F467426

General Info

Members Datasets Scaffolds Average Seq Length
595 246 1190 177

Family's Representative Sequence

Representative Sequence 3300005549|Ga0070704_101122798|Ga0070704_1011227981
Length 203
Sequence MTVRLKADPKARVWRVISRLTYHTPIMLKQYTLLLALVAGIGGATLHAQNVTKETVPGVTNFAKLETTIACAGATTPAAVAGLKQMGYASIINLREASEAGAEVDAEAAAAKTAGITYIHLPFNTAMPNPAVVDNFLKAVTEPKNQPAFVHCASANRAAAMWMIKRMQVDKWDAERAGTEAAALGLTNGALKTFALNYVAAHK

Samples

Sample ID Description Type Environment
1 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
6 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
20 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
31 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
32 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
33 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
34 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
35 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
36 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
37 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
38 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
39 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
40 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
41 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
42 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
43 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
44 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
45 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
46 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
47 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
48 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
49 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
50 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
51 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
52 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
53 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
54 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
55 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
56 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
57 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
58 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
59 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
60 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
61 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
62 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
63 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
64 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
65 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
66 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
67 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
68 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
69 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
70 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
71 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
73 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
74 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
75 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
76 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
77 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
78 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
79 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
80 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
82 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
83 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
85 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
86 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
87 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
88 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
89 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
90 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
91 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
92 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
93 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
94 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
95 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
96 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
97 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
98 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
99 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
100 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
101 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
102 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
103 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
104 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
105 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
106 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
107 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
156 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
159 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
160 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
161 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
162 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
163 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
164 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
165 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
166 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
167 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
168 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
169 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
170 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
171 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
172 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
173 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
174 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
175 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
176 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
177 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
178 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
179 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
180 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
181 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
182 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
183 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
184 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
185 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
186 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
187 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
188 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
189 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
190 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
191 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
192 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
193 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
194 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
195 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
196 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
197 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
198 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
199 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
200 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
201 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
202 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
203 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
204 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
205 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
206 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
207 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
208 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
209 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
210 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
211 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
212 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
213 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
214 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
215 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
216 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
217 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
218 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
219 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
220 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
221 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
222 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
223 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
224 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
225 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
226 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
227 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
228 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
229 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
230 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
231 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
232 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
233 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
234 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
235 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
236 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
237 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
238 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
239 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
240 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
241 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
242 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
243 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
244 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
245 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
246 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.33
Metatranscriptomes 0.67
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.53
Rhizosphere 96.47
Stem 0
Stem Tuber 0
Unclassified 30.25

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070704_101122798 3300005549 Bacteria 715
2 JGI24751J29686_10004104 3300002459 Bacteria 2952
3 Ga0058863_11928163 3300004799 Unclassified 1425
4 Ga0058861_11890518 3300004800 Unclassified 992
5 Ga0058862_12460640 3300004803 Unclassified 666
6 Ga0058862_12609258 3300004803 Bacteria 1511
7 Ga0065704_10002484 3300005289 Bacteria 9944
8 Ga0065704_10081093 3300005289 Bacteria 3821
9 Ga0065715_10000775 3300005293 Bacteria 8453
10 Ga0065715_10139648 3300005293 Bacteria 1873
11 Ga0065715_10458709 3300005293 Bacteria 818
12 Ga0065707_10003125 3300005295 Bacteria 9578
13 Ga0065707_10004606 3300005295 Bacteria 4479
14 Ga0065707_10716576 3300005295 Bacteria 632
15 Ga0070676_10247221 3300005328 Bacteria 1189
16 Ga0070683_100154797 3300005329 Bacteria 2174
17 Ga0070683_100884024 3300005329 Unclassified 857
18 Ga0070690_100050879 3300005330 Bacteria 2643
19 Ga0070690_100365458 3300005330 Bacteria 1051
20 Ga0070670_100003074 3300005331 Bacteria 13801
21 Ga0070670_100018756 3300005331 Bacteria 5932
22 Ga0070670_100053909 3300005331 Unclassified 3453
23 Ga0070677_10062495 3300005333 Bacteria 1541
24 Ga0070666_10031894 3300005335 Bacteria 3480
25 Ga0070666_10111952 3300005335 Bacteria 1888
26 Ga0070680_100064273 3300005336 Bacteria 3007
27 Ga0070680_100462634 3300005336 Bacteria 1084
28 Ga0070682_100254874 3300005337 Bacteria 1267
29 Ga0070660_100009028 3300005339 Bacteria 6995
30 Ga0070689_100007233 3300005340 Bacteria 7742
31 Ga0070689_100035649 3300005340 Unclassified 3802
32 Ga0070689_100223937 3300005340 Bacteria 1544
33 Ga0070689_100380945 3300005340 Bacteria 1189
34 Ga0070689_100817348 3300005340 Unclassified 820
35 Ga0070691_10052333 3300005341 Bacteria 1952
36 Ga0070687_100013990 3300005343 Bacteria 3593
37 Ga0070661_100084245 3300005344 Bacteria 2349
38 Ga0070668_101681380 3300005347 Bacteria 582
39 Ga0070669_100000596 3300005353 Bacteria 26785
40 Ga0070669_100490528 3300005353 Unclassified 1018
41 Ga0070669_100898918 3300005353 Unclassified 756
42 Ga0070675_100002521 3300005354 Bacteria 13706
43 Ga0070675_100057998 3300005354 Unclassified 3193
44 Ga0070675_100664893 3300005354 Bacteria 947
45 Ga0070671_100137196 3300005355 Bacteria 2062
46 Ga0070674_101595195 3300005356 Bacteria 588
47 Ga0070673_100117358 3300005364 Unclassified 2215
48 Ga0070673_100220811 3300005364 Unclassified 1640
49 Ga0070673_100349074 3300005364 Bacteria 1313
50 Ga0070673_101023558 3300005364 Bacteria 770
51 Ga0070688_100019634 3300005365 Unclassified 3917
52 Ga0070688_100071642 3300005365 Bacteria 2219
53 Ga0070659_100481769 3300005366 Unclassified 1056
54 Ga0070709_10198756 3300005434 Unclassified 1418
55 Ga0070713_100086830 3300005436 Bacteria 2683
56 Ga0070713_100147447 3300005436 Bacteria 2090
57 Ga0070710_10269374 3300005437 Bacteria 1101
58 Ga0070710_10566448 3300005437 Bacteria 786
59 Ga0070701_10035599 3300005438 Bacteria 2502
60 Ga0070701_10128766 3300005438 Bacteria 1436
61 Ga0070701_10138614 3300005438 Bacteria 1389
62 Ga0070701_10352328 3300005438 Unclassified 920
63 Ga0070705_100000069 3300005440 Bacteria 54854
64 Ga0070705_100014825 3300005440 Bacteria 4019
65 Ga0070705_100056187 3300005440 Bacteria 2317
66 Ga0070705_100112848 3300005440 Bacteria 1740
67 Ga0070705_100361557 3300005440 Unclassified 1062
68 Ga0070700_100023622 3300005441 Unclassified 3598
69 Ga0070700_100052093 3300005441 Bacteria 2551
70 Ga0070700_100647955 3300005441 Bacteria 834
71 Ga0070694_100022098 3300005444 Unclassified 4074
72 Ga0070694_100297418 3300005444 Bacteria 1236
73 Ga0070678_100255277 3300005456 Bacteria 1472
74 Ga0070678_101117384 3300005456 Bacteria 728
75 Ga0070662_100166807 3300005457 Unclassified 1726
76 Ga0070662_100432818 3300005457 Bacteria 1090
77 Ga0070662_100627107 3300005457 Bacteria 906
78 Ga0070681_10013084 3300005458 Bacteria 8239
79 Ga0070681_10024036 3300005458 Bacteria 6135
80 Ga0070681_10048943 3300005458 Unclassified 4222
81 Ga0070681_10304949 3300005458 Unclassified 1502
82 Ga0070681_10477727 3300005458 Bacteria 1159
83 Ga0070681_10802948 3300005458 Unclassified 858
84 Ga0068867_100033549 3300005459 Unclassified 3718
85 Ga0070706_100197855 3300005467 Bacteria 1877
86 Ga0070706_100400835 3300005467 Unclassified 1277
87 Ga0070706_100845985 3300005467 Bacteria 846
88 Ga0070707_100059756 3300005468 Bacteria 3655
89 Ga0070698_100044591 3300005471 Bacteria 4540
90 Ga0070698_100409741 3300005471 Unclassified 1289
91 Ga0070698_101204935 3300005471 Unclassified 706
92 Ga0070699_100022707 3300005518 Bacteria 5408
93 Ga0070699_100139448 3300005518 Bacteria 2140
94 Ga0070679_100018440 3300005530 Bacteria 6772
95 Ga0070679_100339273 3300005530 Bacteria 1451
96 Ga0070679_100625130 3300005530 Unclassified 1020
97 Ga0070679_100956528 3300005530 Bacteria 800
98 Ga0070679_101552344 3300005530 Unclassified 609
99 Ga0070684_100179959 3300005535 Bacteria 1922
100 Ga0070684_100686337 3300005535 Unclassified 954
101 Ga0070684_101166263 3300005535 Bacteria 724
102 Ga0070697_100095206 3300005536 Bacteria 2468
103 Ga0068853_100530796 3300005539 Unclassified 1113
104 Ga0068853_100887585 3300005539 Bacteria 856
105 Ga0070672_100088129 3300005543 Unclassified 2498
106 Ga0070672_100240951 3300005543 Bacteria 1521
107 Ga0070672_100294070 3300005543 Bacteria 1376
108 Ga0070672_100473574 3300005543 Bacteria 1081
109 Ga0070672_100518656 3300005543 Bacteria 1032
110 Ga0070672_100565488 3300005543 Unclassified 988
111 Ga0070686_100003095 3300005544 Bacteria 9114
112 Ga0070686_100103220 3300005544 Bacteria 1929
113 Ga0070686_100672384 3300005544 Unclassified 823
114 Ga0070695_100000133 3300005545 Bacteria 34008
115 Ga0070695_100012286 3300005545 Bacteria 5136
116 Ga0070695_100021770 3300005545 Bacteria 3927
117 Ga0070695_100721593 3300005545 Bacteria 793
118 Ga0070696_100000157 3300005546 Bacteria 37991
119 Ga0070696_100034575 3300005546 Bacteria 3477
120 Ga0070696_100202030 3300005546 Bacteria 1484
121 Ga0070693_100524157 3300005547 Bacteria 844
122 Ga0070693_100993218 3300005547 Unclassified 634
123 Ga0070704_100009439 3300005549 Bacteria 5892
124 Ga0070704_100016355 3300005549 Unclassified 4685
125 Ga0070704_100057512 3300005549 Bacteria 2765
126 Ga0070704_100118847 3300005549 Bacteria 2026
127 Ga0070704_100981753 3300005549 Unclassified 763
128 Ga0068855_100195964 3300005563 Bacteria 2276
129 Ga0068855_100215955 3300005563 Bacteria 2153
130 Ga0068855_100405661 3300005563 Bacteria 1493
131 Ga0070664_100099457 3300005564 Bacteria 2528
132 Ga0070664_100105150 3300005564 Bacteria 2458
133 Ga0070664_101216811 3300005564 Unclassified 711
134 Ga0068857_100087675 3300005577 Bacteria 2784
135 Ga0068857_100131760 3300005577 Unclassified 2255
136 Ga0068857_100249566 3300005577 Bacteria 1627
137 Ga0068857_100281217 3300005577 Bacteria 1531
138 Ga0068857_100473363 3300005577 Bacteria 1173
139 Ga0068857_101505804 3300005577 Bacteria 656
140 Ga0068854_100005900 3300005578 Bacteria 7758
141 Ga0068854_100179250 3300005578 Bacteria 1654
142 Ga0068856_100035939 3300005614 Bacteria 4857
143 Ga0068856_100242263 3300005614 Unclassified 1818
144 Ga0068856_100873819 3300005614 Bacteria 918
145 Ga0070702_100106626 3300005615 Bacteria 1729
146 Ga0068859_100001112 3300005617 Bacteria 27444
147 Ga0068859_100024181 3300005617 Bacteria 6095
148 Ga0068859_100040886 3300005617 Bacteria 4657
149 Ga0068859_100041964 3300005617 Bacteria 4595
150 Ga0068859_100060275 3300005617 Bacteria 3823
151 Ga0068859_100392946 3300005617 Bacteria 1483
152 Ga0068859_100532879 3300005617 Bacteria 1269
153 Ga0068859_100767033 3300005617 Unclassified 1053
154 Ga0068859_100925874 3300005617 Unclassified 956
155 Ga0068864_100073738 3300005618 Unclassified 2976
156 Ga0068864_100093768 3300005618 Bacteria 2652
157 Ga0068864_100107263 3300005618 Bacteria 2484
158 Ga0068864_100186539 3300005618 Bacteria 1899
159 Ga0068864_101079766 3300005618 Unclassified 798
160 Ga0068861_100011836 3300005719 Bacteria 6072
161 Ga0068861_100026910 3300005719 Bacteria 4185
162 Ga0068861_100210157 3300005719 Unclassified 1639
163 Ga0068861_100453441 3300005719 Bacteria 1150
164 Ga0068870_10004437 3300005840 Bacteria 6043
165 Ga0068870_10128132 3300005840 Bacteria 1471
166 Ga0068863_100011384 3300005841 Bacteria 8609
167 Ga0068863_100327881 3300005841 Bacteria 1488
168 Ga0068863_100328002 3300005841 Bacteria 1488
169 Ga0068863_100846814 3300005841 Bacteria 913
170 Ga0068858_100253490 3300005842 Unclassified 1672
171 Ga0068858_100864980 3300005842 Unclassified 883
172 Ga0068858_101375929 3300005842 Unclassified 695
173 Ga0068858_101664296 3300005842 Unclassified 630
174 Ga0068860_100009826 3300005843 Bacteria 9492
175 Ga0068860_100220386 3300005843 Unclassified 1842
176 Ga0068860_100591277 3300005843 Bacteria 1115
177 Ga0068862_100021671 3300005844 Bacteria 5373
178 Ga0068862_100291662 3300005844 Unclassified 1498
179 Ga0068862_100700990 3300005844 Bacteria 981
180 Ga0081455_10041240 3300005937 Bacteria 4062
181 Ga0070717_10409652 3300006028 Bacteria 1219
182 Ga0070717_10815335 3300006028 Unclassified 849
183 Ga0075432_10107434 3300006058 Unclassified 1037
184 Ga0097621_100002833 3300006237 Bacteria 11893
185 Ga0097621_100013393 3300006237 Bacteria 6114
186 Ga0097621_100257453 3300006237 Unclassified 1530
187 Ga0097621_100455039 3300006237 Bacteria 1154
188 Ga0097621_100968949 3300006237 Unclassified 795
189 Ga0068871_100002968 3300006358 Bacteria 11636
190 Ga0068871_100041248 3300006358 Bacteria 3700
191 Ga0068871_100072644 3300006358 Bacteria 2833
192 Ga0068871_100169473 3300006358 Bacteria 1871
193 Ga0068871_100284869 3300006358 Archaea 1446
194 Ga0068871_100627284 3300006358 Unclassified 979
195 Ga0068871_100824597 3300006358 Bacteria 856
196 Ga0068871_101339169 3300006358 Bacteria 674
197 Ga0075428_100010194 3300006844 Bacteria 10432
198 Ga0075428_100257672 3300006844 Bacteria 1879
199 Ga0075428_100433800 3300006844 Bacteria 1408
200 Ga0075428_100553295 3300006844 Bacteria 1230
201 Ga0075428_100897923 3300006844 Unclassified 940
202 Ga0075431_101232928 3300006847 Bacteria 710
203 Ga0075433_10076388 3300006852 Bacteria 2949
204 Ga0075433_10199722 3300006852 Bacteria 1778
205 Ga0075433_10373995 3300006852 Bacteria 1258
206 Ga0075434_100000134 3300006871 Bacteria 44745
207 Ga0075434_100012587 3300006871 Bacteria 8021
208 Ga0075434_100053141 3300006871 Unclassified 4026
209 Ga0075434_100089122 3300006871 Bacteria 3087
210 Ga0075434_100194677 3300006871 Bacteria 2047
211 Ga0075434_100279771 3300006871 Bacteria 1688
212 Ga0075434_100364891 3300006871 Bacteria 1465
213 Ga0075434_100527025 3300006871 Bacteria 1202
214 Ga0075429_100057750 3300006880 Bacteria 3379
215 Ga0075429_100115678 3300006880 Unclassified 2344
216 Ga0075429_100560798 3300006880 Bacteria 1001
217 Ga0068865_100423537 3300006881 Bacteria 1095
218 Ga0068865_101112257 3300006881 Unclassified 696
219 Ga0075436_100000233 3300006914 Bacteria 34841
220 Ga0097620_100001112 3300006931 Bacteria 27444
221 Ga0097620_100024182 3300006931 Bacteria 6095
222 Ga0097620_100040885 3300006931 Bacteria 4657
223 Ga0097620_100041964 3300006931 Bacteria 4595
224 Ga0097620_100060273 3300006931 Bacteria 3823
225 Ga0097620_100392961 3300006931 Bacteria 1483
226 Ga0097620_100532897 3300006931 Bacteria 1269
227 Ga0097620_100766975 3300006931 Unclassified 1053
228 Ga0097620_100925818 3300006931 Unclassified 956
229 Ga0075435_100000220 3300007076 Bacteria 35137
230 Ga0075435_100002696 3300007076 Bacteria 11857
231 Ga0075435_100095965 3300007076 Unclassified 2452
232 Ga0075435_100180170 3300007076 Unclassified 1785
233 Ga0075435_100855723 3300007076 Bacteria 792
234 Ga0105240_10152272 3300009093 Bacteria 2753
235 Ga0105240_10200150 3300009093 Bacteria 2341
236 Ga0105240_10355171 3300009093 Unclassified 1662
237 Ga0111539_10000329 3300009094 Bacteria 58030
238 Ga0111539_10099433 3300009094 Unclassified 3416
239 Ga0111539_10150560 3300009094 Bacteria 2723
240 Ga0111539_10204688 3300009094 Bacteria 2301
241 Ga0111539_10357357 3300009094 Bacteria 1700
242 Ga0111539_10441449 3300009094 Bacteria 1515
243 Ga0105245_10049350 3300009098 Bacteria 3769
244 Ga0105247_10883011 3300009101 Bacteria 689
245 Ga0114129_10006373 3300009147 Bacteria 16732
246 Ga0114129_10022079 3300009147 Bacteria 9031
247 Ga0114129_10159731 3300009147 Bacteria 3080
248 Ga0114129_10359818 3300009147 Unclassified 1926
249 Ga0114129_10586331 3300009147 Bacteria 1446
250 Ga0105243_10218562 3300009148 Bacteria 1683
251 Ga0105243_10714432 3300009148 Bacteria 978
252 Ga0105241_10110698 3300009174 Unclassified 2197
253 Ga0105242_10543175 3300009176 Unclassified 1113
254 Ga0105242_10649517 3300009176 Unclassified 1026
255 Ga0105248_10031719 3300009177 Bacteria 5904
256 Ga0105248_10037063 3300009177 Bacteria 5453
257 Ga0105248_10171323 3300009177 Bacteria 2446
258 Ga0105248_10512734 3300009177 Bacteria 1352
259 Ga0105237_10519337 3300009545 Unclassified 1197
260 Ga0105238_10088365 3300009551 Unclassified 3085
261 Ga0105249_10009258 3300009553 Bacteria 8611
262 Ga0105249_10127035 3300009553 Bacteria 2429
263 Ga0105249_10415630 3300009553 Bacteria 1378
264 Ga0105239_10825306 3300010375 Bacteria 1063
265 Ga0105246_10572537 3300011119 Bacteria 971
266 Ga0157369_11308461 3300013105 Bacteria 739
267 Ga0157374_10029328 3300013296 Unclassified 4981
268 Ga0157378_10219987 3300013297 Unclassified 1805
269 Ga0157378_10578890 3300013297 Bacteria 1131
270 Ga0163162_10070722 3300013306 Unclassified 3541
271 Ga0157372_10017830 3300013307 Bacteria 7624
272 Ga0157372_10168556 3300013307 Unclassified 2533
273 Ga0157372_10583834 3300013307 Unclassified 1302
274 Ga0157375_10015796 3300013308 Bacteria 6765
275 Ga0157375_10299691 3300013308 Unclassified 1771
276 Ga0157375_11023287 3300013308 Bacteria 965
277 Ga0163163_10063074 3300014325 Bacteria 3673
278 Ga0163163_10743593 3300014325 Unclassified 1044
279 Ga0157380_11724305 3300014326 Bacteria 684
280 Ga0157380_11948250 3300014326 Unclassified 649
281 Ga0157377_10032568 3300014745 Unclassified 2839
282 Ga0157377_10061758 3300014745 Bacteria 2142
283 Ga0157379_10761365 3300014968 Bacteria 912
284 Ga0157379_11479191 3300014968 Unclassified 660
285 Ga0157376_10296501 3300014969 Bacteria 1529
286 Ga0157376_10311440 3300014969 Bacteria 1494
287 Ga0157376_10333030 3300014969 Bacteria 1447
288 Ga0157376_10432107 3300014969 Bacteria 1280
289 Ga0207682_10069913 3300025893 Bacteria 1485
290 Ga0207692_10230942 3300025898 Bacteria 1101
291 Ga0207680_10047117 3300025903 Bacteria 2552
292 Ga0207699_10201805 3300025906 Bacteria 1348
293 Ga0207645_10041419 3300025907 Unclassified 2948
294 Ga0207643_10003250 3300025908 Bacteria 8771
295 Ga0207643_10034784 3300025908 Unclassified 2824
296 Ga0207684_10158310 3300025910 Bacteria 1949
297 Ga0207684_10517659 3300025910 Unclassified 1022
298 Ga0207684_10660479 3300025910 Bacteria 890
299 Ga0207654_10062028 3300025911 Unclassified 2189
300 Ga0207707_10030162 3300025912 Bacteria 4743
301 Ga0207707_10057053 3300025912 Unclassified 3399
302 Ga0207707_10242977 3300025912 Unclassified 1565
303 Ga0207707_10306037 3300025912 Bacteria 1374
304 Ga0207707_10615903 3300025912 Unclassified 918
305 Ga0207695_10201157 3300025913 Bacteria 1906
306 Ga0207695_10317896 3300025913 Unclassified 1446
307 Ga0207660_10084927 3300025917 Unclassified 2334
308 Ga0207660_10758077 3300025917 Unclassified 792
309 Ga0207662_10012815 3300025918 Bacteria 4677
310 Ga0207662_10058582 3300025918 Bacteria 2306
311 Ga0207662_10370820 3300025918 Unclassified 965
312 Ga0207649_10227355 3300025920 Bacteria 1332
313 Ga0207652_10019301 3300025921 Bacteria 5605
314 Ga0207652_10227074 3300025921 Unclassified 1683
315 Ga0207652_10311625 3300025921 Bacteria 1421
316 Ga0207652_10970358 3300025921 Bacteria 748
317 Ga0207646_10049596 3300025922 Bacteria 3759
318 Ga0207646_11291509 3300025922 Unclassified 638
319 Ga0207681_10003145 3300025923 Bacteria 10375
320 Ga0207694_10137340 3300025924 Unclassified 1964
321 Ga0207650_10271166 3300025925 Unclassified 1379
322 Ga0207650_11044149 3300025925 Bacteria 695
323 Ga0207650_11084706 3300025925 Unclassified 681
324 Ga0207650_11296352 3300025925 Unclassified 620
325 Ga0207659_10000237 3300025926 Bacteria 33603
326 Ga0207659_10000321 3300025926 Bacteria 28969
327 Ga0207659_10152933 3300025926 Bacteria 1803
328 Ga0207659_10624366 3300025926 Unclassified 920
329 Ga0207687_10563755 3300025927 Bacteria 957
330 Ga0207687_10861885 3300025927 Unclassified 774
331 Ga0207700_10480437 3300025928 Bacteria 1098
332 Ga0207644_10068107 3300025931 Unclassified 2596
333 Ga0207644_10443389 3300025931 Unclassified 1066
334 Ga0207706_10029283 3300025933 Unclassified 4916
335 Ga0207706_10267311 3300025933 Bacteria 1493
336 Ga0207706_10402510 3300025933 Bacteria 1187
337 Ga0207686_10314121 3300025934 Unclassified 1168
338 Ga0207709_10093179 3300025935 Bacteria 1974
339 Ga0207709_10876149 3300025935 Bacteria 728
340 Ga0207670_10037408 3300025936 Unclassified 3162
341 Ga0207670_10052709 3300025936 Unclassified 2736
342 Ga0207670_10148185 3300025936 Bacteria 1738
343 Ga0207670_10737395 3300025936 Unclassified 817
344 Ga0207669_11270213 3300025937 Bacteria 625
345 Ga0207704_10211558 3300025938 Unclassified 1428
346 Ga0207691_10125637 3300025940 Unclassified 2270
347 Ga0207691_10148034 3300025940 Unclassified 2066
348 Ga0207691_10577611 3300025940 Unclassified 952
349 Ga0207691_10577823 3300025940 Unclassified 952
350 Ga0207711_10642622 3300025941 Bacteria 990
351 Ga0207689_10405969 3300025942 Bacteria 1136
352 Ga0207661_10104517 3300025944 Unclassified 2385
353 Ga0207661_10386580 3300025944 Bacteria 1267
354 Ga0207661_10732940 3300025944 Unclassified 909
355 Ga0207679_10009451 3300025945 Bacteria 6247
356 Ga0207679_10134033 3300025945 Bacteria 1992
357 Ga0207679_10350701 3300025945 Unclassified 1286
358 Ga0207679_10443832 3300025945 Bacteria 1150
359 Ga0207667_10181827 3300025949 Bacteria 2159
360 Ga0207667_10528567 3300025949 Bacteria 1194
361 Ga0207667_10825538 3300025949 Unclassified 922
362 Ga0207651_10024769 3300025960 Bacteria 3718
363 Ga0207651_10195043 3300025960 Bacteria 1618
364 Ga0207651_10493987 3300025960 Bacteria 1057
365 Ga0207651_10838670 3300025960 Unclassified 816
366 Ga0207712_10032467 3300025961 Unclassified 3525
367 Ga0207712_10159398 3300025961 Bacteria 1752
368 Ga0207712_10411502 3300025961 Bacteria 1139
369 Ga0207668_10358570 3300025972 Bacteria 1221
370 Ga0207640_10006145 3300025981 Bacteria 6572
371 Ga0207640_10091488 3300025981 Bacteria 2108
372 Ga0207640_10746316 3300025981 Bacteria 843
373 Ga0207703_10316735 3300026035 Unclassified 1427
374 Ga0207639_10245232 3300026041 Unclassified 1560
375 Ga0207708_10144890 3300026075 Bacteria 1866
376 Ga0207708_10174180 3300026075 Bacteria 1705
377 Ga0207708_10483962 3300026075 Bacteria 1035
378 Ga0207708_11527706 3300026075 Unclassified 587
379 Ga0207702_10274195 3300026078 Bacteria 1592
380 Ga0207641_10171341 3300026088 Bacteria 1982
381 Ga0207641_10468631 3300026088 Unclassified 1219
382 Ga0207648_10000784 3300026089 Bacteria 35793
383 Ga0207676_10033634 3300026095 Bacteria 3874
384 Ga0207676_10038854 3300026095 Bacteria 3636
385 Ga0207676_10180379 3300026095 Bacteria 1848
386 Ga0207676_10639670 3300026095 Bacteria 1025
387 Ga0207676_10924726 3300026095 Unclassified 856
388 Ga0207674_10019967 3300026116 Bacteria 7251
389 Ga0207674_10033926 3300026116 Bacteria 5339
390 Ga0207674_10039891 3300026116 Bacteria 4865
391 Ga0207674_10367648 3300026116 Unclassified 1390
392 Ga0207674_10613402 3300026116 Bacteria 1051
393 Ga0207675_100000123 3300026118 Bacteria 63809
394 Ga0207675_100027691 3300026118 Bacteria 5278
395 Ga0207675_100044996 3300026118 Bacteria 4124
396 Ga0207675_100337734 3300026118 Bacteria 1474
397 Ga0207675_100722130 3300026118 Bacteria 1006
398 Ga0207675_100744492 3300026118 Bacteria 991
399 Ga0207683_10109845 3300026121 Bacteria 2468
400 Ga0207428_10003636 3300027907 Bacteria 14864
401 Ga0207428_10014320 3300027907 Bacteria 6900
402 Ga0268265_10007820 3300028380 Bacteria 7214
403 Ga0268265_10042169 3300028380 Bacteria 3384
404 Ga0268265_10244940 3300028380 Bacteria 1584
405 Ga0268265_10277096 3300028380 Unclassified 1499
406 Ga0268265_10843624 3300028380 Bacteria 896
407 Ga0268264_10008871 3300028381 Bacteria 8335
408 Ga0268264_10501696 3300028381 Bacteria 1184
409 Ga0268264_11099086 3300028381 Bacteria 803
410 Ga0265332_10010871 3300031238 Bacteria 4043
411 Ga0265320_10143144 3300031240 Bacteria 1082
412 Ga0307416_100148265 3300032002 Bacteria 2147
413 Ga0373950_0006166 3300034818 Bacteria 1819
414 Ga0373958_0001553 3300034819 Bacteria 3105
415 Ga0373938_0001952 3300034957 Bacteria 3304
416 Ga0373929_0001388 3300035085 Bacteria 4642
417 Ga0373949_0001787 3300035090 Bacteria 5892
418 Ga0373951_0001967 3300035091 Bacteria 5277
419 Ga0373951_0142837 3300035091 Unclassified 666
420 Ga0373952_0003841 3300035092 Bacteria 2722
421 Ga0373923_0324924 3300035111 Unclassified 731
422 Ga0373932_0000383 3300035112 Bacteria 13634
423 Ga0373932_0051303 3300035112 Bacteria 1225
424 Ga0373936_0187045 3300035113 Unclassified 910
425 Ga0373939_0000665 3300035114 Bacteria 8518
426 Ga0373939_0018202 3300035114 Bacteria 1878
427 Ga0373941_0177511 3300035115 Unclassified 797
428 Ga0373945_0062607 3300035116 Bacteria 1391
429 Ga0373953_0186720 3300035117 Unclassified 895
430 Ga0373956_0256494 3300035119 Bacteria 831
431 Ga0373956_0285281 3300035119 Unclassified 786
432 Ga0373960_0005061 3300035121 Bacteria 3036
433 Ga0373943_0054076 3300035170 Bacteria 1985
434 Ga0373943_0084756 3300035170 Unclassified 1631
435 Ga0373946_0002929 3300035171 Bacteria 6052
436 Ga0373946_0049793 3300035171 Bacteria 1748
437 Ga0373955_0349102 3300035172 Unclassified 896
438 Ga0373955_0413949 3300035172 Unclassified 820
439 Ga0373942_0000774 3300035207 Bacteria 8811
440 Ga0373942_0184997 3300035207 Unclassified 684
441 Ga0373961_0001736 3300035241 Bacteria 6064
442 Ga0373962_0001672 3300035242 Bacteria 5267
443 Ga0373924_0110777 3300035410 Unclassified 1186
444 Ga0373924_0193704 3300035410 Bacteria 896
445 Ga0373931_0019491 3300035691 Bacteria 3386
446 Ga0373935_0044675 3300035692 Unclassified 2793
447 Ga0373935_0061612 3300035692 Bacteria 2402
448 Ga0373927_0061440 3300035695 Bacteria 2431
449 Ga0373933_0453186 3300035724 Unclassified 839
450 Ga0373947_0012960 3300035725 Bacteria 4780
451 Ga0373947_0046022 3300035725 Bacteria 2612
452 Ga0373947_0448621 3300035725 Bacteria 874
453 Ga0373937_0051201 3300036401 Bacteria 3785
454 Ga0373937_0110958 3300036401 Bacteria 2551
455 Ga0373937_0291043 3300036401 Unclassified 1543
456 Ga0373937_0305651 3300036401 Bacteria 1504
457 Ga0373937_0524634 3300036401 Unclassified 1125
458 Ga0373925_0064494 3300037068 Bacteria 2757
459 Ga0373925_0286083 3300037068 Bacteria 1328
460 Ga0373925_0560040 3300037068 Unclassified 940
461 Ga0373925_0775789 3300037068 Unclassified 790
462 Ga0451577_0403271 3300042876 Unclassified 1241
463 Ga0451577_0435487 3300042876 Bacteria 1190
464 Ga0451576_0003278 3300045051 Bacteria 22470
465 Ga0451576_0286694 3300045051 Bacteria 1721
466 Ga0451576_0440748 3300045051 Unclassified 1367
467 Ga0451576_1191556 3300045051 Bacteria 795
468 Ga0495592_0348589 3300046454 Bacteria 950
469 Ga0495592_0456265 3300046454 Unclassified 800
470 Ga0495629_0118683 3300046459 Bacteria 1843
471 Ga0495629_0146957 3300046459 Bacteria 1639
472 Ga0495580_0045683 3300046472 Unclassified 3110
473 Ga0495580_0052875 3300046472 Bacteria 2868
474 Ga0495580_0423174 3300046472 Unclassified 896
475 Ga0495639_0336723 3300046475 Unclassified 756
476 Ga0495584_0040508 3300046491 Bacteria 2352
477 Ga0495594_0588635 3300046499 Unclassified 631
478 Ga0495608_0037657 3300046511 Bacteria 3252
479 Ga0495628_0623217 3300046516 Unclassified 768
480 Ga0495630_0000821 3300046517 Bacteria 21862
481 Ga0495630_0938736 3300046517 Bacteria 658
482 Ga0495663_0015242 3300046525 Bacteria 2163
483 Ga0495642_0024967 3300046528 Unclassified 2366
484 Ga0495652_0189502 3300046529 Bacteria 1571
485 Ga0495587_0252718 3300046536 Bacteria 991
486 Ga0495598_0004449 3300046537 Bacteria 3035
487 Ga0495609_0032964 3300046538 Bacteria 2351
488 Ga0495609_0042955 3300046538 Bacteria 2030
489 Ga0495621_0005391 3300046539 Bacteria 3672
490 Ga0495621_0313905 3300046539 Bacteria 652
491 Ga0495645_0002920 3300046543 Bacteria 11597
492 Ga0495645_0170497 3300046543 Bacteria 1498
493 Ga0495667_0096924 3300046559 Bacteria 1909
494 Ga0495659_0002137 3300046664 Bacteria 6444
495 Ga0495659_0017607 3300046664 Unclassified 2371
496 Ga0495659_0036760 3300046664 Unclassified 1732
497 Ga0495659_0039190 3300046664 Bacteria 1685
498 Ga0495659_0066530 3300046664 Bacteria 1342
499 Ga0495659_0215431 3300046664 Unclassified 791
500 Ga0495659_0285342 3300046664 Unclassified 695
501 Ga0495588_0001631 3300046674 Bacteria 9596
502 Ga0495657_0152890 3300046675 Unclassified 1432
503 Ga0495647_0026790 3300046681 Bacteria 2115
504 Ga0495647_0043063 3300046681 Bacteria 1726
505 Ga0495647_0180481 3300046681 Unclassified 918
506 Ga0495647_0256902 3300046681 Bacteria 779
507 Ga0495658_0105601 3300046683 Unclassified 1687
508 Ga0495658_0290998 3300046683 Bacteria 1032
509 Ga0495658_0455983 3300046683 Bacteria 817
510 Ga0495669_0004930 3300046684 Bacteria 5541
511 Ga0495669_0073870 3300046684 Bacteria 1558
512 Ga0495669_0170492 3300046684 Bacteria 1035
513 Ga0495613_0000415 3300046689 Bacteria 36573
514 Ga0495670_0083425 3300046691 Unclassified 1630
515 Ga0495600_0335556 3300046809 Unclassified 949
516 Ga0495581_0170166 3300047315 Unclassified 1274
517 Ga0495581_0264298 3300047315 Bacteria 1006
518 Ga0495604_0153990 3300047317 Unclassified 1630
519 Ga0495636_0015406 3300047318 Bacteria 3047
520 Ga0495636_0074487 3300047318 Bacteria 1454
521 Ga0495636_0324156 3300047318 Bacteria 724
522 Ga0495677_0016836 3300047445 Bacteria 2651
523 Ga0495684_0002262 3300047471 Bacteria 15430
524 Ga0496102_0041552 3300048905 Bacteria 4164
525 Ga0496102_0148304 3300048905 Bacteria 2203
526 Ga0496104_0026825 3300048907 Bacteria 5325
527 Ga0496105_0514729 3300048908 Bacteria 938
528 Ga0496107_0263066 3300048910 Unclassified 1284
529 Ga0496107_0298411 3300048910 Bacteria 1199
530 Ga0496107_0301816 3300048910 Bacteria 1192
531 Ga0496108_0796933 3300048911 Unclassified 815
532 Ga0496108_1008839 3300048911 Bacteria 711
533 Ga0496109_0192302 3300048912 Bacteria 1918
534 Ga0496109_0229873 3300048912 Bacteria 1745
535 Ga0496109_0724549 3300048912 Unclassified 932
536 Ga0496110_0833502 3300048913 Bacteria 827
537 Ga0496111_0275427 3300048914 Bacteria 1248
538 Ga0496112_0065492 3300048915 Bacteria 3586
539 Ga0496112_0170738 3300048915 Unclassified 2140
540 Ga0496112_0251786 3300048915 Bacteria 1717
541 Ga0496112_0379146 3300048915 Bacteria 1355
542 Ga0496112_0559835 3300048915 Unclassified 1077
543 Ga0496112_0931917 3300048915 Bacteria 790
544 Ga0496113_0531059 3300048916 Unclassified 944
545 Ga0501068_0174071 3300049584 Bacteria 1359
546 Ga0501068_0511575 3300049584 Unclassified 779
547 Ga0501071_0290595 3300049587 Bacteria 1238
548 nmdc:mga05p37_18236_c1 3300050507 Bacteria 8480
549 nmdc:mga05p37_195612_c1 3300050507 Bacteria 2452
550 nmdc:mga05p37_234320_c1 3300050507 Bacteria 2210
551 nmdc:mga05p37_37664_c1 3300050507 Bacteria 5931
552 nmdc:mga09592_1056321_c1 3300050508 Bacteria 677
553 nmdc:mga09592_49492_c1 3300050508 Bacteria 3543
554 nmdc:mga09592_580045_c1 3300050508 Bacteria 962
555 nmdc:mga08y16_146448_c1 3300050511 Bacteria 2455
556 nmdc:mga08y16_173029_c1 3300050511 Bacteria 2242
557 nmdc:mga08y16_88422_c1 3300050511 Bacteria 3229
558 nmdc:mga0n895_1082522_c1 3300050512 Bacteria 780
559 nmdc:mga0n895_10_c1 3300050512 Bacteria 115544
560 nmdc:mga0n895_192530_c1 3300050512 Bacteria 2070
561 nmdc:mga0n895_269831_c1 3300050512 Bacteria 1726
562 nmdc:mga0n895_44447_c1 3300050512 Bacteria 4331
563 nmdc:mga0n895_555457_c1 3300050512 Bacteria 1154
564 nmdc:mga0n895_59959_c1 3300050512 Bacteria 3754
565 nmdc:mga0n895_696272_c1 3300050512 Bacteria 1012
566 nmdc:mga0n895_73061_c1 3300050512 Bacteria 3404
567 nmdc:mga0n895_775233_c1 3300050512 Bacteria 951
568 nmdc:mga0rr50_120718_c1 3300050513 Bacteria 2086
569 nmdc:mga0rr50_1268_c1 3300050513 Bacteria 13739
570 nmdc:mga0rr50_199707_c1 3300050513 Bacteria 1643
571 nmdc:mga0rr50_20_c1 3300050513 Bacteria 140799
572 nmdc:mga0rr50_53739_c1 3300050513 Unclassified 2997
573 nmdc:mga0rr50_551093_c1 3300050513 Bacteria 982
574 nmdc:mga08x19_319_c1 3300050514 Bacteria 34836
575 nmdc:mga08x19_98219_c1 3300050514 Unclassified 1940
576 nmdc:mga0a205_116948_c1 3300050515 Bacteria 2565
577 nmdc:mga0a205_254739_c2 3300050515 Bacteria 1333
578 nmdc:mga0a205_277373_c1 3300050515 Bacteria 1552
579 nmdc:mga0a205_310644_c1 3300050515 Bacteria 1449
580 nmdc:mga0a205_7558_c1 3300050515 Bacteria 9846
581 Ga0495601_0112861 3300053077 Bacteria 1761
582 Ga0495601_0149765 3300053077 Bacteria 1523
583 Ga0495601_0153760 3300053077 Unclassified 1502
584 Ga0495601_0435831 3300053077 Unclassified 848
585 Ga0495601_0713773 3300053077 Unclassified 639
586 Ga0495595_0139134 3300053084 Unclassified 1190
587 Ga0495595_0148046 3300053084 Bacteria 1154
588 Ga0495595_0158511 3300053084 Bacteria 1116
589 Ga0495595_0268200 3300053084 Unclassified 856
590 Ga0495595_0284632 3300053084 Unclassified 830
591 Ga0495619_0002614 3300053085 Bacteria 11763
592 Ga0495619_0039391 3300053085 Unclassified 3085
593 Ga0495619_0253749 3300053085 Bacteria 1219
594 Ga0495619_0294942 3300053085 Unclassified 1123
595 Ga0495619_0649980 3300053085 Bacteria 719
596 Ga0070704_101122798
597 JGI24751J29686_10004104
598 Ga0058863_11928163
599 Ga0058861_11890518
600 Ga0058862_12460640
601 Ga0058862_12609258
602 Ga0065704_10002484
603 Ga0065704_10081093
604 Ga0065715_10000775
605 Ga0065715_10139648
606 Ga0065715_10458709
607 Ga0065707_10003125
608 Ga0065707_10004606
609 Ga0065707_10716576
610 Ga0070676_10247221
611 Ga0070683_100154797
612 Ga0070683_100884024
613 Ga0070690_100050879
614 Ga0070690_100365458
615 Ga0070670_100003074
616 Ga0070670_100018756
617 Ga0070670_100053909
618 Ga0070677_10062495
619 Ga0070666_10031894
620 Ga0070666_10111952
621 Ga0070680_100064273
622 Ga0070680_100462634
623 Ga0070682_100254874
624 Ga0070660_100009028
625 Ga0070689_100007233
626 Ga0070689_100035649
627 Ga0070689_100223937
628 Ga0070689_100380945
629 Ga0070689_100817348
630 Ga0070691_10052333
631 Ga0070687_100013990
632 Ga0070661_100084245
633 Ga0070668_101681380
634 Ga0070669_100000596
635 Ga0070669_100490528
636 Ga0070669_100898918
637 Ga0070675_100002521
638 Ga0070675_100057998
639 Ga0070675_100664893
640 Ga0070671_100137196
641 Ga0070674_101595195
642 Ga0070673_100117358
643 Ga0070673_100220811
644 Ga0070673_100349074
645 Ga0070673_101023558
646 Ga0070688_100019634
647 Ga0070688_100071642
648 Ga0070659_100481769
649 Ga0070709_10198756
650 Ga0070713_100086830
651 Ga0070713_100147447
652 Ga0070710_10269374
653 Ga0070710_10566448
654 Ga0070701_10035599
655 Ga0070701_10128766
656 Ga0070701_10138614
657 Ga0070701_10352328
658 Ga0070705_100000069
659 Ga0070705_100014825
660 Ga0070705_100056187
661 Ga0070705_100112848
662 Ga0070705_100361557
663 Ga0070700_100023622
664 Ga0070700_100052093
665 Ga0070700_100647955
666 Ga0070694_100022098
667 Ga0070694_100297418
668 Ga0070678_100255277
669 Ga0070678_101117384
670 Ga0070662_100166807
671 Ga0070662_100432818
672 Ga0070662_100627107
673 Ga0070681_10013084
674 Ga0070681_10024036
675 Ga0070681_10048943
676 Ga0070681_10304949
677 Ga0070681_10477727
678 Ga0070681_10802948
679 Ga0068867_100033549
680 Ga0070706_100197855
681 Ga0070706_100400835
682 Ga0070706_100845985
683 Ga0070707_100059756
684 Ga0070698_100044591
685 Ga0070698_100409741
686 Ga0070698_101204935
687 Ga0070699_100022707
688 Ga0070699_100139448
689 Ga0070679_100018440
690 Ga0070679_100339273
691 Ga0070679_100625130
692 Ga0070679_100956528
693 Ga0070679_101552344
694 Ga0070684_100179959
695 Ga0070684_100686337
696 Ga0070684_101166263
697 Ga0070697_100095206
698 Ga0068853_100530796
699 Ga0068853_100887585
700 Ga0070672_100088129
701 Ga0070672_100240951
702 Ga0070672_100294070
703 Ga0070672_100473574
704 Ga0070672_100518656
705 Ga0070672_100565488
706 Ga0070686_100003095
707 Ga0070686_100103220
708 Ga0070686_100672384
709 Ga0070695_100000133
710 Ga0070695_100012286
711 Ga0070695_100021770
712 Ga0070695_100721593
713 Ga0070696_100000157
714 Ga0070696_100034575
715 Ga0070696_100202030
716 Ga0070693_100524157
717 Ga0070693_100993218
718 Ga0070704_100009439
719 Ga0070704_100016355
720 Ga0070704_100057512
721 Ga0070704_100118847
722 Ga0070704_100981753
723 Ga0068855_100195964
724 Ga0068855_100215955
725 Ga0068855_100405661
726 Ga0070664_100099457
727 Ga0070664_100105150
728 Ga0070664_101216811
729 Ga0068857_100087675
730 Ga0068857_100131760
731 Ga0068857_100249566
732 Ga0068857_100281217
733 Ga0068857_100473363
734 Ga0068857_101505804
735 Ga0068854_100005900
736 Ga0068854_100179250
737 Ga0068856_100035939
738 Ga0068856_100242263
739 Ga0068856_100873819
740 Ga0070702_100106626
741 Ga0068859_100001112
742 Ga0068859_100024181
743 Ga0068859_100040886
744 Ga0068859_100041964
745 Ga0068859_100060275
746 Ga0068859_100392946
747 Ga0068859_100532879
748 Ga0068859_100767033
749 Ga0068859_100925874
750 Ga0068864_100073738
751 Ga0068864_100093768
752 Ga0068864_100107263
753 Ga0068864_100186539
754 Ga0068864_101079766
755 Ga0068861_100011836
756 Ga0068861_100026910
757 Ga0068861_100210157
758 Ga0068861_100453441
759 Ga0068870_10004437
760 Ga0068870_10128132
761 Ga0068863_100011384
762 Ga0068863_100327881
763 Ga0068863_100328002
764 Ga0068863_100846814
765 Ga0068858_100253490
766 Ga0068858_100864980
767 Ga0068858_101375929
768 Ga0068858_101664296
769 Ga0068860_100009826
770 Ga0068860_100220386
771 Ga0068860_100591277
772 Ga0068862_100021671
773 Ga0068862_100291662
774 Ga0068862_100700990
775 Ga0081455_10041240
776 Ga0070717_10409652
777 Ga0070717_10815335
778 Ga0075432_10107434
779 Ga0097621_100002833
780 Ga0097621_100013393
781 Ga0097621_100257453
782 Ga0097621_100455039
783 Ga0097621_100968949
784 Ga0068871_100002968
785 Ga0068871_100041248
786 Ga0068871_100072644
787 Ga0068871_100169473
788 Ga0068871_100284869
789 Ga0068871_100627284
790 Ga0068871_100824597
791 Ga0068871_101339169
792 Ga0075428_100010194
793 Ga0075428_100257672
794 Ga0075428_100433800
795 Ga0075428_100553295
796 Ga0075428_100897923
797 Ga0075431_101232928
798 Ga0075433_10076388
799 Ga0075433_10199722
800 Ga0075433_10373995
801 Ga0075434_100000134
802 Ga0075434_100012587
803 Ga0075434_100053141
804 Ga0075434_100089122
805 Ga0075434_100194677
806 Ga0075434_100279771
807 Ga0075434_100364891
808 Ga0075434_100527025
809 Ga0075429_100057750
810 Ga0075429_100115678
811 Ga0075429_100560798
812 Ga0068865_100423537
813 Ga0068865_101112257
814 Ga0075436_100000233
815 Ga0097620_100001112
816 Ga0097620_100024182
817 Ga0097620_100040885
818 Ga0097620_100041964
819 Ga0097620_100060273
820 Ga0097620_100392961
821 Ga0097620_100532897
822 Ga0097620_100766975
823 Ga0097620_100925818
824 Ga0075435_100000220
825 Ga0075435_100002696
826 Ga0075435_100095965
827 Ga0075435_100180170
828 Ga0075435_100855723
829 Ga0105240_10152272
830 Ga0105240_10200150
831 Ga0105240_10355171
832 Ga0111539_10000329
833 Ga0111539_10099433
834 Ga0111539_10150560
835 Ga0111539_10204688
836 Ga0111539_10357357
837 Ga0111539_10441449
838 Ga0105245_10049350
839 Ga0105247_10883011
840 Ga0114129_10006373
841 Ga0114129_10022079
842 Ga0114129_10159731
843 Ga0114129_10359818
844 Ga0114129_10586331
845 Ga0105243_10218562
846 Ga0105243_10714432
847 Ga0105241_10110698
848 Ga0105242_10543175
849 Ga0105242_10649517
850 Ga0105248_10031719
851 Ga0105248_10037063
852 Ga0105248_10171323
853 Ga0105248_10512734
854 Ga0105237_10519337
855 Ga0105238_10088365
856 Ga0105249_10009258
857 Ga0105249_10127035
858 Ga0105249_10415630
859 Ga0105239_10825306
860 Ga0105246_10572537
861 Ga0157369_11308461
862 Ga0157374_10029328
863 Ga0157378_10219987
864 Ga0157378_10578890
865 Ga0163162_10070722
866 Ga0157372_10017830
867 Ga0157372_10168556
868 Ga0157372_10583834
869 Ga0157375_10015796
870 Ga0157375_10299691
871 Ga0157375_11023287
872 Ga0163163_10063074
873 Ga0163163_10743593
874 Ga0157380_11724305
875 Ga0157380_11948250
876 Ga0157377_10032568
877 Ga0157377_10061758
878 Ga0157379_10761365
879 Ga0157379_11479191
880 Ga0157376_10296501
881 Ga0157376_10311440
882 Ga0157376_10333030
883 Ga0157376_10432107
884 Ga0207682_10069913
885 Ga0207692_10230942
886 Ga0207680_10047117
887 Ga0207699_10201805
888 Ga0207645_10041419
889 Ga0207643_10003250
890 Ga0207643_10034784
891 Ga0207684_10158310
892 Ga0207684_10517659
893 Ga0207684_10660479
894 Ga0207654_10062028
895 Ga0207707_10030162
896 Ga0207707_10057053
897 Ga0207707_10242977
898 Ga0207707_10306037
899 Ga0207707_10615903
900 Ga0207695_10201157
901 Ga0207695_10317896
902 Ga0207660_10084927
903 Ga0207660_10758077
904 Ga0207662_10012815
905 Ga0207662_10058582
906 Ga0207662_10370820
907 Ga0207649_10227355
908 Ga0207652_10019301
909 Ga0207652_10227074
910 Ga0207652_10311625
911 Ga0207652_10970358
912 Ga0207646_10049596
913 Ga0207646_11291509
914 Ga0207681_10003145
915 Ga0207694_10137340
916 Ga0207650_10271166
917 Ga0207650_11044149
918 Ga0207650_11084706
919 Ga0207650_11296352
920 Ga0207659_10000237
921 Ga0207659_10000321
922 Ga0207659_10152933
923 Ga0207659_10624366
924 Ga0207687_10563755
925 Ga0207687_10861885
926 Ga0207700_10480437
927 Ga0207644_10068107
928 Ga0207644_10443389
929 Ga0207706_10029283
930 Ga0207706_10267311
931 Ga0207706_10402510
932 Ga0207686_10314121
933 Ga0207709_10093179
934 Ga0207709_10876149
935 Ga0207670_10037408
936 Ga0207670_10052709
937 Ga0207670_10148185
938 Ga0207670_10737395
939 Ga0207669_11270213
940 Ga0207704_10211558
941 Ga0207691_10125637
942 Ga0207691_10148034
943 Ga0207691_10577611
944 Ga0207691_10577823
945 Ga0207711_10642622
946 Ga0207689_10405969
947 Ga0207661_10104517
948 Ga0207661_10386580
949 Ga0207661_10732940
950 Ga0207679_10009451
951 Ga0207679_10134033
952 Ga0207679_10350701
953 Ga0207679_10443832
954 Ga0207667_10181827
955 Ga0207667_10528567
956 Ga0207667_10825538
957 Ga0207651_10024769
958 Ga0207651_10195043
959 Ga0207651_10493987
960 Ga0207651_10838670
961 Ga0207712_10032467
962 Ga0207712_10159398
963 Ga0207712_10411502
964 Ga0207668_10358570
965 Ga0207640_10006145
966 Ga0207640_10091488
967 Ga0207640_10746316
968 Ga0207703_10316735
969 Ga0207639_10245232
970 Ga0207708_10144890
971 Ga0207708_10174180
972 Ga0207708_10483962
973 Ga0207708_11527706
974 Ga0207702_10274195
975 Ga0207641_10171341
976 Ga0207641_10468631
977 Ga0207648_10000784
978 Ga0207676_10033634
979 Ga0207676_10038854
980 Ga0207676_10180379
981 Ga0207676_10639670
982 Ga0207676_10924726
983 Ga0207674_10019967
984 Ga0207674_10033926
985 Ga0207674_10039891
986 Ga0207674_10367648
987 Ga0207674_10613402
988 Ga0207675_100000123
989 Ga0207675_100027691
990 Ga0207675_100044996
991 Ga0207675_100337734
992 Ga0207675_100722130
993 Ga0207675_100744492
994 Ga0207683_10109845
995 Ga0207428_10003636
996 Ga0207428_10014320
997 Ga0268265_10007820
998 Ga0268265_10042169
999 Ga0268265_10244940
1000 Ga0268265_10277096
1001 Ga0268265_10843624
1002 Ga0268264_10008871
1003 Ga0268264_10501696
1004 Ga0268264_11099086
1005 Ga0265332_10010871
1006 Ga0265320_10143144
1007 Ga0307416_100148265
1008 Ga0373950_0006166
1009 Ga0373958_0001553
1010 Ga0373938_0001952
1011 Ga0373929_0001388
1012 Ga0373949_0001787
1013 Ga0373951_0001967
1014 Ga0373951_0142837
1015 Ga0373952_0003841
1016 Ga0373923_0324924
1017 Ga0373932_0000383
1018 Ga0373932_0051303
1019 Ga0373936_0187045
1020 Ga0373939_0000665
1021 Ga0373939_0018202
1022 Ga0373941_0177511
1023 Ga0373945_0062607
1024 Ga0373953_0186720
1025 Ga0373956_0256494
1026 Ga0373956_0285281
1027 Ga0373960_0005061
1028 Ga0373943_0054076
1029 Ga0373943_0084756
1030 Ga0373946_0002929
1031 Ga0373946_0049793
1032 Ga0373955_0349102
1033 Ga0373955_0413949
1034 Ga0373942_0000774
1035 Ga0373942_0184997
1036 Ga0373961_0001736
1037 Ga0373962_0001672
1038 Ga0373924_0110777
1039 Ga0373924_0193704
1040 Ga0373931_0019491
1041 Ga0373935_0044675
1042 Ga0373935_0061612
1043 Ga0373927_0061440
1044 Ga0373933_0453186
1045 Ga0373947_0012960
1046 Ga0373947_0046022
1047 Ga0373947_0448621
1048 Ga0373937_0051201
1049 Ga0373937_0110958
1050 Ga0373937_0291043
1051 Ga0373937_0305651
1052 Ga0373937_0524634
1053 Ga0373925_0064494
1054 Ga0373925_0286083
1055 Ga0373925_0560040
1056 Ga0373925_0775789
1057 Ga0451577_0403271
1058 Ga0451577_0435487
1059 Ga0451576_0003278
1060 Ga0451576_0286694
1061 Ga0451576_0440748
1062 Ga0451576_1191556
1063 Ga0495592_0348589
1064 Ga0495592_0456265
1065 Ga0495629_0118683
1066 Ga0495629_0146957
1067 Ga0495580_0045683
1068 Ga0495580_0052875
1069 Ga0495580_0423174
1070 Ga0495639_0336723
1071 Ga0495584_0040508
1072 Ga0495594_0588635
1073 Ga0495608_0037657
1074 Ga0495628_0623217
1075 Ga0495630_0000821
1076 Ga0495630_0938736
1077 Ga0495663_0015242
1078 Ga0495642_0024967
1079 Ga0495652_0189502
1080 Ga0495587_0252718
1081 Ga0495598_0004449
1082 Ga0495609_0032964
1083 Ga0495609_0042955
1084 Ga0495621_0005391
1085 Ga0495621_0313905
1086 Ga0495645_0002920
1087 Ga0495645_0170497
1088 Ga0495667_0096924
1089 Ga0495659_0002137
1090 Ga0495659_0017607
1091 Ga0495659_0036760
1092 Ga0495659_0039190
1093 Ga0495659_0066530
1094 Ga0495659_0215431
1095 Ga0495659_0285342
1096 Ga0495588_0001631
1097 Ga0495657_0152890
1098 Ga0495647_0026790
1099 Ga0495647_0043063
1100 Ga0495647_0180481
1101 Ga0495647_0256902
1102 Ga0495658_0105601
1103 Ga0495658_0290998
1104 Ga0495658_0455983
1105 Ga0495669_0004930
1106 Ga0495669_0073870
1107 Ga0495669_0170492
1108 Ga0495613_0000415
1109 Ga0495670_0083425
1110 Ga0495600_0335556
1111 Ga0495581_0170166
1112 Ga0495581_0264298
1113 Ga0495604_0153990
1114 Ga0495636_0015406
1115 Ga0495636_0074487
1116 Ga0495636_0324156
1117 Ga0495677_0016836
1118 Ga0495684_0002262
1119 Ga0496102_0041552
1120 Ga0496102_0148304
1121 Ga0496104_0026825
1122 Ga0496105_0514729
1123 Ga0496107_0263066
1124 Ga0496107_0298411
1125 Ga0496107_0301816
1126 Ga0496108_0796933
1127 Ga0496108_1008839
1128 Ga0496109_0192302
1129 Ga0496109_0229873
1130 Ga0496109_0724549
1131 Ga0496110_0833502
1132 Ga0496111_0275427
1133 Ga0496112_0065492
1134 Ga0496112_0170738
1135 Ga0496112_0251786
1136 Ga0496112_0379146
1137 Ga0496112_0559835
1138 Ga0496112_0931917
1139 Ga0496113_0531059
1140 Ga0501068_0174071
1141 Ga0501068_0511575
1142 Ga0501071_0290595
1143 nmdc:mga05p37_18236_c1
1144 nmdc:mga05p37_195612_c1
1145 nmdc:mga05p37_234320_c1
1146 nmdc:mga05p37_37664_c1
1147 nmdc:mga09592_1056321_c1
1148 nmdc:mga09592_49492_c1
1149 nmdc:mga09592_580045_c1
1150 nmdc:mga08y16_146448_c1
1151 nmdc:mga08y16_173029_c1
1152 nmdc:mga08y16_88422_c1
1153 nmdc:mga0n895_1082522_c1
1154 nmdc:mga0n895_10_c1
1155 nmdc:mga0n895_192530_c1
1156 nmdc:mga0n895_269831_c1
1157 nmdc:mga0n895_44447_c1
1158 nmdc:mga0n895_555457_c1
1159 nmdc:mga0n895_59959_c1
1160 nmdc:mga0n895_696272_c1
1161 nmdc:mga0n895_73061_c1
1162 nmdc:mga0n895_775233_c1
1163 nmdc:mga0rr50_120718_c1
1164 nmdc:mga0rr50_1268_c1
1165 nmdc:mga0rr50_199707_c1
1166 nmdc:mga0rr50_20_c1
1167 nmdc:mga0rr50_53739_c1
1168 nmdc:mga0rr50_551093_c1
1169 nmdc:mga08x19_319_c1
1170 nmdc:mga08x19_98219_c1
1171 nmdc:mga0a205_116948_c1
1172 nmdc:mga0a205_254739_c2
1173 nmdc:mga0a205_277373_c1
1174 nmdc:mga0a205_310644_c1
1175 nmdc:mga0a205_7558_c1
1176 Ga0495601_0112861
1177 Ga0495601_0149765
1178 Ga0495601_0153760
1179 Ga0495601_0435831
1180 Ga0495601_0713773
1181 Ga0495595_0139134
1182 Ga0495595_0148046
1183 Ga0495595_0158511
1184 Ga0495595_0268200
1185 Ga0495595_0284632
1186 Ga0495619_0002614
1187 Ga0495619_0039391
1188 Ga0495619_0253749
1189 Ga0495619_0294942
1190 Ga0495619_0649980

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04273

BLH_phosphatase

Beta-lactamase hydrolase-like protein, phosphatase-like domain

61

169

0.86

PF22741

PTP-NADK

DSP-PTPase phosphatase fused to NAD+ Kinase

47

195

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
3nme-assembly1.cif.gz_B structure of a plant phosphatase 0.8267 35 157
4kyq-assembly1.cif.gz_A structure of a product bound plant phosphatase 0.8248 32 157
2i6i-assembly1.cif.gz_A crystal structures of the archaeal sulfolobus ptp-fold phosphatase 0.8196 41 170
2i6o-assembly1.cif.gz_A crystal structure of the complex of the archaeal sulfolobus ptp-fold phosphatase with phosphopeptides n-g-(p)y-k-n 0.8088 41 174
4pyh-assembly1.cif.gz_A phospho-glucan bound structure of starch phosphatase starch excess4 reveals the mechanism for c6-specificty 0.8035 26 157
ID Description Score Start End Superfamily
af_Q54QF3_111_235_3.90.190.10 Alpha Beta;Alpha-Beta Complex;Protein-Tyrosine Phosphatase; Chain A;Protein tyrosine phosphatase superfamily 0.8593 130 171 3.90.190.10
2dxpA00 Alpha Beta;Alpha-Beta Complex;Protein-Tyrosine Phosphatase; Chain A;Protein tyrosine phosphatase superfamily 0.8224 41 176 3.90.190.10
1fpzC00 Alpha Beta;Alpha-Beta Complex;Protein-Tyrosine Phosphatase; Chain A;Protein tyrosine phosphatase superfamily 0.8013 43 174 3.90.190.10
2f46B00 Alpha Beta;Alpha-Beta Complex;Protein-Tyrosine Phosphatase; Chain A;Protein tyrosine phosphatase superfamily 0.7919 38 170 3.90.190.10
af_Q9UUF3_81_240_3.90.190.10 Alpha Beta;Alpha-Beta Complex;Protein-Tyrosine Phosphatase; Chain A;Protein tyrosine phosphatase superfamily 0.7803 34 171 3.90.190.10
ID Description Score Start End GO Terms
AF-A0A7Y5WUX3-F1-model_v4 Rhodanese domain-containing protein 0.9623 24 174 GO:0016787
AF-A0A7W0KBH3-F1-model_v4 DSP-PTPase phosphatase fused to NAD+ Kinase domain-containing protein 0.9546 67 177
AF-A0A2V8KTU2-F1-model_v4 Beta-lactamase hydrolase-like protein phosphatase-like domain-containing protein 0.9532 20 177 GO:0016787
AF-A0A2V8GKJ1-F1-model_v4 Uncharacterized protein 0.9461 74 177 GO:0016787
AF-A0A2V8M640-F1-model_v4 Beta-lactamase hydrolase-like protein phosphatase-like domain-containing protein 0.9363 16 177 GO:0016787

Map