F467303

General Info

Members Datasets Scaffolds Average Seq Length
594 256 1188 273

Family's Representative Sequence

Representative Sequence 3300005456|Ga0070678_100266744|Ga0070678_1002667441
Length 301
Sequence MRGALGSKARQKSAGAQVSPVLGGSVARKPIITLTTDFGLNDHFVGTMKGVILSIEPEAQIVDISHAVQAFDVLDAALTVSQAYNYFPTGTVHMVIVDPGVGTARRPIVVTTERHNFVAPDNGVLSLVYQKEQRIHARAVTAEHYALQPISNTFHGRDLFSPVAAYLAKGVDPEKFGEEITDFVRFNAPKPKPVNETTLRGVVLKVDRFGNLITNITPEDVPMLFTEPPAPFKIVIGKREVMEIKTAYAQGAPGEVFGILGSMGFLEVAANRGSAAQVLGVGKGTDVNIVLGGAVAAGNGG

Samples

Sample ID Description Type Environment
1 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
2 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
4 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
7 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
8 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
9 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
18 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
22 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
23 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
24 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
25 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
26 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
27 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
28 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
29 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
30 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
31 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
32 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
33 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
34 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
35 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
36 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
37 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
38 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
39 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
40 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
41 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
42 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
43 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
44 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
45 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
46 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
47 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
48 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
49 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
50 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
51 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
52 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
53 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
54 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
55 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
56 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
57 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
58 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
59 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
60 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
61 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
62 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
63 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
64 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
65 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
66 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
67 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
68 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
69 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
70 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
71 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
72 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
73 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
74 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
75 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
76 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
77 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
78 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
79 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
80 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
82 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
83 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
84 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
85 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
86 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
87 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
88 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
89 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
90 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
91 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
92 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
93 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
94 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
95 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
96 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
97 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
98 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
99 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
100 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
101 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
102 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
103 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
104 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
105 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
106 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
107 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
108 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
109 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
110 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
111 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
112 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
113 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
114 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
115 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
116 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
117 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
118 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
119 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
183 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
184 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
185 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
186 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
187 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
188 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
189 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
190 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
191 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
192 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
193 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
194 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
195 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
196 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
197 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
198 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
199 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
200 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
201 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
202 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
203 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
204 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
205 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
206 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
207 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
208 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
209 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
210 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
211 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
212 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
213 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
214 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
215 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
216 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
217 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
218 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
219 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
220 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
221 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
222 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
223 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
224 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
225 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
226 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
227 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
228 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
229 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
230 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
231 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
232 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
233 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
234 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
235 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
236 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
237 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
238 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
239 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
240 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
241 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
242 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
243 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
244 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
245 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
246 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
247 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
248 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
249 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
250 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
251 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
252 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
253 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
254 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
255 2739367866 Hymenobacter sp. YR204 Isolate Unclassified
256 2910245624 Adhaeribacter radiodurans KUDC8001 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.33
Metatranscriptomes 0.34
Isolates 0.34

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 6.57
Rhizosphere 93.1
Stem 0
Stem Tuber 0
Unclassified 21.04

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070678_100266744 3300005456 Bacteria 1442
2 MRS1b_contig_8068207 2162886011 Bacteria 2358
3 MBSR1b_contig_12601351 2162886012 Bacteria 2424
4 MBSR1b_contig_9154985 2162886012 Bacteria 1588
5 JGI24747J21853_1002677 3300001978 Unclassified 1475
6 JGI24737J22298_10008848 3300001990 Bacteria 3360
7 JGI24748J21848_1001252 3300002074 Bacteria 2779
8 JGI24751J29686_10001087 3300002459 Bacteria 5892
9 Ga0065712_10012270 3300005290 Bacteria 2131
10 Ga0065712_10087863 3300005290 Bacteria 2551
11 Ga0065712_10118918 3300005290 Bacteria 1693
12 Ga0065715_10119565 3300005293 Bacteria 2252
13 Ga0070658_10016468 3300005327 Bacteria 5916
14 Ga0070676_10001793 3300005328 Bacteria 10937
15 Ga0070683_100019515 3300005329 Bacteria 6022
16 Ga0070683_100051204 3300005329 Bacteria 3823
17 Ga0070683_100062412 3300005329 Bacteria 3465
18 Ga0070690_100279583 3300005330 Unclassified 1190
19 Ga0070670_100074330 3300005331 Unclassified 2919
20 Ga0068869_100057535 3300005334 Bacteria 2839
21 Ga0068869_100145922 3300005334 Bacteria 1831
22 Ga0068869_100265991 3300005334 Bacteria 1374
23 Ga0070666_10008992 3300005335 Bacteria 6219
24 Ga0070666_10345968 3300005335 Unclassified 1063
25 Ga0070680_100166670 3300005336 Bacteria 1852
26 Ga0070682_100144430 3300005337 Bacteria 1626
27 Ga0070682_100296545 3300005337 Unclassified 1184
28 Ga0068868_100019030 3300005338 Bacteria 5141
29 Ga0068868_100025908 3300005338 Bacteria 4464
30 Ga0068868_100026331 3300005338 Bacteria 4431
31 Ga0068868_100061868 3300005338 Bacteria 2966
32 Ga0068868_100101083 3300005338 Unclassified 2333
33 Ga0070660_100001514 3300005339 Bacteria 15928
34 Ga0070660_100029552 3300005339 Bacteria 4108
35 Ga0070660_100219898 3300005339 Unclassified 1543
36 Ga0070689_100018545 3300005340 Bacteria 5129
37 Ga0070691_10184171 3300005341 Bacteria 1088
38 Ga0070687_100027529 3300005343 Bacteria 2747
39 Ga0070687_100127366 3300005343 Bacteria 1465
40 Ga0070687_100189145 3300005343 Unclassified 1239
41 Ga0070661_100002033 3300005344 Bacteria 13977
42 Ga0070661_100050056 3300005344 Bacteria 3058
43 Ga0070661_100097345 3300005344 Bacteria 2184
44 Ga0070661_100193236 3300005344 Bacteria 1553
45 Ga0070668_100025094 3300005347 Bacteria 4518
46 Ga0070668_100025449 3300005347 Bacteria 4486
47 Ga0070669_100018507 3300005353 Bacteria 4978
48 Ga0070669_100054538 3300005353 Bacteria 2928
49 Ga0070669_100247592 3300005353 Bacteria 1418
50 Ga0070671_100235184 3300005355 Bacteria 1555
51 Ga0070674_100099350 3300005356 Bacteria 2117
52 Ga0070674_100162243 3300005356 Unclassified 1697
53 Ga0070674_100468273 3300005356 Bacteria 1043
54 Ga0070673_100021725 3300005364 Bacteria 4660
55 Ga0070673_100115792 3300005364 Unclassified 2229
56 Ga0070688_100023746 3300005365 Bacteria 3610
57 Ga0070659_100013876 3300005366 Bacteria 6010
58 Ga0070659_100018702 3300005366 Bacteria 5230
59 Ga0070659_100092394 3300005366 Bacteria 2426
60 Ga0070667_100029222 3300005367 Bacteria 4592
61 Ga0070667_100110671 3300005367 Bacteria 2381
62 Ga0070709_10016510 3300005434 Bacteria 4217
63 Ga0070709_10025106 3300005434 Bacteria 3518
64 Ga0070709_10036671 3300005434 Bacteria 2989
65 Ga0070709_10043452 3300005434 Bacteria 2779
66 Ga0070709_10093249 3300005434 Unclassified 1990
67 Ga0070714_100030051 3300005435 Bacteria 4521
68 Ga0070714_100072522 3300005435 Bacteria 2981
69 Ga0070714_100078478 3300005435 Unclassified 2869
70 Ga0070714_100516843 3300005435 Bacteria 1140
71 Ga0070714_100582265 3300005435 Unclassified 1073
72 Ga0070713_100000113 3300005436 Bacteria 52925
73 Ga0070713_100024669 3300005436 Unclassified 4689
74 Ga0070713_100025507 3300005436 Bacteria 4622
75 Ga0070713_100029469 3300005436 Bacteria 4348
76 Ga0070713_100099201 3300005436 Bacteria 2519
77 Ga0070713_100185551 3300005436 Unclassified 1872
78 Ga0070710_10008846 3300005437 Bacteria 4912
79 Ga0070710_10009740 3300005437 Bacteria 4707
80 Ga0070710_10092810 3300005437 Bacteria 1784
81 Ga0070711_100000236 3300005439 Bacteria 28538
82 Ga0070711_100002807 3300005439 Bacteria 9996
83 Ga0070711_100012358 3300005439 Bacteria 5330
84 Ga0070711_100088294 3300005439 Bacteria 2227
85 Ga0070711_100530572 3300005439 Unclassified 974
86 Ga0070705_100137617 3300005440 Bacteria 1603
87 Ga0070705_100364370 3300005440 Unclassified 1058
88 Ga0070700_100294354 3300005441 Unclassified 1182
89 Ga0070694_100168201 3300005444 Unclassified 1613
90 Ga0070708_100007935 3300005445 Bacteria 8501
91 Ga0070708_100017096 3300005445 Bacteria 6040
92 Ga0070708_100036020 3300005445 Bacteria 4314
93 Ga0070708_100289722 3300005445 Unclassified 1541
94 Ga0070708_100530130 3300005445 Bacteria 1111
95 Ga0070663_100010946 3300005455 Bacteria 5671
96 Ga0070663_100083542 3300005455 Bacteria 2352
97 Ga0070678_100011545 3300005456 Bacteria 5456
98 Ga0070678_100066024 3300005456 Bacteria 2688
99 Ga0070678_100418675 3300005456 Unclassified 1167
100 Ga0070662_100000541 3300005457 Bacteria 22936
101 Ga0070662_100004201 3300005457 Bacteria 9075
102 Ga0070662_100013805 3300005457 Bacteria 5380
103 Ga0070681_10005452 3300005458 Bacteria 12290
104 Ga0070681_10134669 3300005458 Bacteria 2401
105 Ga0068867_100006401 3300005459 Bacteria 8322
106 Ga0068867_100015881 3300005459 Bacteria 5344
107 Ga0068867_100028215 3300005459 Bacteria 4040
108 Ga0068867_100324300 3300005459 Bacteria 1277
109 Ga0070685_10000909 3300005466 Bacteria 15909
110 Ga0070706_100001218 3300005467 Bacteria 27549
111 Ga0070706_100401115 3300005467 Bacteria 1277
112 Ga0070707_100525006 3300005468 Bacteria 1146
113 Ga0070698_100000027 3300005471 Bacteria 98052
114 Ga0070699_100062821 3300005518 Bacteria 3220
115 Ga0070679_100062173 3300005530 Unclassified 3722
116 Ga0070679_100086542 3300005530 Bacteria 3120
117 Ga0070684_100026773 3300005535 Bacteria 4861
118 Ga0070684_100064108 3300005535 Bacteria 3223
119 Ga0070684_100068254 3300005535 Bacteria 3125
120 Ga0070684_100105435 3300005535 Bacteria 2522
121 Ga0070684_100596830 3300005535 Unclassified 1026
122 Ga0070697_100001597 3300005536 Bacteria 17280
123 Ga0070697_100003032 3300005536 Bacteria 12908
124 Ga0070697_100039049 3300005536 Bacteria 3837
125 Ga0070697_100060621 3300005536 Bacteria 3084
126 Ga0070697_100118236 3300005536 Unclassified 2214
127 Ga0070697_100167040 3300005536 Bacteria 1861
128 Ga0068853_100013969 3300005539 Bacteria 6568
129 Ga0070672_100093958 3300005543 Bacteria 2423
130 Ga0070686_100119051 3300005544 Unclassified 1811
131 Ga0070686_100185715 3300005544 Bacteria 1480
132 Ga0070696_100100219 3300005546 Unclassified 2074
133 Ga0070696_100384739 3300005546 Unclassified 1094
134 Ga0070693_100183503 3300005547 Unclassified 1348
135 Ga0070665_100037519 3300005548 Bacteria 4873
136 Ga0068855_100002332 3300005563 Bacteria 23435
137 Ga0068855_100008708 3300005563 Bacteria 12266
138 Ga0068855_100118518 3300005563 Bacteria 3031
139 Ga0068855_100337863 3300005563 Bacteria 1661
140 Ga0070664_100032307 3300005564 Bacteria 4377
141 Ga0070664_100045645 3300005564 Bacteria 3701
142 Ga0070664_100164959 3300005564 Unclassified 1962
143 Ga0068857_100001007 3300005577 Bacteria 21676
144 Ga0068857_100234868 3300005577 Bacteria 1677
145 Ga0068854_100001455 3300005578 Bacteria 14332
146 Ga0068854_100004607 3300005578 Bacteria 8697
147 Ga0068854_100021780 3300005578 Bacteria 4355
148 Ga0068854_100025663 3300005578 Bacteria 4043
149 Ga0068854_100054661 3300005578 Bacteria 2872
150 Ga0068856_100002178 3300005614 Bacteria 20311
151 Ga0068856_100006209 3300005614 Bacteria 11725
152 Ga0068856_100006480 3300005614 Bacteria 11477
153 Ga0068856_100052420 3300005614 Bacteria 4023
154 Ga0068856_100091558 3300005614 Bacteria 3025
155 Ga0068856_100095737 3300005614 Bacteria 2957
156 Ga0070702_100039028 3300005615 Bacteria 2648
157 Ga0068852_100005565 3300005616 Bacteria 9035
158 Ga0068852_100577011 3300005616 Bacteria 1127
159 Ga0068859_100003612 3300005617 Bacteria 15777
160 Ga0068859_100110229 3300005617 Bacteria 2814
161 Ga0068859_100129707 3300005617 Bacteria 2592
162 Ga0068859_100975574 3300005617 Unclassified 930
163 Ga0068864_100007578 3300005618 Bacteria 8944
164 Ga0068864_100057620 3300005618 Unclassified 3357
165 Ga0068866_10000947 3300005718 Bacteria 12769
166 Ga0068866_10007019 3300005718 Unclassified 4708
167 Ga0068866_10170093 3300005718 Unclassified 1278
168 Ga0068861_100006605 3300005719 Bacteria 7916
169 Ga0068851_10005063 3300005834 Bacteria 5978
170 Ga0068870_10008194 3300005840 Bacteria 4689
171 Ga0068863_100014632 3300005841 Bacteria 7553
172 Ga0068863_100054932 3300005841 Unclassified 3773
173 Ga0068863_100400594 3300005841 Unclassified 1342
174 Ga0068863_100418969 3300005841 Bacteria 1312
175 Ga0068858_100001765 3300005842 Bacteria 22061
176 Ga0068858_100017426 3300005842 Bacteria 6738
177 Ga0068858_100041684 3300005842 Bacteria 4256
178 Ga0068858_100132832 3300005842 Bacteria 2335
179 Ga0068858_100214494 3300005842 Bacteria 1822
180 Ga0068860_100050979 3300005843 Bacteria 3939
181 Ga0068860_100057998 3300005843 Bacteria 3680
182 Ga0068860_100069774 3300005843 Bacteria 3341
183 Ga0068860_100388545 3300005843 Unclassified 1378
184 Ga0070717_10001194 3300006028 Bacteria 17603
185 Ga0070717_10001824 3300006028 Bacteria 14874
186 Ga0070717_10147108 3300006028 Bacteria 2036
187 Ga0070717_10405506 3300006028 Unclassified 1225
188 Ga0070717_10462451 3300006028 Unclassified 1144
189 Ga0070715_10010527 3300006163 Bacteria 3299
190 Ga0070715_10011256 3300006163 Bacteria 3217
191 Ga0070715_10050885 3300006163 Bacteria 1780
192 Ga0070716_100002598 3300006173 Bacteria 8337
193 Ga0070716_100002767 3300006173 Bacteria 8145
194 Ga0070716_100004530 3300006173 Bacteria 6654
195 Ga0070716_100153928 3300006173 Bacteria 1482
196 Ga0070716_100313409 3300006173 Bacteria 1096
197 Ga0070712_100000084 3300006175 Bacteria 48408
198 Ga0070712_100001560 3300006175 Bacteria 14018
199 Ga0070712_100002974 3300006175 Bacteria 10490
200 Ga0070712_100079367 3300006175 Bacteria 2372
201 Ga0097621_100000630 3300006237 Bacteria 24845
202 Ga0097621_100077332 3300006237 Unclassified 2762
203 Ga0097621_100614688 3300006237 Unclassified 994
204 Ga0068871_100002296 3300006358 Bacteria 13012
205 Ga0068871_100057003 3300006358 Bacteria 3177
206 Ga0075433_10001388 3300006852 Bacteria 17839
207 Ga0075433_10002611 3300006852 Bacteria 13740
208 Ga0075433_10178535 3300006852 Unclassified 1889
209 Ga0075433_10275886 3300006852 Unclassified 1490
210 Ga0075434_100000201 3300006871 Bacteria 40218
211 Ga0075434_100022103 3300006871 Bacteria 6194
212 Ga0075434_100045075 3300006871 Bacteria 4375
213 Ga0068865_100014343 3300006881 Bacteria 5034
214 Ga0068865_100259694 3300006881 Unclassified 1375
215 Ga0075436_100001585 3300006914 Bacteria 15544
216 Ga0075436_100015296 3300006914 Bacteria 5256
217 Ga0075436_100168265 3300006914 Unclassified 1547
218 Ga0097620_100003612 3300006931 Bacteria 15777
219 Ga0097620_100110224 3300006931 Bacteria 2814
220 Ga0097620_100129701 3300006931 Bacteria 2592
221 Ga0097620_100975590 3300006931 Unclassified 930
222 Ga0075435_100000888 3300007076 Bacteria 18792
223 Ga0075435_100045702 3300007076 Unclassified 3511
224 Ga0105250_10093222 3300009092 Unclassified 1226
225 Ga0105240_10096452 3300009093 Bacteria 3603
226 Ga0105240_10173312 3300009093 Bacteria 2553
227 Ga0105240_10383629 3300009093 Unclassified 1586
228 Ga0105240_10727643 3300009093 Unclassified 1081
229 Ga0105245_10014151 3300009098 Bacteria 6953
230 Ga0105245_10088644 3300009098 Bacteria 2842
231 Ga0105247_10003758 3300009101 Bacteria 9843
232 Ga0105247_10229825 3300009101 Bacteria 1259
233 Ga0114129_10029561 3300009147 Bacteria 7760
234 Ga0105243_10013206 3300009148 Bacteria 6245
235 Ga0105241_10015977 3300009174 Bacteria 5501
236 Ga0105241_10022445 3300009174 Bacteria 4675
237 Ga0105241_10057820 3300009174 Bacteria 2976
238 Ga0105241_10160347 3300009174 Unclassified 1848
239 Ga0105241_10379098 3300009174 Bacteria 1235
240 Ga0105242_10013697 3300009176 Bacteria 6275
241 Ga0105242_10047109 3300009176 Bacteria 3499
242 Ga0105242_10175925 3300009176 Bacteria 1884
243 Ga0105242_10373492 3300009176 Bacteria 1323
244 Ga0105248_10169667 3300009177 Bacteria 2459
245 Ga0105237_10077425 3300009545 Unclassified 3315
246 Ga0105237_10251589 3300009545 Bacteria 1769
247 Ga0105237_10308754 3300009545 Unclassified 1585
248 Ga0105238_10021729 3300009551 Bacteria 6536
249 Ga0105238_10078013 3300009551 Bacteria 3303
250 Ga0105238_10120383 3300009551 Bacteria 2604
251 Ga0105249_10013062 3300009553 Bacteria 7331
252 Ga0105239_10005111 3300010375 Bacteria 15488
253 Ga0105239_10382592 3300010375 Unclassified 1591
254 Ga0105246_10000324 3300011119 Bacteria 25337
255 Ga0105246_10075724 3300011119 Bacteria 2383
256 Ga0157373_10038988 3300013100 Bacteria 3402
257 Ga0157373_10065098 3300013100 Bacteria 2580
258 Ga0157373_10093010 3300013100 Bacteria 2124
259 Ga0157373_10113394 3300013100 Unclassified 1905
260 Ga0157371_10014059 3300013102 Bacteria 6055
261 Ga0157371_10141903 3300013102 Unclassified 1711
262 Ga0157371_10157163 3300013102 Unclassified 1623
263 Ga0157370_10067178 3300013104 Bacteria 3389
264 Ga0157369_10048321 3300013105 Bacteria 4617
265 Ga0157369_10205490 3300013105 Bacteria 2066
266 Ga0157369_10644504 3300013105 Unclassified 1093
267 Ga0157374_10000354 3300013296 Bacteria 42454
268 Ga0157374_10010532 3300013296 Bacteria 7957
269 Ga0157374_10065885 3300013296 Bacteria 3403
270 Ga0157374_10071420 3300013296 Bacteria 3273
271 Ga0157374_10080483 3300013296 Unclassified 3090
272 Ga0157374_10099213 3300013296 Bacteria 2789
273 Ga0157374_10162525 3300013296 Unclassified 2175
274 Ga0157378_10000328 3300013297 Bacteria 46856
275 Ga0157378_10000732 3300013297 Bacteria 30694
276 Ga0157378_10045748 3300013297 Bacteria 3890
277 Ga0157378_10107484 3300013297 Bacteria 2553
278 Ga0157378_10176014 3300013297 Bacteria 2010
279 Ga0157378_10182517 3300013297 Unclassified 1975
280 Ga0163162_10043429 3300013306 Bacteria 4501
281 Ga0163162_10087554 3300013306 Unclassified 3193
282 Ga0163162_10169308 3300013306 Bacteria 2309
283 Ga0157372_10001669 3300013307 Bacteria 24030
284 Ga0157372_10002271 3300013307 Bacteria 20824
285 Ga0157372_10021596 3300013307 Bacteria 6956
286 Ga0157372_10026297 3300013307 Bacteria 6332
287 Ga0157372_10027564 3300013307 Bacteria 6189
288 Ga0157372_10038024 3300013307 Bacteria 5311
289 Ga0157372_10041484 3300013307 Bacteria 5089
290 Ga0157372_10058718 3300013307 Bacteria 4301
291 Ga0157375_10015937 3300013308 Bacteria 6740
292 Ga0157375_10032583 3300013308 Bacteria 4944
293 Ga0163163_10001504 3300014325 Bacteria 19702
294 Ga0163163_10109857 3300014325 Bacteria 2785
295 Ga0163163_10132528 3300014325 Bacteria 2532
296 Ga0163163_10136165 3300014325 Bacteria 2497
297 Ga0163163_10177609 3300014325 Unclassified 2176
298 Ga0157377_10002081 3300014745 Bacteria 8793
299 Ga0157379_10001741 3300014968 Bacteria 17992
300 Ga0157379_10031617 3300014968 Bacteria 4716
301 Ga0157376_10007255 3300014969 Bacteria 7894
302 Ga0157376_10095084 3300014969 Bacteria 2590
303 Ga0157376_10319298 3300014969 Unclassified 1476
304 Ga0157376_10335015 3300014969 Unclassified 1443
305 Ga0182007_10001772 3300015262 Bacteria 11312
306 Ga0182005_1008282 3300015265 Bacteria 3071
307 Ga0163161_10030100 3300017792 Bacteria 3861
308 Ga0163161_10143159 3300017792 Bacteria 1811
309 Ga0213873_10013186 3300021358 Unclassified 1808
310 Ga0207656_10005990 3300025321 Bacteria 4344
311 Ga0207656_10032059 3300025321 Bacteria 2180
312 Ga0207696_1074660 3300025711 Unclassified 940
313 Ga0207692_10004170 3300025898 Bacteria 5706
314 Ga0207692_10063272 3300025898 Bacteria 1922
315 Ga0207692_10066601 3300025898 Unclassified 1883
316 Ga0207642_10003847 3300025899 Bacteria 4785
317 Ga0207642_10045845 3300025899 Bacteria 1944
318 Ga0207710_10010510 3300025900 Bacteria 3900
319 Ga0207688_10001487 3300025901 Bacteria 12289
320 Ga0207680_10008390 3300025903 Bacteria 5068
321 Ga0207680_10044195 3300025903 Bacteria 2618
322 Ga0207647_10005620 3300025904 Bacteria 9157
323 Ga0207647_10047830 3300025904 Bacteria 2658
324 Ga0207685_10020404 3300025905 Bacteria 2202
325 Ga0207685_10029340 3300025905 Bacteria 1946
326 Ga0207699_10021795 3300025906 Unclassified 3461
327 Ga0207699_10022490 3300025906 Unclassified 3417
328 Ga0207699_10037262 3300025906 Bacteria 2779
329 Ga0207699_10091048 3300025906 Bacteria 1915
330 Ga0207699_10289552 3300025906 Bacteria 1141
331 Ga0207645_10000311 3300025907 Bacteria 40978
332 Ga0207643_10006088 3300025908 Bacteria 6447
333 Ga0207705_10100273 3300025909 Bacteria 2130
334 Ga0207684_10001028 3300025910 Bacteria 31287
335 Ga0207684_10001658 3300025910 Bacteria 23659
336 Ga0207684_10334824 3300025910 Bacteria 1304
337 Ga0207654_10087725 3300025911 Bacteria 1889
338 Ga0207654_10155113 3300025911 Unclassified 1474
339 Ga0207707_10008193 3300025912 Bacteria 9071
340 Ga0207707_10391772 3300025912 Bacteria 1193
341 Ga0207695_10162991 3300025913 Bacteria 2160
342 Ga0207695_10307936 3300025913 Unclassified 1474
343 Ga0207671_10067294 3300025914 Bacteria 2668
344 Ga0207693_10000015 3300025915 Bacteria 147464
345 Ga0207693_10000715 3300025915 Bacteria 29867
346 Ga0207693_10008088 3300025915 Bacteria 8627
347 Ga0207693_10010594 3300025915 Bacteria 7480
348 Ga0207693_10018822 3300025915 Bacteria 5495
349 Ga0207693_10026052 3300025915 Bacteria 4631
350 Ga0207693_10101647 3300025915 Bacteria 2254
351 Ga0207663_10001752 3300025916 Bacteria 10219
352 Ga0207663_10011917 3300025916 Bacteria 4683
353 Ga0207663_10049153 3300025916 Unclassified 2614
354 Ga0207663_10081561 3300025916 Bacteria 2119
355 Ga0207663_10375179 3300025916 Unclassified 1082
356 Ga0207662_10118359 3300025918 Bacteria 1659
357 Ga0207657_10001005 3300025919 Bacteria 30014
358 Ga0207657_10001879 3300025919 Bacteria 22697
359 Ga0207657_10002644 3300025919 Bacteria 19341
360 Ga0207649_10002375 3300025920 Bacteria 10556
361 Ga0207649_10083470 3300025920 Bacteria 2074
362 Ga0207649_10161182 3300025920 Bacteria 1554
363 Ga0207652_10044135 3300025921 Bacteria 3797
364 Ga0207652_10168119 3300025921 Bacteria 1967
365 Ga0207652_10240357 3300025921 Bacteria 1632
366 Ga0207646_10001530 3300025922 Bacteria 28310
367 Ga0207646_10037727 3300025922 Unclassified 4355
368 Ga0207681_10120332 3300025923 Unclassified 1924
369 Ga0207650_10000097 3300025925 Bacteria 115583
370 Ga0207650_10006137 3300025925 Bacteria 8187
371 Ga0207659_10044255 3300025926 Bacteria 3131
372 Ga0207687_10033401 3300025927 Bacteria 3490
373 Ga0207687_10036878 3300025927 Bacteria 3332
374 Ga0207700_10000621 3300025928 Bacteria 20713
375 Ga0207700_10128683 3300025928 Unclassified 2064
376 Ga0207700_10369223 3300025928 Bacteria 1252
377 Ga0207700_10393433 3300025928 Unclassified 1214
378 Ga0207664_10026701 3300025929 Bacteria 4367
379 Ga0207664_10074071 3300025929 Bacteria 2750
380 Ga0207664_10132027 3300025929 Bacteria 2103
381 Ga0207664_10294240 3300025929 Bacteria 1427
382 Ga0207664_10485042 3300025929 Bacteria 1106
383 Ga0207644_10058519 3300025931 Bacteria 2785
384 Ga0207644_10129406 3300025931 Bacteria 1931
385 Ga0207690_10017336 3300025932 Bacteria 4395
386 Ga0207690_10041663 3300025932 Bacteria 3010
387 Ga0207690_10299772 3300025932 Unclassified 1257
388 Ga0207706_10000048 3300025933 Bacteria 117454
389 Ga0207706_10000139 3300025933 Bacteria 79096
390 Ga0207706_10029317 3300025933 Bacteria 4913
391 Ga0207706_10365458 3300025933 Unclassified 1253
392 Ga0207686_10064793 3300025934 Bacteria 2328
393 Ga0207704_10088497 3300025938 Bacteria 2026
394 Ga0207665_10000188 3300025939 Bacteria 41567
395 Ga0207665_10000878 3300025939 Bacteria 20297
396 Ga0207665_10332371 3300025939 Bacteria 1143
397 Ga0207665_10337843 3300025939 Bacteria 1134
398 Ga0207691_10004813 3300025940 Bacteria 13056
399 Ga0207711_10017002 3300025941 Bacteria 6042
400 Ga0207711_10025327 3300025941 Bacteria 4977
401 Ga0207689_10000878 3300025942 Bacteria 28919
402 Ga0207661_10000124 3300025944 Bacteria 49095
403 Ga0207661_10067797 3300025944 Unclassified 2903
404 Ga0207661_10109659 3300025944 Bacteria 2332
405 Ga0207661_10201848 3300025944 Unclassified 1748
406 Ga0207661_10226044 3300025944 Unclassified 1656
407 Ga0207679_10000065 3300025945 Bacteria 97825
408 Ga0207679_10092025 3300025945 Bacteria 2349
409 Ga0207679_10333284 3300025945 Unclassified 1317
410 Ga0207667_10004841 3300025949 Bacteria 16459
411 Ga0207667_10089881 3300025949 Bacteria 3173
412 Ga0207667_10097733 3300025949 Unclassified 3030
413 Ga0207651_10010116 3300025960 Bacteria 5207
414 Ga0207651_10048040 3300025960 Bacteria 2882
415 Ga0207712_10480790 3300025961 Unclassified 1059
416 Ga0207668_10053637 3300025972 Bacteria 2795
417 Ga0207640_10013376 3300025981 Bacteria 4700
418 Ga0207640_10014587 3300025981 Bacteria 4527
419 Ga0207640_10024774 3300025981 Bacteria 3625
420 Ga0207640_10081438 3300025981 Bacteria 2213
421 Ga0207658_10003567 3300025986 Bacteria 10982
422 Ga0207658_10350956 3300025986 Unclassified 1285
423 Ga0207677_10006492 3300026023 Bacteria 6425
424 Ga0207677_10152496 3300026023 Bacteria 1785
425 Ga0207677_10194809 3300026023 Unclassified 1606
426 Ga0207703_10026628 3300026035 Bacteria 4553
427 Ga0207703_10061592 3300026035 Bacteria 3072
428 Ga0207703_10149507 3300026035 Bacteria 2035
429 Ga0207703_10532444 3300026035 Unclassified 1106
430 Ga0207639_10078999 3300026041 Bacteria 2599
431 Ga0207678_10000103 3300026067 Bacteria 69649
432 Ga0207678_10004262 3300026067 Bacteria 12823
433 Ga0207678_10070530 3300026067 Bacteria 2996
434 Ga0207708_10215709 3300026075 Unclassified 1535
435 Ga0207702_10002238 3300026078 Bacteria 18563
436 Ga0207702_10069883 3300026078 Bacteria 3019
437 Ga0207702_10301347 3300026078 Unclassified 1521
438 Ga0207641_10000183 3300026088 Bacteria 87085
439 Ga0207641_10027893 3300026088 Bacteria 4664
440 Ga0207641_10381106 3300026088 Bacteria 1350
441 Ga0207648_10000618 3300026089 Bacteria 39818
442 Ga0207648_10016847 3300026089 Bacteria 6663
443 Ga0207648_10019365 3300026089 Bacteria 6143
444 Ga0207648_10182288 3300026089 Bacteria 1859
445 Ga0207676_10000428 3300026095 Bacteria 35461
446 Ga0207676_10016938 3300026095 Bacteria 5277
447 Ga0207676_10524999 3300026095 Bacteria 1127
448 Ga0207674_10000981 3300026116 Bacteria 37324
449 Ga0207674_10001650 3300026116 Bacteria 28701
450 Ga0207674_10022370 3300026116 Bacteria 6789
451 Ga0207675_100254621 3300026118 Bacteria 1700
452 Ga0207683_10000478 3300026121 Bacteria 37215
453 Ga0207683_10055935 3300026121 Bacteria 3460
454 Ga0207683_10179888 3300026121 Bacteria 1917
455 Ga0207698_10086759 3300026142 Unclassified 2546
456 Ga0207698_10117973 3300026142 Bacteria 2240
457 Ga0268266_10094468 3300028379 Bacteria 2624
458 Ga0268266_10250026 3300028379 Unclassified 1639
459 Ga0268266_10518704 3300028379 Unclassified 1139
460 Ga0268264_10003488 3300028381 Bacteria 13557
461 Ga0268264_10457142 3300028381 Unclassified 1238
462 Ga0265338_10006936 3300028800 Bacteria 14251
463 Ga0265338_10023793 3300028800 Bacteria 6282
464 Ga0265762_1002245 3300030760 Bacteria 3495
465 Ga0265760_10039296 3300031090 Unclassified 1408
466 Ga0265330_10004202 3300031235 Bacteria 7346
467 Ga0265325_10001839 3300031241 Bacteria 14670
468 Ga0265340_10076172 3300031247 Bacteria 1585
469 Ga0265339_10010938 3300031249 Bacteria 5609
470 Ga0265339_10076375 3300031249 Unclassified 1777
471 Ga0265331_10075825 3300031250 Bacteria 1568
472 Ga0265316_10053922 3300031344 Bacteria 3149
473 Ga0265314_10011704 3300031711 Bacteria 7218
474 Ga0307412_10316440 3300031911 Bacteria 1240
475 Ga0373949_0014300 3300035090 Bacteria 1766
476 Ga0373923_0005332 3300035111 Bacteria 4364
477 Ga0373932_0022015 3300035112 Bacteria 1689
478 Ga0373941_0021276 3300035115 Bacteria 1828
479 Ga0373943_0123757 3300035170 Unclassified 1377
480 Ga0373943_0141105 3300035170 Bacteria 1298
481 Ga0373955_0065745 3300035172 Bacteria 2014
482 Ga0373931_0186533 3300035691 Bacteria 1231
483 Ga0373931_0247705 3300035691 Unclassified 1082
484 Ga0373935_0021984 3300035692 Bacteria 3906
485 Ga0373935_0050587 3300035692 Bacteria 2637
486 Ga0373927_0061965 3300035695 Bacteria 2419
487 Ga0373927_0123946 3300035695 Unclassified 1687
488 Ga0373927_0138830 3300035695 Bacteria 1589
489 Ga0373947_0010332 3300035725 Bacteria 5356
490 Ga0373937_0006656 3300036401 Bacteria 9971
491 Ga0373937_0148147 3300036401 Bacteria 2198
492 Ga0373925_0002032 3300037068 Bacteria 16709
493 Ga0373925_0008828 3300037068 Bacteria 7343
494 Ga0373925_0035645 3300037068 Unclassified 3672
495 Ga0373925_0063682 3300037068 Unclassified 2775
496 Ga0436364_0780048 3300037853 Bacteria 814
497 Ga0242420_029192 3300038996 Bacteria 1017
498 Ga0436362_1015845 3300039453 Bacteria 3226
499 Ga0466961_0147382 3300044693 Unclassified 1471
500 Ga0466963_0180370 3300044694 Unclassified 1474
501 Ga0466964_0057103 3300044706 Bacteria 1615
502 Ga0466959_0281866 3300045049 Unclassified 1140
503 Ga0451576_0288160 3300045051 Bacteria 1717
504 Ga0451576_0422851 3300045051 Unclassified 1398
505 Ga0466967_0002081 3300045976 Bacteria 12247
506 Ga0466967_0318636 3300045976 Unclassified 1499
507 Ga0466967_0667895 3300045976 Bacteria 1028
508 Ga0495629_0005415 3300046459 Bacteria 9519
509 Ga0495629_0321842 3300046459 Bacteria 1057
510 Ga0495629_0388782 3300046459 Bacteria 949
511 Ga0495641_0001339 3300046461 Bacteria 21069
512 Ga0495580_0000315 3300046472 Bacteria 39584
513 Ga0495580_0001387 3300046472 Bacteria 21261
514 Ga0495580_0003011 3300046472 Bacteria 14447
515 Ga0495580_0003383 3300046472 Bacteria 13628
516 Ga0495580_0006849 3300046472 Bacteria 9225
517 Ga0495580_0041358 3300046472 Bacteria 3287
518 Ga0495580_0066095 3300046472 Bacteria 2532
519 Ga0495580_0228753 3300046472 Bacteria 1277
520 Ga0495582_0003742 3300046473 Bacteria 8571
521 Ga0495664_0219636 3300046477 Bacteria 1150
522 Ga0495584_0043065 3300046491 Bacteria 2279
523 Ga0495628_0137292 3300046516 Bacteria 1868
524 Ga0495630_0063635 3300046517 Unclassified 2771
525 Ga0495631_0032811 3300046518 Bacteria 2339
526 Ga0495644_0001194 3300046523 Bacteria 10659
527 Ga0495665_0002616 3300046531 Bacteria 9708
528 Ga0495656_0005818 3300046615 Bacteria 4284
529 Ga0495646_0313810 3300046680 Bacteria 827
530 Ga0495674_0087626 3300047319 Bacteria 2664
531 Ga0495674_0244153 3300047319 Bacteria 1479
532 Ga0495674_0344196 3300047319 Bacteria 1211
533 Ga0495676_0211382 3300047321 Bacteria 1342
534 Ga0495675_0020523 3300047444 Bacteria 4204
535 Ga0495684_0163421 3300047471 Bacteria 1660
536 Ga0495686_0000003 3300047472 Bacteria 899502
537 Ga0495686_0032943 3300047472 Bacteria 3350
538 Ga0496100_0023316 3300048903 Bacteria 3759
539 Ga0496100_0202186 3300048903 Unclassified 1448
540 Ga0496100_0218307 3300048903 Unclassified 1398
541 Ga0496101_0137909 3300048904 Unclassified 1857
542 Ga0496101_0180222 3300048904 Bacteria 1627
543 Ga0496101_0202514 3300048904 Unclassified 1535
544 Ga0496102_0017506 3300048905 Bacteria 6276
545 Ga0496102_0040335 3300048905 Unclassified 4223
546 Ga0496102_0112863 3300048905 Bacteria 2535
547 Ga0496102_0300814 3300048905 Unclassified 1512
548 Ga0496103_0014091 3300048906 Bacteria 4746
549 Ga0496103_0025709 3300048906 Unclassified 3560
550 Ga0496103_0105179 3300048906 Unclassified 1789
551 Ga0496104_0013890 3300048907 Bacteria 7265
552 Ga0496104_0178820 3300048907 Unclassified 2032
553 Ga0496104_0180499 3300048907 Unclassified 2021
554 Ga0496104_0296876 3300048907 Bacteria 1528
555 Ga0496104_0653788 3300048907 Unclassified 960
556 Ga0496105_0032884 3300048908 Bacteria 4257
557 Ga0496106_0029034 3300048909 Bacteria 4122
558 Ga0496106_0047801 3300048909 Bacteria 3221
559 Ga0496106_0261740 3300048909 Unclassified 1384
560 Ga0496108_0007623 3300048911 Bacteria 8766
561 Ga0496108_0060700 3300048911 Bacteria 3182
562 Ga0496109_0000335 3300048912 Bacteria 43760
563 Ga0496109_0020221 3300048912 Bacteria 5880
564 Ga0496110_0006022 3300048913 Bacteria 9551
565 Ga0496110_0037545 3300048913 Bacteria 4211
566 Ga0496111_0119508 3300048914 Bacteria 1946
567 Ga0496112_0001705 3300048915 Bacteria 17154
568 Ga0496112_0367825 3300048915 Unclassified 1379
569 Ga0496112_0405530 3300048915 Unclassified 1303
570 Ga0496113_0000733 3300048916 Bacteria 16818
571 Ga0496113_0285607 3300048916 Unclassified 1320
572 Ga0496113_0618199 3300048916 Bacteria 867
573 Ga0496114_0306924 3300048917 Unclassified 1401
574 Ga0496115_0006034 3300048918 Bacteria 8851
575 Ga0496115_0028984 3300048918 Bacteria 4344
576 Ga0496115_0112462 3300048918 Unclassified 2237
577 Ga0501069_0157957 3300049585 Bacteria 1305
578 nmdc:mga0n895_118622_c1 3300050512 Bacteria 2666
579 nmdc:mga0n895_13971_c1 3300050512 Bacteria 7273
580 nmdc:mga0n895_2843_c1 3300050512 Bacteria 13714
581 nmdc:mga0n895_3164_c1 3300050512 Bacteria 13154
582 nmdc:mga0rr50_1195_c1 3300050513 Bacteria 14098
583 nmdc:mga0rr50_37569_c1 3300050513 Bacteria 3497
584 nmdc:mga08x19_11236_c1 3300050514 Bacteria 5390
585 nmdc:mga08x19_1445_c1 3300050514 Bacteria 14689
586 nmdc:mga08x19_228190_c1 3300050514 Unclassified 1281
587 nmdc:mga0a205_148877_c1 3300050515 Bacteria 2241
588 nmdc:mga0a205_330_c1 3300050515 Bacteria 35421
589 nmdc:mga0a205_3953_c2 3300050515 Bacteria 10912
590 Ga0495601_0094935 3300053077 Bacteria 1922
591 Ga0495619_0150026 3300053085 Bacteria 1608
592 Ga0501084_0226307 3300054114 Bacteria 1578
593 2740033598 2739367866 Bacteria 4215900
594 2910248789 2910245624 Bacteria 6935613
595 Ga0070678_100266744
596 MRS1b_contig_8068207
597 MBSR1b_contig_12601351
598 MBSR1b_contig_9154985
599 JGI24747J21853_1002677
600 JGI24737J22298_10008848
601 JGI24748J21848_1001252
602 JGI24751J29686_10001087
603 Ga0065712_10012270
604 Ga0065712_10087863
605 Ga0065712_10118918
606 Ga0065715_10119565
607 Ga0070658_10016468
608 Ga0070676_10001793
609 Ga0070683_100019515
610 Ga0070683_100051204
611 Ga0070683_100062412
612 Ga0070690_100279583
613 Ga0070670_100074330
614 Ga0068869_100057535
615 Ga0068869_100145922
616 Ga0068869_100265991
617 Ga0070666_10008992
618 Ga0070666_10345968
619 Ga0070680_100166670
620 Ga0070682_100144430
621 Ga0070682_100296545
622 Ga0068868_100019030
623 Ga0068868_100025908
624 Ga0068868_100026331
625 Ga0068868_100061868
626 Ga0068868_100101083
627 Ga0070660_100001514
628 Ga0070660_100029552
629 Ga0070660_100219898
630 Ga0070689_100018545
631 Ga0070691_10184171
632 Ga0070687_100027529
633 Ga0070687_100127366
634 Ga0070687_100189145
635 Ga0070661_100002033
636 Ga0070661_100050056
637 Ga0070661_100097345
638 Ga0070661_100193236
639 Ga0070668_100025094
640 Ga0070668_100025449
641 Ga0070669_100018507
642 Ga0070669_100054538
643 Ga0070669_100247592
644 Ga0070671_100235184
645 Ga0070674_100099350
646 Ga0070674_100162243
647 Ga0070674_100468273
648 Ga0070673_100021725
649 Ga0070673_100115792
650 Ga0070688_100023746
651 Ga0070659_100013876
652 Ga0070659_100018702
653 Ga0070659_100092394
654 Ga0070667_100029222
655 Ga0070667_100110671
656 Ga0070709_10016510
657 Ga0070709_10025106
658 Ga0070709_10036671
659 Ga0070709_10043452
660 Ga0070709_10093249
661 Ga0070714_100030051
662 Ga0070714_100072522
663 Ga0070714_100078478
664 Ga0070714_100516843
665 Ga0070714_100582265
666 Ga0070713_100000113
667 Ga0070713_100024669
668 Ga0070713_100025507
669 Ga0070713_100029469
670 Ga0070713_100099201
671 Ga0070713_100185551
672 Ga0070710_10008846
673 Ga0070710_10009740
674 Ga0070710_10092810
675 Ga0070711_100000236
676 Ga0070711_100002807
677 Ga0070711_100012358
678 Ga0070711_100088294
679 Ga0070711_100530572
680 Ga0070705_100137617
681 Ga0070705_100364370
682 Ga0070700_100294354
683 Ga0070694_100168201
684 Ga0070708_100007935
685 Ga0070708_100017096
686 Ga0070708_100036020
687 Ga0070708_100289722
688 Ga0070708_100530130
689 Ga0070663_100010946
690 Ga0070663_100083542
691 Ga0070678_100011545
692 Ga0070678_100066024
693 Ga0070678_100418675
694 Ga0070662_100000541
695 Ga0070662_100004201
696 Ga0070662_100013805
697 Ga0070681_10005452
698 Ga0070681_10134669
699 Ga0068867_100006401
700 Ga0068867_100015881
701 Ga0068867_100028215
702 Ga0068867_100324300
703 Ga0070685_10000909
704 Ga0070706_100001218
705 Ga0070706_100401115
706 Ga0070707_100525006
707 Ga0070698_100000027
708 Ga0070699_100062821
709 Ga0070679_100062173
710 Ga0070679_100086542
711 Ga0070684_100026773
712 Ga0070684_100064108
713 Ga0070684_100068254
714 Ga0070684_100105435
715 Ga0070684_100596830
716 Ga0070697_100001597
717 Ga0070697_100003032
718 Ga0070697_100039049
719 Ga0070697_100060621
720 Ga0070697_100118236
721 Ga0070697_100167040
722 Ga0068853_100013969
723 Ga0070672_100093958
724 Ga0070686_100119051
725 Ga0070686_100185715
726 Ga0070696_100100219
727 Ga0070696_100384739
728 Ga0070693_100183503
729 Ga0070665_100037519
730 Ga0068855_100002332
731 Ga0068855_100008708
732 Ga0068855_100118518
733 Ga0068855_100337863
734 Ga0070664_100032307
735 Ga0070664_100045645
736 Ga0070664_100164959
737 Ga0068857_100001007
738 Ga0068857_100234868
739 Ga0068854_100001455
740 Ga0068854_100004607
741 Ga0068854_100021780
742 Ga0068854_100025663
743 Ga0068854_100054661
744 Ga0068856_100002178
745 Ga0068856_100006209
746 Ga0068856_100006480
747 Ga0068856_100052420
748 Ga0068856_100091558
749 Ga0068856_100095737
750 Ga0070702_100039028
751 Ga0068852_100005565
752 Ga0068852_100577011
753 Ga0068859_100003612
754 Ga0068859_100110229
755 Ga0068859_100129707
756 Ga0068859_100975574
757 Ga0068864_100007578
758 Ga0068864_100057620
759 Ga0068866_10000947
760 Ga0068866_10007019
761 Ga0068866_10170093
762 Ga0068861_100006605
763 Ga0068851_10005063
764 Ga0068870_10008194
765 Ga0068863_100014632
766 Ga0068863_100054932
767 Ga0068863_100400594
768 Ga0068863_100418969
769 Ga0068858_100001765
770 Ga0068858_100017426
771 Ga0068858_100041684
772 Ga0068858_100132832
773 Ga0068858_100214494
774 Ga0068860_100050979
775 Ga0068860_100057998
776 Ga0068860_100069774
777 Ga0068860_100388545
778 Ga0070717_10001194
779 Ga0070717_10001824
780 Ga0070717_10147108
781 Ga0070717_10405506
782 Ga0070717_10462451
783 Ga0070715_10010527
784 Ga0070715_10011256
785 Ga0070715_10050885
786 Ga0070716_100002598
787 Ga0070716_100002767
788 Ga0070716_100004530
789 Ga0070716_100153928
790 Ga0070716_100313409
791 Ga0070712_100000084
792 Ga0070712_100001560
793 Ga0070712_100002974
794 Ga0070712_100079367
795 Ga0097621_100000630
796 Ga0097621_100077332
797 Ga0097621_100614688
798 Ga0068871_100002296
799 Ga0068871_100057003
800 Ga0075433_10001388
801 Ga0075433_10002611
802 Ga0075433_10178535
803 Ga0075433_10275886
804 Ga0075434_100000201
805 Ga0075434_100022103
806 Ga0075434_100045075
807 Ga0068865_100014343
808 Ga0068865_100259694
809 Ga0075436_100001585
810 Ga0075436_100015296
811 Ga0075436_100168265
812 Ga0097620_100003612
813 Ga0097620_100110224
814 Ga0097620_100129701
815 Ga0097620_100975590
816 Ga0075435_100000888
817 Ga0075435_100045702
818 Ga0105250_10093222
819 Ga0105240_10096452
820 Ga0105240_10173312
821 Ga0105240_10383629
822 Ga0105240_10727643
823 Ga0105245_10014151
824 Ga0105245_10088644
825 Ga0105247_10003758
826 Ga0105247_10229825
827 Ga0114129_10029561
828 Ga0105243_10013206
829 Ga0105241_10015977
830 Ga0105241_10022445
831 Ga0105241_10057820
832 Ga0105241_10160347
833 Ga0105241_10379098
834 Ga0105242_10013697
835 Ga0105242_10047109
836 Ga0105242_10175925
837 Ga0105242_10373492
838 Ga0105248_10169667
839 Ga0105237_10077425
840 Ga0105237_10251589
841 Ga0105237_10308754
842 Ga0105238_10021729
843 Ga0105238_10078013
844 Ga0105238_10120383
845 Ga0105249_10013062
846 Ga0105239_10005111
847 Ga0105239_10382592
848 Ga0105246_10000324
849 Ga0105246_10075724
850 Ga0157373_10038988
851 Ga0157373_10065098
852 Ga0157373_10093010
853 Ga0157373_10113394
854 Ga0157371_10014059
855 Ga0157371_10141903
856 Ga0157371_10157163
857 Ga0157370_10067178
858 Ga0157369_10048321
859 Ga0157369_10205490
860 Ga0157369_10644504
861 Ga0157374_10000354
862 Ga0157374_10010532
863 Ga0157374_10065885
864 Ga0157374_10071420
865 Ga0157374_10080483
866 Ga0157374_10099213
867 Ga0157374_10162525
868 Ga0157378_10000328
869 Ga0157378_10000732
870 Ga0157378_10045748
871 Ga0157378_10107484
872 Ga0157378_10176014
873 Ga0157378_10182517
874 Ga0163162_10043429
875 Ga0163162_10087554
876 Ga0163162_10169308
877 Ga0157372_10001669
878 Ga0157372_10002271
879 Ga0157372_10021596
880 Ga0157372_10026297
881 Ga0157372_10027564
882 Ga0157372_10038024
883 Ga0157372_10041484
884 Ga0157372_10058718
885 Ga0157375_10015937
886 Ga0157375_10032583
887 Ga0163163_10001504
888 Ga0163163_10109857
889 Ga0163163_10132528
890 Ga0163163_10136165
891 Ga0163163_10177609
892 Ga0157377_10002081
893 Ga0157379_10001741
894 Ga0157379_10031617
895 Ga0157376_10007255
896 Ga0157376_10095084
897 Ga0157376_10319298
898 Ga0157376_10335015
899 Ga0182007_10001772
900 Ga0182005_1008282
901 Ga0163161_10030100
902 Ga0163161_10143159
903 Ga0213873_10013186
904 Ga0207656_10005990
905 Ga0207656_10032059
906 Ga0207696_1074660
907 Ga0207692_10004170
908 Ga0207692_10063272
909 Ga0207692_10066601
910 Ga0207642_10003847
911 Ga0207642_10045845
912 Ga0207710_10010510
913 Ga0207688_10001487
914 Ga0207680_10008390
915 Ga0207680_10044195
916 Ga0207647_10005620
917 Ga0207647_10047830
918 Ga0207685_10020404
919 Ga0207685_10029340
920 Ga0207699_10021795
921 Ga0207699_10022490
922 Ga0207699_10037262
923 Ga0207699_10091048
924 Ga0207699_10289552
925 Ga0207645_10000311
926 Ga0207643_10006088
927 Ga0207705_10100273
928 Ga0207684_10001028
929 Ga0207684_10001658
930 Ga0207684_10334824
931 Ga0207654_10087725
932 Ga0207654_10155113
933 Ga0207707_10008193
934 Ga0207707_10391772
935 Ga0207695_10162991
936 Ga0207695_10307936
937 Ga0207671_10067294
938 Ga0207693_10000015
939 Ga0207693_10000715
940 Ga0207693_10008088
941 Ga0207693_10010594
942 Ga0207693_10018822
943 Ga0207693_10026052
944 Ga0207693_10101647
945 Ga0207663_10001752
946 Ga0207663_10011917
947 Ga0207663_10049153
948 Ga0207663_10081561
949 Ga0207663_10375179
950 Ga0207662_10118359
951 Ga0207657_10001005
952 Ga0207657_10001879
953 Ga0207657_10002644
954 Ga0207649_10002375
955 Ga0207649_10083470
956 Ga0207649_10161182
957 Ga0207652_10044135
958 Ga0207652_10168119
959 Ga0207652_10240357
960 Ga0207646_10001530
961 Ga0207646_10037727
962 Ga0207681_10120332
963 Ga0207650_10000097
964 Ga0207650_10006137
965 Ga0207659_10044255
966 Ga0207687_10033401
967 Ga0207687_10036878
968 Ga0207700_10000621
969 Ga0207700_10128683
970 Ga0207700_10369223
971 Ga0207700_10393433
972 Ga0207664_10026701
973 Ga0207664_10074071
974 Ga0207664_10132027
975 Ga0207664_10294240
976 Ga0207664_10485042
977 Ga0207644_10058519
978 Ga0207644_10129406
979 Ga0207690_10017336
980 Ga0207690_10041663
981 Ga0207690_10299772
982 Ga0207706_10000048
983 Ga0207706_10000139
984 Ga0207706_10029317
985 Ga0207706_10365458
986 Ga0207686_10064793
987 Ga0207704_10088497
988 Ga0207665_10000188
989 Ga0207665_10000878
990 Ga0207665_10332371
991 Ga0207665_10337843
992 Ga0207691_10004813
993 Ga0207711_10017002
994 Ga0207711_10025327
995 Ga0207689_10000878
996 Ga0207661_10000124
997 Ga0207661_10067797
998 Ga0207661_10109659
999 Ga0207661_10201848
1000 Ga0207661_10226044
1001 Ga0207679_10000065
1002 Ga0207679_10092025
1003 Ga0207679_10333284
1004 Ga0207667_10004841
1005 Ga0207667_10089881
1006 Ga0207667_10097733
1007 Ga0207651_10010116
1008 Ga0207651_10048040
1009 Ga0207712_10480790
1010 Ga0207668_10053637
1011 Ga0207640_10013376
1012 Ga0207640_10014587
1013 Ga0207640_10024774
1014 Ga0207640_10081438
1015 Ga0207658_10003567
1016 Ga0207658_10350956
1017 Ga0207677_10006492
1018 Ga0207677_10152496
1019 Ga0207677_10194809
1020 Ga0207703_10026628
1021 Ga0207703_10061592
1022 Ga0207703_10149507
1023 Ga0207703_10532444
1024 Ga0207639_10078999
1025 Ga0207678_10000103
1026 Ga0207678_10004262
1027 Ga0207678_10070530
1028 Ga0207708_10215709
1029 Ga0207702_10002238
1030 Ga0207702_10069883
1031 Ga0207702_10301347
1032 Ga0207641_10000183
1033 Ga0207641_10027893
1034 Ga0207641_10381106
1035 Ga0207648_10000618
1036 Ga0207648_10016847
1037 Ga0207648_10019365
1038 Ga0207648_10182288
1039 Ga0207676_10000428
1040 Ga0207676_10016938
1041 Ga0207676_10524999
1042 Ga0207674_10000981
1043 Ga0207674_10001650
1044 Ga0207674_10022370
1045 Ga0207675_100254621
1046 Ga0207683_10000478
1047 Ga0207683_10055935
1048 Ga0207683_10179888
1049 Ga0207698_10086759
1050 Ga0207698_10117973
1051 Ga0268266_10094468
1052 Ga0268266_10250026
1053 Ga0268266_10518704
1054 Ga0268264_10003488
1055 Ga0268264_10457142
1056 Ga0265338_10006936
1057 Ga0265338_10023793
1058 Ga0265762_1002245
1059 Ga0265760_10039296
1060 Ga0265330_10004202
1061 Ga0265325_10001839
1062 Ga0265340_10076172
1063 Ga0265339_10010938
1064 Ga0265339_10076375
1065 Ga0265331_10075825
1066 Ga0265316_10053922
1067 Ga0265314_10011704
1068 Ga0307412_10316440
1069 Ga0373949_0014300
1070 Ga0373923_0005332
1071 Ga0373932_0022015
1072 Ga0373941_0021276
1073 Ga0373943_0123757
1074 Ga0373943_0141105
1075 Ga0373955_0065745
1076 Ga0373931_0186533
1077 Ga0373931_0247705
1078 Ga0373935_0021984
1079 Ga0373935_0050587
1080 Ga0373927_0061965
1081 Ga0373927_0123946
1082 Ga0373927_0138830
1083 Ga0373947_0010332
1084 Ga0373937_0006656
1085 Ga0373937_0148147
1086 Ga0373925_0002032
1087 Ga0373925_0008828
1088 Ga0373925_0035645
1089 Ga0373925_0063682
1090 Ga0436364_0780048
1091 Ga0242420_029192
1092 Ga0436362_1015845
1093 Ga0466961_0147382
1094 Ga0466963_0180370
1095 Ga0466964_0057103
1096 Ga0466959_0281866
1097 Ga0451576_0288160
1098 Ga0451576_0422851
1099 Ga0466967_0002081
1100 Ga0466967_0318636
1101 Ga0466967_0667895
1102 Ga0495629_0005415
1103 Ga0495629_0321842
1104 Ga0495629_0388782
1105 Ga0495641_0001339
1106 Ga0495580_0000315
1107 Ga0495580_0001387
1108 Ga0495580_0003011
1109 Ga0495580_0003383
1110 Ga0495580_0006849
1111 Ga0495580_0041358
1112 Ga0495580_0066095
1113 Ga0495580_0228753
1114 Ga0495582_0003742
1115 Ga0495664_0219636
1116 Ga0495584_0043065
1117 Ga0495628_0137292
1118 Ga0495630_0063635
1119 Ga0495631_0032811
1120 Ga0495644_0001194
1121 Ga0495665_0002616
1122 Ga0495656_0005818
1123 Ga0495646_0313810
1124 Ga0495674_0087626
1125 Ga0495674_0244153
1126 Ga0495674_0344196
1127 Ga0495676_0211382
1128 Ga0495675_0020523
1129 Ga0495684_0163421
1130 Ga0495686_0000003
1131 Ga0495686_0032943
1132 Ga0496100_0023316
1133 Ga0496100_0202186
1134 Ga0496100_0218307
1135 Ga0496101_0137909
1136 Ga0496101_0180222
1137 Ga0496101_0202514
1138 Ga0496102_0017506
1139 Ga0496102_0040335
1140 Ga0496102_0112863
1141 Ga0496102_0300814
1142 Ga0496103_0014091
1143 Ga0496103_0025709
1144 Ga0496103_0105179
1145 Ga0496104_0013890
1146 Ga0496104_0178820
1147 Ga0496104_0180499
1148 Ga0496104_0296876
1149 Ga0496104_0653788
1150 Ga0496105_0032884
1151 Ga0496106_0029034
1152 Ga0496106_0047801
1153 Ga0496106_0261740
1154 Ga0496108_0007623
1155 Ga0496108_0060700
1156 Ga0496109_0000335
1157 Ga0496109_0020221
1158 Ga0496110_0006022
1159 Ga0496110_0037545
1160 Ga0496111_0119508
1161 Ga0496112_0001705
1162 Ga0496112_0367825
1163 Ga0496112_0405530
1164 Ga0496113_0000733
1165 Ga0496113_0285607
1166 Ga0496113_0618199
1167 Ga0496114_0306924
1168 Ga0496115_0006034
1169 Ga0496115_0028984
1170 Ga0496115_0112462
1171 Ga0501069_0157957
1172 nmdc:mga0n895_118622_c1
1173 nmdc:mga0n895_13971_c1
1174 nmdc:mga0n895_2843_c1
1175 nmdc:mga0n895_3164_c1
1176 nmdc:mga0rr50_1195_c1
1177 nmdc:mga0rr50_37569_c1
1178 nmdc:mga08x19_11236_c1
1179 nmdc:mga08x19_1445_c1
1180 nmdc:mga08x19_228190_c1
1181 nmdc:mga0a205_148877_c1
1182 nmdc:mga0a205_330_c1
1183 nmdc:mga0a205_3953_c2
1184 Ga0495601_0094935
1185 Ga0495619_0150026
1186 Ga0501084_0226307
1187 2740033598
1188 2910248789

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01887

SAM_HAT_N

SAM hydroxide adenosyltransferase N-terminal domain

32

177

0.95

PF20257

SAM_HAT_C

SAM hydroxide adenosyltransferase C-terminal domain

201

288

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
6ryz-assembly1.cif.gz_A sall with s-adenosyl methionine 0.9272 3 265
7xto-assembly1.cif.gz_B structure of cla2 reveal the mechanism of soil bacterial derived chlorinase 0.9257 3 266
2zbu-assembly1.cif.gz_A crystal structure of uncharacterized conserved protein from thermotoga maritima 0.9226 7 265
7xto-assembly1.cif.gz_B structure of cla2 reveal the mechanism of soil bacterial derived chlorinase 0.9222 3 266
2cc2-assembly1.cif.gz_C-2 x-ray crystal structure of 5'-fluorodeoxyadenosine synthase from streptomyces cattleya complexed with 5'deoxyadenosine 0.9188 5 266
ID Description Score Start End Superfamily
2zbvA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;S-adenosyl-l-methionine hydroxide adenosyltransferase, N-terminal 0.9534 8 161 3.40.50.10790
2q6oA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;S-adenosyl-l-methionine hydroxide adenosyltransferase, N-terminal 0.9492 5 161 3.40.50.10790
2zbvA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;S-adenosyl-l-methionine hydroxide adenosyltransferase, N-terminal 0.9415 8 161 3.40.50.10790
af_Q2FUT0_2_166_3.40.50.10790 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;S-adenosyl-l-methionine hydroxide adenosyltransferase, N-terminal 0.932 6 162 3.40.50.10790
1rqpB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;S-adenosyl-l-methionine hydroxide adenosyltransferase, N-terminal 0.9268 5 163 3.40.50.10790
ID Description Score Start End GO Terms
AF-A0A2V9P785-F1-model_v4 S-adenosyl-l-methionine hydroxide adenosyltransferase N-terminal domain-containing protein 0.9864 1 147
AF-A0A0F9KKB1-F1-model_v4 S-adenosyl-l-methionine hydroxide adenosyltransferase N-terminal domain-containing protein 0.9805 4 113
AF-X1TSK2-F1-model_v4 S-adenosyl-l-methionine hydroxide adenosyltransferase N-terminal domain-containing protein 0.9798 3 105
AF-A0A354BNF7-F1-model_v4 S-adenosyl-l-methionine hydroxide adenosyltransferase N-terminal domain-containing protein 0.9773 3 129
AF-A0A7V9GD75-F1-model_v4 SAM-dependent chlorinase/fluorinase 0.9766 6 267

Map