025304 Bacteria 989
187 Ga0207656_10204905 3300025321 Bacteria 954
188 Ga0207696_1000536 3300025711 Bacteria 30858
189 Ga0207647_10006096 3300025904 Bacteria 8786
190 Ga0207647_10018080 3300025904 Bacteria 4778
191 Ga0207695_10000305 3300025913 Bacteria 119810
192 Ga0207695_10000618 3300025913 Bacteria 71425
193 Ga0207695_10115801 3300025913 Bacteria 2655
194 Ga0207671_10015924 3300025914 Bacteria 5863
195 Ga0207671_10042403 3300025914 Bacteria 3368
196 Ga0207671_10090281 3300025914 Bacteria 2307
197 Ga0207657_10000161 3300025919 Bacteria 69107
198 Ga0207681_10595432 3300025923 Bacteria 913
199 Ga0207694_10007801 3300025924 Bacteria 8107
200 Ga0207694_10361584 3300025924 Bacteria 1203
201 Ga0207650_10000347 3300025925 Bacteria 44769
202 Ga0207700_10059272 3300025928 Unclassified 2895
203 Ga0207664_10272991 3300025929 Bacteria 1482
204 Ga0207690_10000016 3300025932 Bacteria 256657
205 Ga0207706_10007475 3300025933 Bacteria 10100
206 Ga0207667_10001356 3300025949 Bacteria 30748
207 Ga0207667_10005426 3300025949 Bacteria 15550
208 Ga0207667_10021135 3300025949 Bacteria 7218
209 Ga0207678_10001686 3300026067 Bacteria 20292
210 Ga0207678_10372135 3300026067 Bacteria 1234
211 Ga0207702_10647081 3300026078 Bacteria 1039
212 Ga0207702_10756942 3300026078 Bacteria 959
213 Ga0207641_10430449 3300026088 Bacteria 1272
214 Ga0207676_10068826 3300026095 Bacteria 2833
215 Ga0207698_10035134 3300026142 Bacteria 3663
216 Ga0209371_1000696 3300027312 Bacteria 28540
217 Ga0268266_10371450 3300028379 Bacteria 1347
218 Ga0268265_10564976 3300028380 Bacteria 1082
219 Ga0307515_10000049 3300028794 Bacteria 278611
220 Ga0307515_10027435 3300028794 Bacteria 9734
221 Ga0307515_10056306 3300028794 Bacteria 5718
222 Ga0265324_10062209 3300029957 Bacteria 1275
223 Ga0237817_11014 3300030083 Bacteria 1702
224 Ga0268256_1001454 3300030500 Bacteria 14249
225 Ga0265328_10012962 3300031239 Bacteria 3308
226 Ga0265320_10038663 3300031240 Bacteria 2392
227 Ga0265327_10000056 3300031251 Bacteria 243974
228 Ga0307509_10394933 3300031507 Bacteria 1092
229 Ga0307408_100277766 3300031548 Bacteria 1394
230 Ga0307405_10000550 3300031731 Bacteria 14248
231 Ga0307406_10064314 3300031901 Bacteria 2380
232 Ga0307412_10001127 3300031911 Bacteria 15298
233 Ga0307412_10147066 3300031911 Bacteria 1734
234 Ga0373931_0072476 3300035691 Bacteria 1884
235 Ga0395899_0222643 3300037312 Bacteria 1306
236 Ga0395900_0064055 3300037418 Bacteria 3779
237 Ga0436364_0780022 3300037853 Bacteria 1501
238 Ga0439436_0006670 3300041404 Bacteria 3547
239 Ga0439439_0043127 3300041406 Bacteria 1173
240 Ga0451789_0132060 3300041443 Bacteria 921
241 Ga0451793_0006762 3300041452 Bacteria 1276
242 Ga0451795_1183767 3300041456 Bacteria 1599
243 Ga0451833_0105841 3300041491 Bacteria 3101
244 Ga0451837_0956710 3300041494 Bacteria 1747
245 Ga0451839_1600287 3300041496 Bacteria 2028
246 Ga0451841_0664988 3300041498 Bacteria 2303
247 Ga0451847_0118416 3300041503 Bacteria 1084
248 Ga0451849_0495765 3300041505 Bacteria 1087
249 Ga0451851_0642284 3300041507 Bacteria 1517
250 Ga0439437_002701 3300042000 Bacteria 1909
251 Ga0450890_001363 3300042127 Bacteria 3526
252 Ga0450903_002568 3300042138 Bacteria 3217
253 Ga0450889_000625 3300042144 Bacteria 3923
254 Ga0450906_012024 3300042145 Bacteria 1609
255 Ga0451577_0003810 3300042876 Bacteria 16417
256 Ga0451577_0054161 3300042876 Bacteria 3581
257 Ga0466961_0009284 3300044693 Bacteria 6261
258 Ga0495617_001983 3300046452 Bacteria 8542
259 Ga0495627_012578 3300046453 Bacteria 2997
260 Ga0495592_0112445 3300046454 Bacteria 1925
261 Ga0495590_0046223 3300046457 Bacteria 1519
262 Ga0495590_0091434 3300046457 Bacteria 1077
263 Ga0495591_030400 3300046458 Bacteria 1630
264 Ga0495638_0159315 3300046460 Bacteria 1303
265 Ga0495651_0005876 3300046462 Bacteria 9359
266 Ga0495650_0000061 3300046471 Bacteria 283347
267 Ga0495650_0066051 3300046471 Bacteria 1433
268 Ga0495650_0103250 3300046471 Bacteria 1068
269 Ga0495605_0000436 3300046474 Bacteria 37694
270 Ga0495605_0020492 3300046474 Bacteria 3513
271 Ga0495585_0003214 3300046492 Bacteria 11151
272 Ga0495594_0002216 3300046499 Bacteria 10104
273 Ga0495607_0025601 3300046501 Bacteria 3667
274 Ga0495583_0000028 3300046506 Bacteria 255787
275 Ga0495583_0007906 3300046506 Bacteria 6595
276 Ga0495606_0001098 3300046507 Bacteria 38718
277 Ga0495606_0003051 3300046507 Bacteria 18253
278 Ga0495606_0022289 3300046507 Bacteria 4617
279 Ga0495606_0026951 3300046507 Bacteria 4082
280 Ga0495606_0072369 3300046507 Bacteria 2166
281 Ga0495606_0127251 3300046507 Bacteria 1518
282 Ga0495606_0157798 3300046507 Bacteria 1326
283 Ga0495610_0000420 3300046512 Bacteria 43578
284 Ga0495610_0001044 3300046512 Bacteria 25446
285 Ga0495610_0058084 3300046512 Bacteria 1852
286 Ga0495620_0000028 3300046515 Bacteria 123172
287 Ga0495620_0062130 3300046515 Bacteria 1552
288 Ga0495628_0091302 3300046516 Bacteria 2357
289 Ga0495631_0004357 3300046518 Bacteria 7543
290 Ga0495632_0104768 3300046519 Bacteria 1331
291 Ga0495637_0009532 3300046520 Bacteria 4732
292 Ga0495643_0002534 3300046522 Bacteria 14326
293 Ga0495643_0051663 3300046522 Bacteria 2210
294 Ga0495644_0065179 3300046523 Bacteria 1369
295 Ga0495648_0111445 3300046524 Bacteria 1488
296 Ga0495654_0024570 3300046530 Bacteria 3111
297 Ga0495609_0000081 3300046538 Bacteria 116100
298 Ga0495597_0002579 3300046542 Bacteria 11317
299 Ga0495597_0094325 3300046542 Bacteria 1267
300 Ga0495645_0224470 3300046543 Bacteria 1262
301 Ga0495622_0056036 3300046557 Bacteria 1828
302 Ga0495622_0090166 3300046557 Bacteria 1409
303 Ga0495633_0000028 3300046558 Bacteria 203214
304 Ga0495656_0028483 3300046615 Bacteria 2241
305 Ga0495668_0084828 3300046616 Bacteria 1737
306 Ga0495611_0004906 3300046648 Bacteria 5740
307 Ga0495611_0047409 3300046648 Bacteria 1929
308 Ga0495625_0044813 3300046660 Bacteria 3200
309 Ga0495625_0107761 3300046660 Bacteria 1907
310 Ga0495625_0120638 3300046660 Bacteria 1784
311 Ga0495661_0000217 3300046665 Bacteria 66241
312 Ga0495670_0003475 3300046691 Bacteria 7738
313 Ga0495670_0025016 3300046691 Bacteria 2952
314 Ga0495671_0003759 3300046692 Bacteria 9222
315 Ga0495589_0000379 3300046794 Bacteria 34046
316 Ga0495600_0136415 3300046809 Bacteria 1594
317 Ga0495660_0004690 3300046810 Bacteria 8247
318 Ga0495660_0060931 3300046810 Bacteria 2025
319 Ga0495604_0002788 3300047317 Bacteria 14017
320 Ga0495674_0014822 3300047319 Bacteria 7294
321 Ga0495680_0034500 3300047322 Bacteria 4084
322 Ga0495683_0000060 3300047323 Bacteria 115881
323 Ga0495687_046019 3300047443 Bacteria 1886
324 Ga0495679_000396 3300047446 Bacteria 32865
325 Ga0495679_038311 3300047446 Bacteria 1502
326 Ga0495673_0005039 3300047469 Bacteria 8090
327 Ga0495681_0010978 3300047470 Bacteria 5436
328 Ga0495681_0129984 3300047470 Bacteria 1073
329 Ga0495686_0003077 3300047472 Bacteria 14761
330 Ga0495686_0058178 3300047472 Bacteria 2410
331 Ga0495686_0082903 3300047472 Bacteria 1956
332 Ga0495686_0117633 3300047472 Bacteria 1587
333 Ga0495686_0129536 3300047472 Bacteria 1497
334 Ga0495686_0196571 3300047472 Bacteria 1159
335 Ga0495626_0121409 3300048091 Bacteria 1123
336 Ga0496100_0615874 3300048903 Bacteria 844
337 Ga0496101_0022927 3300048904 Bacteria 4305
338 Ga0496101_0207727 3300048904 Bacteria 1516
339 Ga0496102_0265128 3300048905 Bacteria 1619
340 Ga0496103_0041057 3300048906 Bacteria 2844
341 Ga0496104_0340786 3300048907 Bacteria 1412
342 Ga0496104_0346432 3300048907 Bacteria 1398
343 Ga0496105_0006245 3300048908 Bacteria 9149
344 Ga0496105_0205778 3300048908 Bacteria 1605
345 Ga0496106_0000433 3300048909 Bacteria 29790
346 Ga0496107_0053728 3300048910 Bacteria 2906
347 Ga0496112_0256817 3300048915 Bacteria 1697
348 Ga0496114_0302462 3300048917 Bacteria 1412
349 Ga0496116_0004348 3300048919 Bacteria 13548
350 Ga0496116_0007352 3300048919 Bacteria 9790
351 Ga0496116_0027382 3300048919 Bacteria 4151
352 Ga0496116_0110131 3300048919 Bacteria 1621
353 Ga0496116_0165675 3300048919 Bacteria 1205
354 Ga0496117_0005361 3300048920 Bacteria 13507
355 Ga0496117_0016578 3300048920 Bacteria 6208
356 Ga0496117_0022940 3300048920 Bacteria 4995
357 Ga0496117_0027866 3300048920 Bacteria 4387
358 Ga0496118_0005583 3300048921 Bacteria 14229
359 Ga0496118_0012262 3300048921 Bacteria 8252
360 Ga0496118_0017099 3300048921 Bacteria 6620
361 Ga0496118_0022731 3300048921 Bacteria 5469
362 Ga0496118_0038124 3300048921 Bacteria 3856
363 Ga0496118_0096393 3300048921 Bacteria 2016
364 Ga0496118_0130330 3300048921 Bacteria 1616
365 Ga0496118_0132716 3300048921 Bacteria 1595
366 Ga0496119_0046815 3300048922 Bacteria 2696
367 Ga0496119_0104571 3300048922 Bacteria 1583
368 Ga0496121_0003993 3300048924 Bacteria 20349
369 Ga0496121_0019111 3300048924 Bacteria 6871
370 Ga0496121_0024968 3300048924 Bacteria 5693
371 Ga0496121_0025819 3300048924 Bacteria 5559
372 Ga0496121_0033459 3300048924 Bacteria 4650
373 Ga0496121_0046359 3300048924 Bacteria 3721
374 Ga0496121_0083027 3300048924 Bacteria 2530
375 Ga0496121_0224846 3300048924 Bacteria 1319
376 Ga0496122_0005948 3300048925 Bacteria 14284
377 Ga0496122_0013136 3300048925 Bacteria 8142
378 Ga0496122_0062840 3300048925 Bacteria 2715
379 Ga0496122_0063369 3300048925 Bacteria 2698
380 Ga0496122_0080142 3300048925 Bacteria 2278
381 Ga0496123_0003014 3300048926 Bacteria 19454
382 Ga0496123_0021021 3300048926 Bacteria 5086
383 Ga0496123_0034042 3300048926 Bacteria 3656
384 Ga0496123_0061668 3300048926 Bacteria 2407
385 Ga0496124_0001760 3300048927 Bacteria 30205
386 Ga0496124_0011817 3300048927 Bacteria 8697
387 Ga0496124_0012177 3300048927 Bacteria 8513
388 Ga0496124_0017708 3300048927 Bacteria 6704
389 Ga0496124_0018792 3300048927 Bacteria 6457
390 Ga0496124_0421244 3300048927 Bacteria 920
391 Ga0496125_0001790 3300048928 Bacteria 29696
392 Ga0496125_0010013 3300048928 Bacteria 9632
393 Ga0496125_0056323 3300048928 Bacteria 3193
394 Ga0496125_0221363 3300048928 Bacteria 1219
395 Ga0496125_0417888 3300048928 Bacteria 778
396 Ga0496126_0061633 3300048929 Bacteria 3369
397 Ga0496126_0331837 3300048929 Bacteria 1248
398 Ga0496126_0419892 3300048929 Bacteria 1081
399 Ga0495678_000020 3300049459 Bacteria 253654
400 Ga0495678_070515 3300049459 Bacteria 1283
401 Ga0501032_0001362 3300049569 Bacteria 19394
402 Ga0501033_0003686 3300049570 Bacteria 12462
403 Ga0501034_0023846 3300049571 Bacteria 6230
404 Ga0501036_0005360 3300049572 Bacteria 10386
405 Ga0501038_0013528 3300049574 Bacteria 7438
406 Ga0501038_0174364 3300049574 Bacteria 1739
407 Ga0501039_0016699 3300049575 Bacteria 5624
408 Ga0501042_0269104 3300049578 Bacteria 1230
409 Ga0501043_0013905 3300049579 Bacteria 6297
410 Ga0501043_0015056 3300049579 Bacteria 6057
411 Ga0501046_0001140 3300049580 Bacteria 25891
412 Ga0501046_0182859 3300049580 Bacteria 1567
413 Ga0501047_0139164 3300049581 Bacteria 2306
414 Ga0501048_0002122 3300049582 Bacteria 15118
415 Ga0501048_0014465 3300049582 Bacteria 5843
416 Ga0501067_0124526 3300049583 Bacteria 1434
417 Ga0501068_0002614 3300049584 Bacteria 9533
418 Ga0501070_0234116 3300049586 Bacteria 1504
419 Ga0501072_0000880 3300049588 Bacteria 22001
420 Ga0501073_0001638 3300049589 Bacteria 16604
421 Ga0501074_0000835 3300049590 Bacteria 19579
422 Ga0501075_0163855 3300049591 Bacteria 1696
423 Ga0501076_0061430 3300049592 Bacteria 2990
424 Ga0501077_0008463 3300049593 Bacteria 6374
425 Ga0501080_0000101 3300049742 Bacteria 58881
426 Ga0501044_0152070 3300049823 Bacteria 2296
427 nmdc:mga08x19_234228_c1 3300050514 Bacteria 1264
428 nmdc:mga0a205_10940_c1 3300050515 Bacteria 8348
429 Ga0500644_0029791 3300053088 Bacteria 1720
430 Ga0500556_0000017 3300053104 Bacteria 192495
431 Ga0500572_047951 3300053111 Bacteria 1263
432 Ga0500618_003162 3300053125 Bacteria 5782
433 Ga0500618_028493 3300053125 Bacteria 1323
434 Ga0500658_0000678 3300053134 Bacteria 14022
435 Ga0500568_0001236 3300053139 Bacteria 16971
436 Ga0500568_0057761 3300053139 Bacteria 1509
437 Ga0500577_0125055 3300053142 Bacteria 1073
438 Ga0500604_0065513 3300053151 Bacteria 1149
439 Ga0500622_0002102 3300053156 Bacteria 14846
440 Ga0500622_0003044 3300053156 Bacteria 11581
441 Ga0500633_0005130 3300053160 Bacteria 3079
442 Ga0500636_0000882 3300053177 Bacteria 16069
443 Ga0501084_0000244 3300054114 Bacteria 41061

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300053125 Ga0500618_028493 Ga0500618_028493_179_961 217
2 3300003771 Ga0055526_1004194 Ga0055526_100419411 222
3 3300003790 Ga0055528_1000564 Ga0055528_100056416 222
4 3300005616 Ga0068852_100102514 Ga0068852_1001025142 222
5 3300013104 Ga0157370_10019887 Ga0157370_100198872 222
6 3300013105 Ga0157369_10003280 Ga0157369_1000328013 222
7 3300048921 Ga0496118_0005583 Ga0496118_0005583_6031_6831 222
8 3300003320 rootH2_10005432 rootH2_1000543213 224
9 3300009093 Ga0105240_10000506 Ga0105240_1000050620 224
10 3300013104 Ga0157370_10085667 Ga0157370_100856672 224
11 3300025273 Ga0209673_1021864 Ga0209673_10218642 224
12 3300025913 Ga0207695_10000618 Ga0207695_1000061817 224
13 3300047472 Ga0495686_0129536 Ga0495686_0129536_602_1351 224
14 3300026067 Ga0207678_10372135 Ga0207678_103721352 225
15 3300048928 Ga0496125_0417888 Ga0496125_0417888_15_764 225
16 3300048929 Ga0496126_0419892 Ga0496126_0419892_54_803 225
17 3300003187 JGI25151J46595_10004226 JGI25151J46595_100042264 226
18 3300025245 Ga0207425_1028545 Ga0207425_10285452 226
19 3300025258 Ga0209129_1000066 Ga0209129_100006616 226
20 3300025294 Ga0209025_1003062 Ga0209025_100306212 226
21 3300025303 Ga0209051_1014226 Ga0209051_10142262 226
22 3300046471 Ga0495650_0103250 Ga0495650_0103250_67_816 226
23 3300003775 Ga0055524_1002812 Ga0055524_10028125 227
24 3300003790 Ga0055528_1000621 Ga0055528_100062111 227
25 3300025273 Ga0209673_1000024 Ga0209673_1000024242 227
26 3300025294 Ga0209025_1010422 Ga0209025_10104225 227
27 3300025295 Ga0209564_1004395 Ga0209564_10043955 227
28 3300025299 Ga0209256_1000667 Ga0209256_100066717 227
29 3300025304 Ga0209257_1064132 Ga0209257_10641322 227
30 3300025925 Ga0207650_10000347 Ga0207650_1000034738 227
31 3300002987 JGI25159J45721_1000244 JGI25159J45721_100024414 228
32 3300003354 JGI25160J50197_1000012 JGI25160J50197_1000012145 228
33 3300003374 JGI25161J50226_1000002 JGI25161J50226_1000002297 228
34 3300004625 Ga0055543_1000011 Ga0055543_100001150 228
35 3300005262 Ga0065165_1000082 Ga0065165_100008214 228
36 3300025208 Ga0209436_107837 Ga0209436_1078372 228
37 3300025284 Ga0209130_1000028 Ga0209130_1000028153 228
38 3300025302 Ga0207426_1000012 Ga0207426_1000012428 228
39 3300046507 Ga0495606_0157798 Ga0495606_0157798_116_865 228
40 3300046660 Ga0495625_0107761 Ga0495625_0107761_259_1008 228
41 3300048922 Ga0496119_0046815 Ga0496119_0046815_128_877 228
42 3300048924 Ga0496121_0019111 Ga0496121_0019111_4812_5561 228
43 3300048928 Ga0496125_0221363 Ga0496125_0221363_17_766 228
44 3300041406 Ga0439439_0043127 Ga0439439_0043127_107_847 229
45 3300041456 Ga0451795_1183767 Ga0451795_1183767_766_1515 229
46 3300046460 Ga0495638_0159315 Ga0495638_0159315_501_1250 229
47 3300046501 Ga0495607_0025601 Ga0495607_0025601_1872_2621 229
48 3300046523 Ga0495644_0065179 Ga0495644_0065179_550_1299 229
49 3300046660 Ga0495625_0044813 Ga0495625_0044813_2009_2758 229
50 3300048921 Ga0496118_0096393 Ga0496118_0096393_907_1656 229
51 3300041452 Ga0451793_0006762 Ga0451793_0006762_218_967 230
52 3300046507 Ga0495606_0072369 Ga0495606_0072369_521_1270 230
53 3300046522 Ga0495643_0051663 Ga0495643_0051663_992_1741 231
54 3300041443 Ga0451789_0132060 Ga0451789_0132060_47_796 232
55 3300041491 Ga0451833_0105841 Ga0451833_0105841_340_1089 232
56 3300046648 Ga0495611_0047409 Ga0495611_0047409_680_1429 232
57 3300046615 Ga0495656_0028483 Ga0495656_0028483_68_817 233
58 3300048915 Ga0496112_0256817 Ga0496112_0256817_980_1684 233
59 3300046507 Ga0495606_0022289 Ga0495606_0022289_3343_4092 235
60 3300046512 Ga0495610_0001044 Ga0495610_0001044_21637_22386 236
61 3300048924 Ga0496121_0083027 Ga0496121_0083027_100_849 237
62 iso_pu_bacteria 2513237159 2514000258 242
63 iso_pu_bacteria 2842521101 2842525927 242
64 iso_pu_bacteria 2852387548 2852388116 242
65 iso_pu_bacteria 2501025501 2501075705 243
66 iso_pu_bacteria 2510917015 2511105378 243
67 iso_pu_bacteria 2721755763 2723877237 243
68 iso_pu_bacteria 2928163908 2928166511 243
69 3300003354 JGI25160J50197_1019671 JGI25160J50197_10196712 244
70 3300003771 Ga0055526_1048406 Ga0055526_10484061 244
71 3300003775 Ga0055524_1023168 Ga0055524_10231681 244
72 3300003790 Ga0055528_1022214 Ga0055528_10222142 244
73 3300003790 Ga0055528_1027062 Ga0055528_10270621 244
74 3300005347 Ga0070668_100024464 Ga0070668_1000244643 244
75 3300005355 Ga0070671_100182555 Ga0070671_1001825551 244
76 3300006353 Ga0075370_10020608 Ga0075370_100206083 244
77 3300009011 Ga0105251_10009606 Ga0105251_100096067 244
78 3300009177 Ga0105248_10051042 Ga0105248_100510425 244
79 3300014325 Ga0163163_10223845 Ga0163163_102238452 244
80 3300025258 Ga0209129_1001949 Ga0209129_10019495 244
81 3300025273 Ga0209673_1023030 Ga0209673_10230302 244
82 3300025284 Ga0209130_1022628 Ga0209130_10226281 244
83 3300025295 Ga0209564_1028520 Ga0209564_10285202 244
84 3300025298 Ga0209050_1036794 Ga0209050_10367941 244
85 3300025299 Ga0209256_1005435 Ga0209256_10054356 244
86 3300025299 Ga0209256_1010994 Ga0209256_10109942 244
87 3300025302 Ga0207426_1003768 Ga0207426_10037685 244
88 3300028380 Ga0268265_10564976 Ga0268265_105649761 244
89 3300048905 Ga0496102_0265128 Ga0496102_0265128_717_1454 244
90 3300048906 Ga0496103_0041057 Ga0496103_0041057_526_1263 244
91 3300048907 Ga0496104_0340786 Ga0496104_0340786_150_887 244
92 3300048908 Ga0496105_0006245 Ga0496105_0006245_6164_6901 244
93 3300048910 Ga0496107_0053728 Ga0496107_0053728_172_909 244
94 3300048917 Ga0496114_0302462 Ga0496114_0302462_400_1137 244
95 3300048922 Ga0496119_0104571 Ga0496119_0104571_709_1446 244
96 3300048925 Ga0496122_0062840 Ga0496122_0062840_274_1011 244
97 3300048927 Ga0496124_0018792 Ga0496124_0018792_2942_3679 244
98 3300048929 Ga0496126_0061633 Ga0496126_0061633_1592_2329 244
99 iso_pu_bacteria 2501025501 2501070449 244
100 iso_pu_bacteria 2501025502 2501081888 244
101 iso_pu_bacteria 2501025504 2501409526 244
102 iso_pu_bacteria 2510917013 2511091822 244
103 iso_pu_bacteria 2510917014 2511099062 244
104 iso_pu_bacteria 2510917015 2511108835 244
105 iso_pu_bacteria 2515154189 2516020987 244
106 iso_pu_bacteria 2519103095 2519460541 244
107 iso_pu_bacteria 2582581311 2585293031 244
108 iso_pu_bacteria 2599185239 2599737943 244
109 iso_pu_bacteria 2599185240 2599743840 244
110 iso_pu_bacteria 2599185355 2600207092 244
111 iso_pu_bacteria 2675903129 2676742375 244
112 iso_pu_bacteria 2791354903 2791924641 244
113 iso_pu_bacteria 2802429634 2806051387 244
114 iso_pu_bacteria 2802429635 2806059376 244
115 iso_pu_bacteria 2808606384 2808972365 244
116 iso_pu_bacteria 2808606390 2809007194 244
117 iso_pu_bacteria 2808606391 2809014332 244
118 iso_pu_bacteria 2816332253 2817257671 244
119 iso_pu_bacteria 2816332256 2817281927 244
120 iso_pu_bacteria 2816332286 2817451613 244
121 iso_pu_bacteria 2818991452 2819631792 244
122 iso_pu_bacteria 2863421361 2863423519 244
123 iso_pu_bacteria 2870068957 2870074440 244
124 iso_pu_bacteria 2904564687 2904569618 244
125 iso_pu_bacteria 2904571731 2904576929 244
126 iso_pu_bacteria 2928157003 2928162219 244
127 iso_pu_bacteria 2928163908 2928166354 244
128 iso_pu_bacteria 2928536128 2928536979 244
129 iso_pu_bacteria 2981990288 2981995548 244
130 iso_pu_bacteria 641736154 642418136 244
131 iso_pu_bacteria 8018845410 8018847521 244
132 iso_pu_bacteria 8020807995 8020809057 244
133 iso_pu_bacteria 8020945358 8020949556 244
134 iso_pu_bacteria 8040167225 8040168388 244
135 iso_pu_bacteria 8040173305 8040179483 244
136 3300025297 Ga0209758_1059760 Ga0209758_10597602 245
137 3300031548 Ga0307408_100277766 Ga0307408_1002777662 245
138 3300041404 Ga0439436_0006670 Ga0439436_0006670_332_1072 245
139 3300042145 Ga0450906_012024 Ga0450906_012024_692_1432 245
140 3300046660 Ga0495625_0120638 Ga0495625_0120638_889_1629 245
141 iso_pu_bacteria 2509276021 2509390363 245
142 iso_pu_bacteria 2509276033 2509442098 245
143 iso_pu_bacteria 2510461076 2510897310 245
144 iso_pu_bacteria 2510917028 2511185772 245
145 iso_pu_bacteria 2510917030 2511194730 245
146 iso_pu_bacteria 2513237084 2513570992 245
147 iso_pu_bacteria 2513237085 2513574804 245
148 iso_pu_bacteria 2513237088 2513595369 245
149 iso_pu_bacteria 2513237093 2513634055 245
150 iso_pu_bacteria 2513237103 2513707423 245
151 iso_pu_bacteria 2513237138 2513866530 245
152 iso_pu_bacteria 2513237162 2514022183 245
153 iso_pu_bacteria 2515075009 2515115035 245
154 iso_pu_bacteria 2515154113 2515633928 245
155 iso_pu_bacteria 2515154114 2515641253 245
156 iso_pu_bacteria 2515154116 2515659742 245
157 iso_pu_bacteria 2515154134 2515740991 245
158 iso_pu_bacteria 2516653077 2517038622 245
159 iso_pu_bacteria 2516653085 2517078877 245
160 iso_pu_bacteria 2517093000 2517097665 245
161 iso_pu_bacteria 2517287029 2517409097 245
162 iso_pu_bacteria 2529292951 2530648202 245
163 iso_pu_bacteria 2534681796 2535514727 245
164 iso_pu_bacteria 2582581294 2585201127 245
165 iso_pu_bacteria 2582581298 2585223412 245
166 iso_pu_bacteria 2582581299 2585232430 245
167 iso_pu_bacteria 2582581304 2585256258 245
168 iso_pu_bacteria 2582581316 2585330443 245
169 iso_pu_bacteria 2582581867 2585398933 245
170 iso_pu_bacteria 2585427526 2585523790 245
171 iso_pu_bacteria 2585427528 2585541813 245
172 iso_pu_bacteria 2585427529 2585545992 245
173 iso_pu_bacteria 2585427590 2585818947 245
174 iso_pu_bacteria 2585427593 2585840539 245
175 iso_pu_bacteria 2585427594 2585843872 245
176 iso_pu_bacteria 2643221599 2644004570 245
177 iso_pu_bacteria 2643221634 2644196918 245
178 iso_pu_bacteria 2643221643 2644237526 245
179 iso_pu_bacteria 2724679232 2725946611 245
180 iso_pu_bacteria 2738541293 2738799119 245
181 iso_pu_bacteria 2738541293 2738800944 245
182 iso_pu_bacteria 2738541333 2739038872 245
183 iso_pu_bacteria 2765235942 2766063313 245
184 iso_pu_bacteria 2791355259 2793315193 245
185 iso_pu_bacteria 2791355266 2793358367 245
186 iso_pu_bacteria 2791355267 2793365486 245
187 iso_pu_bacteria 2802429633 2806046626 245
188 iso_pu_bacteria 2802429636 2806066661 245
189 iso_pu_bacteria 2802429637 2806073718 245
190 iso_pu_bacteria 2838680041 2838680178 245
191 iso_pu_bacteria 2838686498 2838689691 245
192 iso_pu_bacteria 2838694306 2838695791 245
193 iso_pu_bacteria 2838707686 2838709166 245
194 iso_pu_bacteria 2838729681 2838731614 245
195 iso_pu_bacteria 2838742623 2838744555 245
196 iso_pu_bacteria 2841851746 2841853095 245
197 iso_pu_bacteria 2842077413 2842079598 245
198 iso_pu_bacteria 2842110456 2842112589 245
199 iso_pu_bacteria 2842118031 2842120216 245
200 iso_pu_bacteria 2842156927 2842160422 245
201 iso_pu_bacteria 2842163707 2842165598 245
202 iso_pu_bacteria 2842180545 2842183912 245
203 iso_pu_bacteria 2842217011 2842219262 245
204 iso_pu_bacteria 2842229732 2842231493 245
205 iso_pu_bacteria 2842237096 2842238577 245
206 iso_pu_bacteria 2842243621 2842246037 245
207 iso_pu_bacteria 2842257432 2842260415 245
208 iso_pu_bacteria 2842271015 2842273825 245
209 iso_pu_bacteria 2842291075 2842293259 245
210 iso_pu_bacteria 2842304105 2842308947 245
211 iso_pu_bacteria 2842370503 2842370640 245
212 iso_pu_bacteria 2842377471 2842379656 245
213 iso_pu_bacteria 2842384541 2842386727 245
214 iso_pu_bacteria 2844454524 2844456438 245
215 iso_pu_bacteria 2857516855 2857522034 245
216 iso_pu_bacteria 2919100787 2919101710 245
217 iso_pu_bacteria 2923556063 2923556339 245
218 iso_pu_bacteria 2933016740 2933019842 245
219 iso_pu_bacteria 2933570622 2933575391 245
220 iso_pu_bacteria 2933586486 2933588522 245
221 iso_pu_bacteria 2935894831 2935896311 245
222 iso_pu_bacteria 2935901341 2935902483 245
223 iso_pu_bacteria 2936375103 2936380055 245
224 iso_pu_bacteria 2996887358 2996888141 245
225 iso_pu_bacteria 3005445848 3005451463 245
226 iso_pu_bacteria 3005452660 3005456524 245
227 iso_pu_bacteria 639633055 639646228 245
228 iso_pu_bacteria 8005258706 8005261307 245
229 iso_pu_bacteria 8005307578 8005310408 245
230 iso_pu_bacteria 8005321885 8005322668 245
231 iso_pu_bacteria 8005376324 8005377867 245
232 iso_pu_bacteria 8005460587 8005465732 245
233 iso_pu_bacteria 8005484373 8005484649 245
234 iso_pu_bacteria 8005542996 8005543397 245
235 iso_pu_bacteria 8005556819 8005560176 245
236 iso_pu_bacteria 8005563573 8005564369 245
237 iso_pu_bacteria 8005570704 8005573921 245
238 iso_pu_bacteria 8018163183 8018167441 245
239 iso_pu_bacteria 8023680758 8023684685 245
240 iso_pu_bacteria 8056375014 8056376077 245
241 iso_pu_bacteria 8057874678 8057879031 245
242 3300005435 Ga0070714_100099041 Ga0070714_1000990413 247
243 3300005436 Ga0070713_100169852 Ga0070713_1001698522 247
244 3300005618 Ga0068864_100034823 Ga0068864_1000348234 247
245 3300005841 Ga0068863_100559119 Ga0068863_1005591191 247
246 3300009551 Ga0105238_10654166 Ga0105238_106541661 247
247 3300013105 Ga0157369_10060475 Ga0157369_100604752 247
248 3300013296 Ga0157374_10265265 Ga0157374_102652653 247
249 3300014325 Ga0163163_10021705 Ga0163163_100217058 247
250 3300014968 Ga0157379_10646366 Ga0157379_106463662 247
251 3300025904 Ga0207647_10018080 Ga0207647_100180803 247
252 3300025914 Ga0207671_10015924 Ga0207671_100159241 247
253 3300025924 Ga0207694_10361584 Ga0207694_103615842 247
254 3300025928 Ga0207700_10059272 Ga0207700_100592723 247
255 3300025929 Ga0207664_10272991 Ga0207664_102729912 247
256 3300026088 Ga0207641_10430449 Ga0207641_104304492 247
257 3300026095 Ga0207676_10068826 Ga0207676_100688263 247
258 3300029957 Ga0265324_10062209 Ga0265324_100622092 247
259 3300035691 Ga0373931_0072476 Ga0373931_0072476_531_1277 247
260 3300037853 Ga0436364_0780022 Ga0436364_0780022_329_1075 247
261 2162886007 SwRhRL2b_contig_2475022 SwRhRL2b_0697.00002760 248
262 3300001979 JGI24740J21852_10034124 JGI24740J21852_100341241 248
263 3300001989 JGI24739J22299_10000239 JGI24739J22299_100002394 248
264 3300001989 JGI24739J22299_10023204 JGI24739J22299_100232042 248
265 3300002737 JGI25162J39368_1001134 JGI25162J39368_100113416 248
266 3300002739 JGI25158J39367_1000011 JGI25158J39367_100001144 248
267 3300002773 JGI25152J39213_1001231 JGI25152J39213_10012313 248
268 3300002773 JGI25152J39213_1002619 JGI25152J39213_10026192 248
269 3300002773 JGI25152J39213_1003698 JGI25152J39213_10036983 248
270 3300002774 JGI25150J39212_1000133 JGI25150J39212_100013327 248
271 3300002774 JGI25150J39212_1006065 JGI25150J39212_10060651 248
272 3300002987 JGI25159J45721_1002544 JGI25159J45721_10025447 248
273 3300003187 JGI25151J46595_10000407 JGI25151J46595_1000040715 248
274 3300003214 JGI25165J46597_1000607 JGI25165J46597_10006079 248
275 3300003215 JGI25153J46596_10001273 JGI25153J46596_100012735 248
276 3300003215 JGI25153J46596_10001632 JGI25153J46596_100016324 248
277 3300003215 JGI25153J46596_10001698 JGI25153J46596_100016989 248
278 3300003215 JGI25153J46596_10005424 JGI25153J46596_100054242 248
279 3300003316 rootH1_10081334 rootH1_100813344 248
280 3300003374 JGI25161J50226_1000186 JGI25161J50226_100018634 248
281 3300003758 Ga0055532_1000131 Ga0055532_100013146 248
282 3300003758 Ga0055532_1000384 Ga0055532_100038416 248
283 3300003758 Ga0055532_1000429 Ga0055532_100042912 248
284 3300003760 Ga0055527_1000357 Ga0055527_100035711 248
285 3300003760 Ga0055527_1000870 Ga0055527_10008704 248
286 3300003761 Ga0055535_1000217 Ga0055535_100021754 248
287 3300003761 Ga0055535_1000815 Ga0055535_100081511 248
288 3300003762 Ga0055542_1000253 Ga0055542_100025354 248
289 3300003763 Ga0055529_1000183 Ga0055529_100018380 248
290 3300003763 Ga0055529_1003327 Ga0055529_10033273 248
291 3300003775 Ga0055524_1037246 Ga0055524_10372461 248
292 3300003790 Ga0055528_1003277 Ga0055528_10032774 248
293 3300003792 Ga0055540_1000181 Ga0055540_100018116 248
294 3300003792 Ga0055540_1003355 Ga0055540_10033555 248
295 3300003856 Ga0058692_1004431 Ga0058692_10044312 248
296 3300004625 Ga0055543_1000073 Ga0055543_100007346 248
297 3300005262 Ga0065165_1005540 Ga0065165_10055406 248
298 3300005262 Ga0065165_1005775 Ga0065165_10057758 248
299 3300005289 Ga0065704_10070719 Ga0065704_1007071920 248
300 3300005339 Ga0070660_100000071 Ga0070660_10000007112 248
301 3300005344 Ga0070661_100290554 Ga0070661_1002905542 248
302 3300005353 Ga0070669_100185166 Ga0070669_1001851662 248
303 3300005356 Ga0070674_100015490 Ga0070674_1000154903 248
304 3300005366 Ga0070659_100000187 Ga0070659_10000018712 248
305 3300005435 Ga0070714_100115519 Ga0070714_1001155191 248
306 3300005436 Ga0070713_100703198 Ga0070713_1007031981 248
307 3300005444 Ga0070694_100097599 Ga0070694_1000975992 248
308 3300005455 Ga0070663_100000223 Ga0070663_10000022313 248
309 3300005455 Ga0070663_100392771 Ga0070663_1003927712 248
310 3300005459 Ga0068867_100185560 Ga0068867_1001855602 248
311 3300005563 Ga0068855_100001605 Ga0068855_10000160527 248
312 3300005563 Ga0068855_100074340 Ga0068855_1000743403 248
313 3300005614 Ga0068856_100958307 Ga0068856_1009583071 248
314 3300005616 Ga0068852_100014531 Ga0068852_1000145314 248
315 3300005834 Ga0068851_10170354 Ga0068851_101703541 248
316 3300006048 Ga0075363_100040801 Ga0075363_1000408013 248
317 3300006178 Ga0075367_10006589 Ga0075367_100065895 248
318 3300006186 Ga0075369_10031455 Ga0075369_100314552 248
319 3300006353 Ga0075370_10052960 Ga0075370_100529602 248
320 3300006844 Ga0075428_100099585 Ga0075428_1000995853 248
321 3300006871 Ga0075434_100195877 Ga0075434_1001958772 248
322 3300009011 Ga0105251_10007781 Ga0105251_100077814 248
323 3300009036 Ga0105244_10104706 Ga0105244_101047062 248
324 3300009092 Ga0105250_10000424 Ga0105250_100004243 248
325 3300009093 Ga0105240_10000397 Ga0105240_1000039764 248
326 3300009093 Ga0105240_10019860 Ga0105240_100198603 248
327 3300009093 Ga0105240_10127573 Ga0105240_101275733 248
328 3300009147 Ga0114129_10146776 Ga0114129_101467762 248
329 3300009545 Ga0105237_10057564 Ga0105237_100575644 248
330 3300009551 Ga0105238_10007386 Ga0105238_1000738610 248
331 3300009765 Ga0123341_1005933 Ga0123341_10059335 248
332 3300009766 Ga0123342_1024443 Ga0123342_10244432 248
333 3300012500 Ga0157314_1001022 Ga0157314_10010222 248
334 3300013104 Ga0157370_10054288 Ga0157370_100542882 248
335 3300013104 Ga0157370_10106463 Ga0157370_101064633 248
336 3300013105 Ga0157369_10018684 Ga0157369_100186847 248
337 3300013296 Ga0157374_10230699 Ga0157374_102306992 248
338 3300013307 Ga0157372_10003574 Ga0157372_100035748 248
339 3300015261 Ga0182006_1005959 Ga0182006_10059594 248
340 3300015261 Ga0182006_1017809 Ga0182006_10178093 248
341 3300015262 Ga0182007_10003805 Ga0182007_100038057 248
342 3300015685 Ga0183369_1003 Ga0183369_1003473 248
343 3300025208 Ga0209436_100048 Ga0209436_10004863 248
344 3300025225 Ga0209566_100217 Ga0209566_10021745 248
345 3300025226 Ga0209674_101720 Ga0209674_1017205 248
346 3300025228 Ga0209672_100012 Ga0209672_100012508 248
347 3300025228 Ga0209672_100030 Ga0209672_100030333 248
348 3300025229 Ga0209147_100007 Ga0209147_100007262 248
349 3300025229 Ga0209147_100036 Ga0209147_1000366 248
350 3300025229 Ga0209147_100076 Ga0209147_100076168 248
351 3300025233 Ga0209437_100056 Ga0209437_100056270 248
352 3300025242 Ga0209258_100014 Ga0209258_100014440 248
353 3300025242 Ga0209258_100056 Ga0209258_100056333 248
354 3300025245 Ga0207425_1000466 Ga0207425_100046615 248
355 3300025245 Ga0207425_1007175 Ga0207425_10071753 248
356 3300025254 Ga0209148_1000178 Ga0209148_1000178115 248
357 3300025254 Ga0209148_1000277 Ga0209148_100027752 248
358 3300025256 Ga0209759_1002312 Ga0209759_10023125 248
359 3300025258 Ga0209129_1000308 Ga0209129_100030815 248
360 3300025258 Ga0209129_1002123 Ga0209129_10021237 248
361 3300025258 Ga0209129_1004035 Ga0209129_10040353 248
362 3300025258 Ga0209129_1019889 Ga0209129_10198891 248
363 3300025261 Ga0209233_1000071 Ga0209233_1000071270 248
364 3300025263 Ga0209565_1010305 Ga0209565_10103052 248
365 3300025272 Ga0209455_1000061 Ga0209455_10000616 248
366 3300025272 Ga0209455_1000590 Ga0209455_100059011 248
367 3300025273 Ga0209673_1000046 Ga0209673_1000046100 248
368 3300025273 Ga0209673_1003542 Ga0209673_10035427 248
369 3300025273 Ga0209673_1022267 Ga0209673_10222671 248
370 3300025284 Ga0209130_1000002 Ga0209130_1000002437 248
371 3300025294 Ga0209025_1000919 Ga0209025_100091928 248
372 3300025294 Ga0209025_1026742 Ga0209025_10267421 248
373 3300025294 Ga0209025_1069250 Ga0209025_10692502 248
374 3300025295 Ga0209564_1001614 Ga0209564_100161410 248
375 3300025295 Ga0209564_1007194 Ga0209564_10071947 248
376 3300025297 Ga0209758_1000788 Ga0209758_100078828 248
377 3300025297 Ga0209758_1001309 Ga0209758_100130933 248
378 3300025297 Ga0209758_1001692 Ga0209758_100169221 248
379 3300025297 Ga0209758_1001755 Ga0209758_100175510 248
380 3300025297 Ga0209758_1015103 Ga0209758_10151032 248
381 3300025297 Ga0209758_1019553 Ga0209758_10195532 248
382 3300025298 Ga0209050_1005821 Ga0209050_10058215 248
383 3300025299 Ga0209256_1004378 Ga0209256_10043782 248
384 3300025299 Ga0209256_1043550 Ga0209256_10435502 248
385 3300025302 Ga0207426_1000013 Ga0207426_1000013437 248
386 3300025303 Ga0209051_1000228 Ga0209051_100022882 248
387 3300025303 Ga0209051_1032941 Ga0209051_10329412 248
388 3300025304 Ga0209257_1007373 Ga0209257_10073736 248
389 3300025321 Ga0207656_10204905 Ga0207656_102049051 248
390 3300025711 Ga0207696_1000536 Ga0207696_10005363 248
391 3300025904 Ga0207647_10006096 Ga0207647_100060965 248
392 3300025913 Ga0207695_10000305 Ga0207695_1000030546 248
393 3300025913 Ga0207695_10115801 Ga0207695_101158012 248
394 3300025914 Ga0207671_10042403 Ga0207671_100424032 248
395 3300025914 Ga0207671_10090281 Ga0207671_100902812 248
396 3300025919 Ga0207657_10000161 Ga0207657_1000016154 248
397 3300025923 Ga0207681_10595432 Ga0207681_105954321 248
398 3300025924 Ga0207694_10007801 Ga0207694_100078017 248
399 3300025932 Ga0207690_10000016 Ga0207690_1000001684 248
400 3300025933 Ga0207706_10007475 Ga0207706_100074754 248
401 3300025949 Ga0207667_10001356 Ga0207667_100013561 248
402 3300025949 Ga0207667_10005426 Ga0207667_100054267 248
403 3300025949 Ga0207667_10021135 Ga0207667_100211351 248
404 3300026067 Ga0207678_10001686 Ga0207678_1000168616 248
405 3300026078 Ga0207702_10647081 Ga0207702_106470811 248
406 3300026078 Ga0207702_10756942 Ga0207702_107569421 248
407 3300026142 Ga0207698_10035134 Ga0207698_100351342 248
408 3300027312 Ga0209371_1000696 Ga0209371_100069623 248
409 3300028379 Ga0268266_10371450 Ga0268266_103714502 248
410 3300028794 Ga0307515_10000049 Ga0307515_10000049198 248
411 3300028794 Ga0307515_10027435 Ga0307515_100274352 248
412 3300028794 Ga0307515_10056306 Ga0307515_100563066 248
413 3300030083 Ga0237817_11014 Ga0237817_110141 248
414 3300030500 Ga0268256_1001454 Ga0268256_10014544 248
415 3300031239 Ga0265328_10012962 Ga0265328_100129623 248
416 3300031240 Ga0265320_10038663 Ga0265320_100386632 248
417 3300031251 Ga0265327_10000056 Ga0265327_1000005692 248
418 3300031507 Ga0307509_10394933 Ga0307509_103949332 248
419 3300031731 Ga0307405_10000550 Ga0307405_1000055011 248
420 3300031901 Ga0307406_10064314 Ga0307406_100643143 248
421 3300031911 Ga0307412_10001127 Ga0307412_100011275 248
422 3300031911 Ga0307412_10147066 Ga0307412_101470662 248
423 3300037312 Ga0395899_0222643 Ga0395899_0222643_259_1038 248
424 3300037418 Ga0395900_0064055 Ga0395900_0064055_1654_2433 248
425 3300041494 Ga0451837_0956710 Ga0451837_0956710_25_774 248
426 3300041496 Ga0451839_1600287 Ga0451839_1600287_265_1017 248
427 3300041498 Ga0451841_0664988 Ga0451841_0664988_554_1303 248
428 3300041503 Ga0451847_0118416 Ga0451847_0118416_180_929 248
429 3300041505 Ga0451849_0495765 Ga0451849_0495765_25_774 248
430 3300041507 Ga0451851_0642284 Ga0451851_0642284_325_1074 248
431 3300042000 Ga0439437_002701 Ga0439437_002701_1033_1806 248
432 3300042127 Ga0450890_001363 Ga0450890_001363_629_1402 248
433 3300042138 Ga0450903_002568 Ga0450903_002568_1507_2280 248
434 3300042144 Ga0450889_000625 Ga0450889_000625_2604_3377 248
435 3300042876 Ga0451577_0003810 Ga0451577_0003810_15626_16375 248
436 3300042876 Ga0451577_0054161 Ga0451577_0054161_149_901 248
437 3300044693 Ga0466961_0009284 Ga0466961_0009284_4909_5655 248
438 3300046452 Ga0495617_001983 Ga0495617_001983_3252_4001 248
439 3300046453 Ga0495627_012578 Ga0495627_012578_230_976 248
440 3300046454 Ga0495592_0112445 Ga0495592_0112445_1157_1906 248
441 3300046457 Ga0495590_0046223 Ga0495590_0046223_704_1453 248
442 3300046457 Ga0495590_0091434 Ga0495590_0091434_105_854 248
443 3300046458 Ga0495591_030400 Ga0495591_030400_287_1033 248
444 3300046462 Ga0495651_0005876 Ga0495651_0005876_1474_2223 248
445 3300046471 Ga0495650_0000061 Ga0495650_0000061_148558_149307 248
446 3300046471 Ga0495650_0066051 Ga0495650_0066051_275_1024 248
447 3300046474 Ga0495605_0000436 Ga0495605_0000436_10429_11175 248
448 3300046474 Ga0495605_0020492 Ga0495605_0020492_258_1007 248
449 3300046492 Ga0495585_0003214 Ga0495585_0003214_10232_10981 248
450 3300046499 Ga0495594_0002216 Ga0495594_0002216_6031_6777 248
451 3300046506 Ga0495583_0000028 Ga0495583_0000028_229364_230110 248
452 3300046506 Ga0495583_0007906 Ga0495583_0007906_5470_6219 248
453 3300046507 Ga0495606_0001098 Ga0495606_0001098_26347_27096 248
454 3300046507 Ga0495606_0003051 Ga0495606_0003051_11497_12246 248
455 3300046507 Ga0495606_0026951 Ga0495606_0026951_1533_2282 248
456 3300046507 Ga0495606_0127251 Ga0495606_0127251_286_1035 248
457 3300046512 Ga0495610_0000420 Ga0495610_0000420_18348_19097 248
458 3300046512 Ga0495610_0058084 Ga0495610_0058084_539_1288 248
459 3300046515 Ga0495620_0000028 Ga0495620_0000028_96860_97606 248
460 3300046515 Ga0495620_0062130 Ga0495620_0062130_441_1190 248
461 3300046516 Ga0495628_0091302 Ga0495628_0091302_1561_2310 248
462 3300046518 Ga0495631_0004357 Ga0495631_0004357_747_1493 248
463 3300046519 Ga0495632_0104768 Ga0495632_0104768_106_855 248
464 3300046520 Ga0495637_0009532 Ga0495637_0009532_49_795 248
465 3300046522 Ga0495643_0002534 Ga0495643_0002534_12037_12786 248
466 3300046524 Ga0495648_0111445 Ga0495648_0111445_44_793 248
467 3300046530 Ga0495654_0024570 Ga0495654_0024570_1435_2181 248
468 3300046538 Ga0495609_0000081 Ga0495609_0000081_25834_26580 248
469 3300046542 Ga0495597_0002579 Ga0495597_0002579_9877_10623 248
470 3300046542 Ga0495597_0094325 Ga0495597_0094325_62_811 248
471 3300046543 Ga0495645_0224470 Ga0495645_0224470_484_1233 248
472 3300046557 Ga0495622_0056036 Ga0495622_0056036_182_964 248
473 3300046557 Ga0495622_0090166 Ga0495622_0090166_556_1305 248
474 3300046558 Ga0495633_0000028 Ga0495633_0000028_25547_26293 248
475 3300046616 Ga0495668_0084828 Ga0495668_0084828_83_832 248
476 3300046648 Ga0495611_0004906 Ga0495611_0004906_1382_2128 248
477 3300046665 Ga0495661_0000217 Ga0495661_0000217_40184_40930 248
478 3300046691 Ga0495670_0003475 Ga0495670_0003475_6576_7322 248
479 3300046691 Ga0495670_0025016 Ga0495670_0025016_1774_2520 248
480 3300046692 Ga0495671_0003759 Ga0495671_0003759_2900_3646 248
481 3300046794 Ga0495589_0000379 Ga0495589_0000379_23439_24185 248
482 3300046809 Ga0495600_0136415 Ga0495600_0136415_643_1392 248
483 3300046810 Ga0495660_0004690 Ga0495660_0004690_101_847 248
484 3300046810 Ga0495660_0060931 Ga0495660_0060931_154_903 248
485 3300047317 Ga0495604_0002788 Ga0495604_0002788_12552_13364 248
486 3300047319 Ga0495674_0014822 Ga0495674_0014822_2431_3180 248
487 3300047322 Ga0495680_0034500 Ga0495680_0034500_1562_2311 248
488 3300047323 Ga0495683_0000060 Ga0495683_0000060_88620_89366 248
489 3300047443 Ga0495687_046019 Ga0495687_046019_945_1694 248
490 3300047446 Ga0495679_000396 Ga0495679_000396_26106_26852 248
491 3300047446 Ga0495679_038311 Ga0495679_038311_267_1016 248
492 3300047469 Ga0495673_0005039 Ga0495673_0005039_7008_7754 248
493 3300047470 Ga0495681_0010978 Ga0495681_0010978_713_1459 248
494 3300047470 Ga0495681_0129984 Ga0495681_0129984_155_904 248
495 3300047472 Ga0495686_0003077 Ga0495686_0003077_7762_8511 248
496 3300047472 Ga0495686_0058178 Ga0495686_0058178_258_1007 248
497 3300047472 Ga0495686_0082903 Ga0495686_0082903_558_1307 248
498 3300047472 Ga0495686_0117633 Ga0495686_0117633_451_1200 248
499 3300047472 Ga0495686_0196571 Ga0495686_0196571_289_1038 248
500 3300048091 Ga0495626_0121409 Ga0495626_0121409_241_990 248
501 3300048903 Ga0496100_0615874 Ga0496100_0615874_24_809 248
502 3300048904 Ga0496101_0022927 Ga0496101_0022927_2033_2779 248
503 3300048904 Ga0496101_0207727 Ga0496101_0207727_375_1121 248
504 3300048907 Ga0496104_0346432 Ga0496104_0346432_503_1249 248
505 3300048908 Ga0496105_0205778 Ga0496105_0205778_670_1416 248
506 3300048909 Ga0496106_0000433 Ga0496106_0000433_21863_22612 248
507 3300048919 Ga0496116_0004348 Ga0496116_0004348_11876_12625 248
508 3300048919 Ga0496116_0007352 Ga0496116_0007352_7527_8366 248
509 3300048919 Ga0496116_0027382 Ga0496116_0027382_466_1215 248
510 3300048919 Ga0496116_0110131 Ga0496116_0110131_473_1240 248
511 3300048919 Ga0496116_0165675 Ga0496116_0165675_315_1061 248
512 3300048920 Ga0496117_0005361 Ga0496117_0005361_11839_12588 248
513 3300048920 Ga0496117_0016578 Ga0496117_0016578_2417_3163 248
514 3300048920 Ga0496117_0022940 Ga0496117_0022940_3844_4593 248
515 3300048920 Ga0496117_0027866 Ga0496117_0027866_475_1224 248
516 3300048921 Ga0496118_0012262 Ga0496118_0012262_2420_3169 248
517 3300048921 Ga0496118_0017099 Ga0496118_0017099_5505_6254 248
518 3300048921 Ga0496118_0022731 Ga0496118_0022731_2782_3531 248
519 3300048921 Ga0496118_0038124 Ga0496118_0038124_3046_3792 248
520 3300048921 Ga0496118_0130330 Ga0496118_0130330_317_1063 248
521 3300048921 Ga0496118_0132716 Ga0496118_0132716_603_1349 248
522 3300048924 Ga0496121_0003993 Ga0496121_0003993_617_1366 248
523 3300048924 Ga0496121_0024968 Ga0496121_0024968_4582_5331 248
524 3300048924 Ga0496121_0025819 Ga0496121_0025819_3150_3896 248
525 3300048924 Ga0496121_0033459 Ga0496121_0033459_374_1213 248
526 3300048924 Ga0496121_0046359 Ga0496121_0046359_2385_3131 248
527 3300048924 Ga0496121_0224846 Ga0496121_0224846_131_880 248
528 3300048925 Ga0496122_0005948 Ga0496122_0005948_292_1041 248
529 3300048925 Ga0496122_0013136 Ga0496122_0013136_6231_6980 248
530 3300048925 Ga0496122_0063369 Ga0496122_0063369_974_1813 248
531 3300048925 Ga0496122_0080142 Ga0496122_0080142_459_1205 248
532 3300048926 Ga0496123_0003014 Ga0496123_0003014_11876_12625 248
533 3300048926 Ga0496123_0021021 Ga0496123_0021021_4073_4822 248
534 3300048926 Ga0496123_0034042 Ga0496123_0034042_2617_3366 248
535 3300048926 Ga0496123_0061668 Ga0496123_0061668_841_1587 248
536 3300048927 Ga0496124_0001760 Ga0496124_0001760_22859_23608 248
537 3300048927 Ga0496124_0011817 Ga0496124_0011817_7928_8677 248
538 3300048927 Ga0496124_0012177 Ga0496124_0012177_7744_8493 248
539 3300048927 Ga0496124_0017708 Ga0496124_0017708_3250_3999 248
540 3300048927 Ga0496124_0421244 Ga0496124_0421244_28_777 248
541 3300048928 Ga0496125_0001790 Ga0496125_0001790_4276_5022 248
542 3300048928 Ga0496125_0010013 Ga0496125_0010013_1038_1787 248
543 3300048928 Ga0496125_0056323 Ga0496125_0056323_31_780 248
544 3300048929 Ga0496126_0331837 Ga0496126_0331837_137_883 248
545 3300049459 Ga0495678_000020 Ga0495678_000020_227491_228237 248
546 3300049459 Ga0495678_070515 Ga0495678_070515_294_1043 248
547 3300049569 Ga0501032_0001362 Ga0501032_0001362_2495_3244 248
548 3300049570 Ga0501033_0003686 Ga0501033_0003686_7401_8150 248
549 3300049571 Ga0501034_0023846 Ga0501034_0023846_406_1155 248
550 3300049572 Ga0501036_0005360 Ga0501036_0005360_3278_4027 248
551 3300049574 Ga0501038_0013528 Ga0501038_0013528_3920_4669 248
552 3300049574 Ga0501038_0174364 Ga0501038_0174364_197_946 248
553 3300049575 Ga0501039_0016699 Ga0501039_0016699_2816_3565 248
554 3300049578 Ga0501042_0269104 Ga0501042_0269104_116_865 248
555 3300049579 Ga0501043_0013905 Ga0501043_0013905_2685_3434 248
556 3300049579 Ga0501043_0015056 Ga0501043_0015056_2975_3745 248
557 3300049580 Ga0501046_0001140 Ga0501046_0001140_6660_7409 248
558 3300049580 Ga0501046_0182859 Ga0501046_0182859_315_1064 248
559 3300049581 Ga0501047_0139164 Ga0501047_0139164_276_1046 248
560 3300049582 Ga0501048_0002122 Ga0501048_0002122_4494_5240 248
561 3300049582 Ga0501048_0014465 Ga0501048_0014465_3196_3945 248
562 3300049583 Ga0501067_0124526 Ga0501067_0124526_484_1233 248
563 3300049584 Ga0501068_0002614 Ga0501068_0002614_4824_5573 248
564 3300049586 Ga0501070_0234116 Ga0501070_0234116_400_1149 248
565 3300049588 Ga0501072_0000880 Ga0501072_0000880_8232_8981 248
566 3300049589 Ga0501073_0001638 Ga0501073_0001638_13901_14650 248
567 3300049590 Ga0501074_0000835 Ga0501074_0000835_13901_14650 248
568 3300049591 Ga0501075_0163855 Ga0501075_0163855_615_1364 248
569 3300049592 Ga0501076_0061430 Ga0501076_0061430_68_817 248
570 3300049593 Ga0501077_0008463 Ga0501077_0008463_2812_3561 248
571 3300049742 Ga0501080_0000101 Ga0501080_0000101_55927_56676 248
572 3300049823 Ga0501044_0152070 Ga0501044_0152070_264_1034 248
573 3300050514 nmdc:mga08x19_234228_c1 nmdc:mga08x19_234228_c1_184_936 248
574 3300050515 nmdc:mga0a205_10940_c1 nmdc:mga0a205_10940_c1_6894_7646 248
575 3300053088 Ga0500644_0029791 Ga0500644_0029791_733_1482 248
576 3300053104 Ga0500556_0000017 Ga0500556_0000017_170497_171282 248
577 3300053111 Ga0500572_047951 Ga0500572_047951_87_836 248
578 3300053125 Ga0500618_003162 Ga0500618_003162_4309_5055 248
579 3300053134 Ga0500658_0000678 Ga0500658_0000678_10994_11743 248
580 3300053139 Ga0500568_0001236 Ga0500568_0001236_10363_11112 248
581 3300053139 Ga0500568_0057761 Ga0500568_0057761_404_1153 248
582 3300053142 Ga0500577_0125055 Ga0500577_0125055_176_925 248
583 3300053151 Ga0500604_0065513 Ga0500604_0065513_337_1086 248
584 3300053156 Ga0500622_0002102 Ga0500622_0002102_6254_7003 248
585 3300053156 Ga0500622_0003044 Ga0500622_0003044_324_1073 248
586 3300053160 Ga0500633_0005130 Ga0500633_0005130_2040_2789 248
587 3300053177 Ga0500636_0000882 Ga0500636_0000882_12366_13115 248
588 3300054114 Ga0501084_0000244 Ga0501084_0000244_10039_10788 248
589 iso_pu_bacteria 2643221585 2643936856 248
590 iso_pu_bacteria 2643221656 2644318757 248
591 iso_pu_bacteria 2841864319 2841866308 248
592 iso_pu_bacteria 2842341865 2842342281 248
593 iso_pu_bacteria 2842363717 2842365811 248
594 iso_pu_bacteria 2857357740 2857358081 248
595 iso_pu_bacteria 2928170801 2928173654 248
596 iso_pu_bacteria 8020938398 8020940689 248
597 iso_pu_bacteria 8020953355 8020954270 248
598 iso_pu_bacteria 8021120328 8021125053 248

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

37

226

0.96

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

43

277

0.95

PF08643

DUF1776

Fungal family of unknown function (DUF1776)

105

239

0.9

PF08659

KR

KR domain

37

211

0.85

PF23441

30

279

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
4bmn-assembly1.cif.gz_B apo structure of short-chain alcohol dehydrogenase from ralstonia sp. dsm 6428 0.9842 2 248
4fgs-assembly1.cif.gz_B crystal structure of a probable dehydrogenase protein 0.9834 2 248
4fgs-assembly1.cif.gz_D crystal structure of a probable dehydrogenase protein 0.9833 1 248
4i5d-assembly1.cif.gz_A crystal structure of ralstonia sp. alcohol dehydrogenase in its apo form 0.9823 2 248
4i5e-assembly1.cif.gz_B crystal structure of ralstonia sp. alcohol dehydrogenase in complex with nadp+ 0.9803 2 248
ID Description Score Start End Superfamily
4bmnA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9717 2 248 3.40.50.720
af_Q9BL81_2_252_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9619 7 248 3.40.50.720
af_Q6PKH6_18_219_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9595 3 176 3.40.50.720
af_Q9U1L2_1_249_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9536 1 248 3.40.50.720
af_A0A0P0X9U1_21_128_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9534 2 90 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A7Y3J8K4-F1-model_v4 SDR family NAD(P)-dependent oxidoreductase 0.9942 1 186 GO:0016491
AF-A0A5E4XTU0-F1-model_v4 Short-chain dehydrogenase/reductase SDR 0.9899 1 186 GO:0050664
AF-A0A365VSL1-F1-model_v4 deleted 0.9859 39 248
AF-A0A0N1DUU3-F1-model_v4 Short-chain dehydrogenase 0.9854 2 248 GO:0016491
AF-A0A5B8UWP2-F1-model_v4 SDR family oxidoreductase 0.9848 2 248 GO:0016491

Feature Viewer

pLDDT pTM Quality
94.79 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map