F467078

General Info

Members Datasets Scaffolds Average Seq Length
591 428 1183 275

Family's Representative Sequence

Representative Sequence 3300048909|Ga0496106_0001539|Ga0496106_0001539_813_1775
Length 320
Sequence MGFRPDAQAAMRPGKPAARVQIMPIQFVPIEFSLGQSSNLRRYIVTTQPIITFHDGHSIPQVGLGVWQTPQDIAAPTVRTALAAGYRHIDTASGYDNEEGVGEGIRSAGVDRKDIFLTTKLRNTDQGYDNALRAFEVSLKKLGSEYIDLYLIHWPSPHRGLYRETWKAFVRLREEGRVRSIGVSNFYPDHLDHIIGDTGVVPVINQIELHPDFQQKAAQEAHKKLNIATESWSPLGQGRFISNPAIGQIAAKHGKTPAQVIIRWHIDTGLVVIPKSVTPSRIEENFKVFDFKLDGDDMAAIAKLDNAGARMGPDPYTATF

Samples

Sample ID Description Type Environment
1 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
2 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
3 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
4 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
5 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
6 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
7 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
8 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
9 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
10 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
11 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
12 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
13 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
14 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
15 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
16 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
17 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
18 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
19 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
20 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
21 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
30 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
31 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
32 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
33 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
34 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
35 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
36 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
37 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
38 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
39 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
40 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
41 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
42 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
43 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
44 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
45 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
46 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
47 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
49 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
50 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
51 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
52 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
53 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
54 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
55 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
56 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
57 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
58 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
59 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
60 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
61 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
62 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
63 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
64 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
65 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
66 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
67 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
68 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
69 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
70 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
71 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
72 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
73 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
74 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
75 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
76 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
77 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
78 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
79 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
92 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
94 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
95 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
96 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
97 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
98 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
99 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
100 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
101 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
102 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
103 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
104 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
105 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
106 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
107 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
108 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
109 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
110 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
111 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
112 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
113 3300041916 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaT_extra_run Metatranscriptome Unclassified
114 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
115 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
116 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
117 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
118 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
119 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
120 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
121 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
122 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
123 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
124 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
125 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
126 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
127 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
128 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
129 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
130 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
131 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
132 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
133 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
134 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
135 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
136 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
137 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
138 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
139 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
140 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
141 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
142 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
143 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
144 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
145 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
146 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
147 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
148 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
149 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
150 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
151 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
152 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
153 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
154 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
155 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
156 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
157 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
158 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
159 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
160 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
161 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
162 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
163 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
164 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
165 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
166 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
167 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
168 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
169 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
170 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
171 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
172 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
173 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
174 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
175 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
176 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
177 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
178 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
179 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
180 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
181 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
182 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
183 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
184 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
185 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
186 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
187 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
188 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
189 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
190 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
191 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
192 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
193 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
194 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
195 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
196 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
197 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
198 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
199 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
200 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
201 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
202 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
203 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
204 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
205 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
206 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
207 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
208 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
209 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
210 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
211 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
212 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
213 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
214 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
215 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
216 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
217 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
218 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
219 2558860983 Allorhizobium undicola ATCC 700741 Isolate Rhizoplane
220 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
221 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
222 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
223 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
224 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
225 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
226 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
227 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
228 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
229 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
230 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
231 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
232 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
233 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
234 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
235 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
236 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
237 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
238 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
239 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
240 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
241 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
242 2643221599 Rhizobium sp. Root708 Isolate Unclassified
243 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
244 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
245 2643221644 Rhizobacter sp. Root1221 Isolate Unclassified
246 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
247 2718217882 Rhizobium sp. N741 Isolate Nodule
248 2718217927 Rhizobium sp. N324 Isolate Nodule
249 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
250 2718218009 Rhizobium sp. N561 Isolate Nodule
251 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
252 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
253 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
254 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
255 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
256 2718218363 Rhizobium sp. N113 Isolate Nodule
257 2718218365 Rhizobium sp. N731 Isolate Nodule
258 2718218366 Rhizobium sp. N621 Isolate Nodule
259 2718218423 Rhizobium sp. N941 Isolate Nodule
260 2721755514 Rhizobium sp. N6212 Isolate Nodule
261 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
262 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
263 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
264 2721755809 Rhizobium sp. N541 Isolate Nodule
265 2721755810 Rhizobium sp. N871 Isolate Nodule
266 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
267 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
268 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
269 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
270 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
271 2728369365 Rhizobium sp. N1341 Isolate Nodule
272 2728369397 Rhizobium sp. N1314 Isolate Nodule
273 2738541293 Rhizobium sp. GV031 Isolate Unclassified
274 2738541317 Rhizobium halophytocola DSM 21600 Isolate Unclassified
275 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
276 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
277 2791355256 Rhizobium sp. M10 Isolate Nodule
278 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
279 2791355260 Rhizobium sp. L9 Isolate Nodule
280 2791355261 Rhizobium sp. J15 Isolate Nodule
281 2791355262 Rhizobium sp. M1 Isolate Nodule
282 2791355263 Rhizobium chutanense C5 Isolate Nodule
283 2791355264 Rhizobium sp. S9 Isolate Nodule
284 2791355265 Rhizobium sp. H4 Isolate Nodule
285 2791355266 Rhizobium sp. L43 Isolate Nodule
286 2791355267 Rhizobium sp. L18 Isolate Nodule
287 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
288 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
289 2802429633 Rhizobium anhuiense J3 Isolate Nodule
290 2802429634 Rhizobium anhuiense S10 Isolate Nodule
291 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
292 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
293 2802429637 Rhizobium anhuiense C15 Isolate Nodule
294 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
295 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
296 2829745981 Methylorubrum rhodinum DSM 2163 Isolate Rhizosphere
297 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
298 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
299 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
300 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
301 2838048938 Rhizobium pisi 27/80 Isolate Nodule
302 2838061910 Rhizobium phaseoli L15 Isolate Nodule
303 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
304 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
305 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
306 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
307 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
308 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
309 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
310 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
311 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
312 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
313 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
314 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
315 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
316 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
317 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
318 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
319 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
320 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
321 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
322 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
323 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
324 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
325 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
326 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
327 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
328 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
329 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
330 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
331 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
332 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
333 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
334 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
335 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
336 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
337 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
338 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
339 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
340 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
341 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
342 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
343 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
344 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
345 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
346 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
347 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
348 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
349 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
350 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
351 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
352 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
353 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
354 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
355 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
356 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
357 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
358 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
359 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
360 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
361 2852677369 Pseudoclavibacter sp. JAI123 Isolate Rhizosphere
362 2854911287 Brucella lupini LUP21 Isolate Unclassified
363 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
364 2887478801 Catellatospora paridis NEAU-CL2 Isolate Rhizosphere
365 2889306138 Methylobacterium sp. PvR107 Isolate Rhizosphere
366 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
367 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
368 2902330777 Methylobacterium sp. 2A Isolate Unclassified
369 2902405164 Methylobacterium sp. P1-11 Isolate Unclassified
370 2913308742 Rhizobium halophytocola DSM 21600 Isolate Unclassified
371 2915650412 Ochrobactrum sp. CM-21-5 Isolate Rhizosphere
372 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
373 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
374 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
375 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
376 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
377 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
378 2933599457 Rhizobium phaseoli M3 Isolate Nodule
379 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
380 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
381 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
382 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
383 2936381700 Rhizobium chutanense C16 Isolate Unclassified
384 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
385 2996887358 Rhizobium sp. R711 Isolate Nodule
386 2996893221 Rhizobium sp. R635 Isolate Nodule
387 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
388 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
389 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
390 637000220 Pseudomonas protegens Pf-5 Isolate Rhizoplane
391 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
392 8005258706 Rhizobium sp. R693 Isolate Nodule
393 8005275841 Rhizobium sp. N4311 Isolate Nodule
394 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
395 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
396 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
397 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
398 8005321885 Rhizobium sp. R72 Isolate Nodule
399 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
400 8005382845 Rhizobium sp. R634 Isolate Nodule
401 8005395548 Rhizobium sp. R339 Isolate Nodule
402 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
403 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
404 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
405 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
406 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
407 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
408 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
409 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
410 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
411 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
412 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
413 8005658619 Rhizobium terrae CC-HIH110 Isolate Unclassified
414 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
415 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
416 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
417 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
418 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
419 8018176218 Rhizobium sp. N122 Isolate Nodule
420 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
421 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
422 8024501048 Rhizobium sp. H4 Isolate Nodule
423 8055431914 Allorhizobium sonneratiae BGMRC 0089 Isolate Unclassified
424 8056207758 Saccharopolyspora indica KCTC 29208 Isolate Rhizosphere
425 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
426 8056382006 Rhizobium croatiense 13T Isolate Nodule
427 8057575449 Rhizobium mayense CCGE526 Isolate Nodule
428 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 59.56
Metatranscriptomes 0.17
Isolates 40.27

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 23.69
Nodule 29.44
Rhizoplane 1.69
Rhizosphere 27.92
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496106_0001539 3300048909 Bacteria 17349
2 JGI25162J39368_1000670 3300002737 Bacteria 24190
3 JGI25158J39367_1000257 3300002739 Bacteria 12106
4 JGI25152J39213_1003396 3300002773 Bacteria 5455
5 JGI25152J39213_1004524 3300002773 Bacteria 4351
6 JGI25152J39213_1008518 3300002773 Bacteria 2538
7 JGI25150J39212_1002930 3300002774 Bacteria 4120
8 JGI25150J39212_1002988 3300002774 Bacteria 4076
9 JGI25150J39212_1006071 3300002774 Bacteria 2526
10 JGI25151J46595_10002488 3300003187 Bacteria 11010
11 JGI25151J46595_10011217 3300003187 Bacteria 4128
12 JGI25151J46595_10033153 3300003187 Bacteria 1993
13 JGI25406J46586_10048057 3300003203 Bacteria 1449
14 JGI25165J46597_1001403 3300003214 Bacteria 13115
15 JGI25153J46596_10007213 3300003215 Bacteria 5507
16 JGI25153J46596_10007250 3300003215 Bacteria 5484
17 JGI25153J46596_10007437 3300003215 Bacteria 5392
18 JGI25153J46596_10030423 3300003215 Bacteria 1837
19 JGI25153J46596_10031428 3300003215 Bacteria 1787
20 rootH2_10005415 3300003320 Bacteria 6748
21 rootL2_10020736 3300003322 Bacteria 9132
22 rootL2_10045350 3300003322 Bacteria 1845
23 rootH1_10031878 3300003316 Bacteria 2339
24 rootH1_10031878 3300003323 Bacteria 5406
25 JGI25160J50197_1001577 3300003354 Bacteria 11246
26 JGI25160J50197_1010078 3300003354 Bacteria 3448
27 JGI25161J50226_1000327 3300003374 Bacteria 25949
28 JGI25161J50226_1004058 3300003374 Bacteria 3157
29 Ga0055526_1005398 3300003771 Bacteria 7358
30 Ga0055526_1005433 3300003771 Bacteria 7329
31 Ga0055526_1005536 3300003771 Bacteria 7219
32 Ga0055526_1009342 3300003771 Bacteria 4734
33 Ga0055526_1030386 3300003771 Bacteria 1577
34 Ga0055524_1003673 3300003775 Bacteria 7355
35 Ga0055524_1026946 3300003775 Bacteria 1759
36 Ga0055528_1000099 3300003790 Bacteria 68463
37 Ga0055528_1003438 3300003790 Bacteria 7948
38 Ga0055528_1007781 3300003790 Bacteria 4687
39 Ga0055528_1007890 3300003790 Bacteria 4645
40 Ga0055528_1012692 3300003790 Bacteria 3252
41 Ga0055528_1028498 3300003790 Bacteria 1539
42 Ga0055528_1031576 3300003790 Bacteria 1374
43 Ga0055528_1034512 3300003790 Bacteria 1245
44 Ga0055540_1001518 3300003792 Bacteria 13685
45 Ga0055540_1017756 3300003792 Bacteria 1975
46 Ga0055543_1000062 3300004625 Bacteria 98034
47 Ga0055543_1000683 3300004625 Bacteria 17717
48 Ga0065165_1007723 3300005262 Bacteria 5206
49 Ga0065165_1020505 3300005262 Bacteria 2322
50 Ga0065165_1031106 3300005262 Bacteria 1691
51 Ga0070666_10083600 3300005335 Bacteria 2184
52 Ga0070668_100063647 3300005347 Bacteria 2859
53 Ga0070668_100433879 3300005347 Bacteria 1127
54 Ga0070671_100021768 3300005355 Bacteria 5236
55 Ga0070674_100002699 3300005356 Bacteria 9810
56 Ga0070709_10303958 3300005434 Bacteria 1166
57 Ga0070663_100098454 3300005455 Bacteria 2179
58 Ga0070662_100492831 3300005457 Bacteria 1021
59 Ga0070665_100058024 3300005548 Bacteria 3881
60 Ga0068856_100096678 3300005614 Bacteria 2942
61 Ga0068852_100075286 3300005616 Bacteria 2977
62 Ga0068862_100168567 3300005844 Bacteria 1959
63 Ga0081455_10110821 3300005937 Bacteria 2181
64 Ga0081538_10002544 3300005981 Bacteria 17736
65 Ga0081539_10016231 3300005985 Bacteria 5339
66 Ga0075365_10019268 3300006038 Bacteria 4209
67 Ga0075365_10042567 3300006038 Bacteria 2969
68 Ga0075363_100025730 3300006048 Bacteria 3005
69 Ga0075364_10211655 3300006051 Bacteria 1315
70 Ga0070716_100148882 3300006173 Bacteria 1503
71 Ga0070716_100225785 3300006173 Bacteria 1261
72 Ga0070712_100015168 3300006175 Bacteria 4956
73 Ga0075362_10170614 3300006177 Bacteria 1051
74 Ga0075367_10000317 3300006178 Bacteria 17069
75 Ga0075367_10006651 3300006178 Bacteria 5861
76 Ga0075369_10002260 3300006186 Bacteria 6838
77 Ga0075369_10002960 3300006186 Bacteria 6137
78 Ga0075369_10003953 3300006186 Bacteria 5434
79 Ga0075366_10099135 3300006195 Bacteria 1748
80 Ga0075434_100404521 3300006871 Bacteria 1386
81 Ga0105251_10012539 3300009011 Bacteria 4791
82 Ga0105251_10056272 3300009011 Bacteria 1862
83 Ga0105244_10092993 3300009036 Bacteria 1481
84 Ga0111539_10000050 3300009094 Bacteria 118845
85 Ga0111539_10111696 3300009094 Bacteria 3207
86 Ga0105248_10202850 3300009177 Bacteria 2234
87 Ga0105237_10005220 3300009545 Bacteria 14694
88 Ga0105249_10073845 3300009553 Bacteria 3155
89 Ga0123341_1000009 3300009765 Bacteria 122597
90 Ga0123342_1005742 3300009766 Bacteria 17739
91 Ga0123342_1021198 3300009766 Bacteria 4602
92 Ga0105239_10004443 3300010375 Bacteria 16762
93 Ga0157373_10030898 3300013100 Bacteria 3854
94 Ga0157370_10003433 3300013104 Bacteria 18605
95 Ga0157369_10105525 3300013105 Bacteria 3000
96 Ga0157380_10544878 3300014326 Bacteria 1137
97 Ga0182007_10002371 3300015262 Bacteria 9423
98 Ga0182005_1006203 3300015265 Bacteria 3673
99 Ga0213876_10078541 3300021384 Bacteria 1744
100 Ga0209436_100018 3300025208 Bacteria 113499
101 Ga0209437_100057 3300025233 Bacteria 362922
102 Ga0207425_1000553 3300025245 Bacteria 22329
103 Ga0207425_1002734 3300025245 Bacteria 6007
104 Ga0207425_1015780 3300025245 Bacteria 1688
105 Ga0207425_1016702 3300025245 Bacteria 1625
106 Ga0209677_100382 3300025253 Bacteria 27101
107 Ga0209129_1000118 3300025258 Bacteria 139972
108 Ga0209129_1000717 3300025258 Bacteria 21402
109 Ga0209129_1001394 3300025258 Bacteria 13509
110 Ga0209129_1002591 3300025258 Bacteria 8663
111 Ga0209129_1012169 3300025258 Bacteria 1997
112 Ga0209129_1012465 3300025258 Bacteria 1947
113 Ga0209233_1000130 3300025261 Bacteria 205687
114 Ga0209233_1000358 3300025261 Bacteria 41919
115 Ga0209673_1000033 3300025273 Bacteria 335369
116 Ga0209673_1000050 3300025273 Bacteria 285287
117 Ga0209673_1000052 3300025273 Bacteria 279795
118 Ga0209673_1001975 3300025273 Bacteria 16020
119 Ga0209673_1004592 3300025273 Bacteria 7322
120 Ga0209673_1006640 3300025273 Bacteria 5526
121 Ga0209673_1008371 3300025273 Bacteria 4611
122 Ga0209673_1011025 3300025273 Bacteria 3760
123 Ga0209673_1046506 3300025273 Bacteria 1184
124 Ga0209130_1000009 3300025284 Bacteria 498952
125 Ga0209130_1008804 3300025284 Bacteria 2941
126 Ga0209130_1009679 3300025284 Bacteria 2723
127 Ga0209675_1001014 3300025291 Bacteria 17608
128 Ga0209676_1012501 3300025292 Bacteria 3329
129 Ga0209676_1039049 3300025292 Bacteria 1353
130 Ga0209025_1000042 3300025294 Bacteria 370577
131 Ga0209025_1000335 3300025294 Bacteria 103615
132 Ga0209025_1002221 3300025294 Bacteria 21395
133 Ga0209025_1002567 3300025294 Bacteria 18887
134 Ga0209025_1006540 3300025294 Bacteria 8995
135 Ga0209025_1013261 3300025294 Bacteria 5196
136 Ga0209025_1032233 3300025294 Bacteria 2456
137 Ga0209025_1044600 3300025294 Bacteria 1850
138 Ga0209564_1001330 3300025295 Bacteria 26421
139 Ga0209564_1002296 3300025295 Bacteria 15576
140 Ga0209564_1005228 3300025295 Bacteria 7506
141 Ga0209564_1019480 3300025295 Bacteria 2532
142 Ga0209564_1020496 3300025295 Bacteria 2418
143 Ga0209564_1024084 3300025295 Bacteria 2090
144 Ga0209564_1034975 3300025295 Bacteria 1463
145 Ga0209758_1000896 3300025297 Bacteria 40464
146 Ga0209758_1001936 3300025297 Bacteria 22483
147 Ga0209758_1001953 3300025297 Bacteria 22290
148 Ga0209758_1002583 3300025297 Bacteria 18175
149 Ga0209758_1031542 3300025297 Bacteria 2171
150 Ga0209758_1034781 3300025297 Bacteria 1997
151 Ga0209758_1035851 3300025297 Bacteria 1947
152 Ga0209758_1073499 3300025297 Bacteria 1065
153 Ga0209050_1013046 3300025298 Bacteria 3743
154 Ga0209256_1001743 3300025299 Bacteria 20757
155 Ga0209256_1003224 3300025299 Bacteria 11772
156 Ga0209256_1003248 3300025299 Bacteria 11690
157 Ga0209256_1013088 3300025299 Bacteria 3107
158 Ga0209256_1015909 3300025299 Bacteria 2601
159 Ga0207426_1000041 3300025302 Bacteria 433536
160 Ga0207426_1000348 3300025302 Bacteria 85294
161 Ga0207426_1010734 3300025302 Bacteria 3537
162 Ga0209051_1000276 3300025303 Bacteria 84192
163 Ga0209051_1006472 3300025303 Bacteria 6596
164 Ga0209051_1006579 3300025303 Bacteria 6520
165 Ga0209051_1021814 3300025303 Bacteria 2712
166 Ga0209051_1036000 3300025303 Bacteria 1834
167 Ga0209257_1005271 3300025304 Bacteria 9217
168 Ga0207680_10368414 3300025903 Bacteria 1011
169 Ga0207699_10191649 3300025906 Bacteria 1380
170 Ga0207695_10000044 3300025913 Bacteria 440819
171 Ga0207671_10000400 3300025914 Bacteria 60604
172 Ga0207693_10009087 3300025915 Bacteria 8112
173 Ga0207644_10017410 3300025931 Bacteria 4851
174 Ga0207665_10195401 3300025939 Bacteria 1472
175 Ga0207711_10587785 3300025941 Bacteria 1039
176 Ga0207668_10022320 3300025972 Bacteria 4050
177 Ga0207678_10126952 3300026067 Bacteria 2175
178 Ga0207702_10030783 3300026078 Bacteria 4471
179 Ga0207698_10051709 3300026142 Bacteria 3143
180 Ga0207428_10000937 3300027907 Bacteria 32446
181 Ga0268266_10033752 3300028379 Bacteria 4350
182 Ga0307515_10079042 3300028794 Bacteria 4315
183 Ga0307512_10084681 3300030522 Bacteria 2252
184 Ga0265340_10027293 3300031247 Bacteria 2879
185 Ga0307513_10116359 3300031456 Bacteria 2653
186 Ga0307405_10003191 3300031731 Bacteria 7467
187 Ga0307518_10062632 3300031838 Bacteria 2701
188 Ga0307410_10072343 3300031852 Bacteria 2394
189 Ga0307406_10001146 3300031901 Bacteria 14816
190 Ga0307416_100252782 3300032002 Bacteria 1717
191 Ga0307411_10123750 3300032005 Bacteria 1876
192 Ga0373931_0003085 3300035691 Bacteria 7452
193 Ga0436365_1180274 3300039437 Bacteria 1763
194 Ga0436363_0797432 3300039450 Bacteria 1343
195 Ga0436363_0976609 3300039450 Bacteria 2910
196 Ga0439465_0004986 3300041413 Bacteria 4265
197 Ga0439465_0033210 3300041413 Bacteria 1650
198 Ga0439465_0041327 3300041413 Bacteria 1492
199 Ga0451802_1528366 3300041460 Bacteria 1566
200 Ga0451835_0763923 3300041492 Bacteria 1059
201 Ga0451841_0751336 3300041498 Bacteria 1110
202 Ga0451845_0282847 3300041501 Bacteria 1357
203 Ga0451845_0787831 3300041501 Bacteria 2459
204 Ga0451855_1070575 3300041511 Bacteria 1866
205 Ga0451853_0215652 3300041512 Bacteria 2189
206 Ga0452271_30813 3300041916 Bacteria 1375
207 Ga0439462_0044276 3300042015 Bacteria 1191
208 Ga0450918_000447 3300042531 Bacteria 8796
209 Ga0466968_0103542 3300044735 Bacteria 1273
210 Ga0495603_0007419 3300046455 Bacteria 6595
211 Ga0495638_0000257 3300046460 Bacteria 71780
212 Ga0495650_0039640 3300046471 Bacteria 2031
213 Ga0495605_0009564 3300046474 Bacteria 5442
214 Ga0495605_0009769 3300046474 Bacteria 5389
215 Ga0495585_0017866 3300046492 Bacteria 4093
216 Ga0495585_0036163 3300046492 Bacteria 2788
217 Ga0495585_0060484 3300046492 Bacteria 2084
218 Ga0495607_0000661 3300046501 Bacteria 33467
219 Ga0495607_0035882 3300046501 Bacteria 2994
220 Ga0495583_0008838 3300046506 Bacteria 6096
221 Ga0495583_0033107 3300046506 Bacteria 2488
222 Ga0495606_0000544 3300046507 Bacteria 60468
223 Ga0495606_0004841 3300046507 Bacteria 13213
224 Ga0495606_0014011 3300046507 Bacteria 6287
225 Ga0495610_0004675 3300046512 Bacteria 10016
226 Ga0495620_0010172 3300046515 Bacteria 4969
227 Ga0495620_0027026 3300046515 Bacteria 2691
228 Ga0495631_0007008 3300046518 Bacteria 5769
229 Ga0495632_0004107 3300046519 Bacteria 10031
230 Ga0495632_0024761 3300046519 Bacteria 3183
231 Ga0495632_0038439 3300046519 Bacteria 2423
232 Ga0495632_0041401 3300046519 Bacteria 2315
233 Ga0495643_0006495 3300046522 Bacteria 7693
234 Ga0495643_0036092 3300046522 Bacteria 2718
235 Ga0495609_0096752 3300046538 Bacteria 1281
236 Ga0495633_0047929 3300046558 Bacteria 2018
237 Ga0495633_0064323 3300046558 Bacteria 1715
238 Ga0495668_0016678 3300046616 Bacteria 4270
239 Ga0495668_0030459 3300046616 Bacteria 3046
240 Ga0495611_0016448 3300046648 Bacteria 3162
241 Ga0495625_0036519 3300046660 Bacteria 3611
242 Ga0495625_0053750 3300046660 Bacteria 2879
243 Ga0495625_0057637 3300046660 Bacteria 2761
244 Ga0495625_0090835 3300046660 Bacteria 2111
245 Ga0495588_0026192 3300046674 Bacteria 2910
246 Ga0495646_0083175 3300046680 Bacteria 1861
247 Ga0495670_0135368 3300046691 Bacteria 1286
248 Ga0495649_0002881 3300046694 Bacteria 11921
249 Ga0495660_0016245 3300046810 Bacteria 4293
250 Ga0495660_0044884 3300046810 Bacteria 2429
251 Ga0495636_0035500 3300047318 Bacteria 2054
252 Ga0495672_0111187 3300047320 Bacteria 1470
253 Ga0495676_0002451 3300047321 Bacteria 16487
254 Ga0495687_033391 3300047443 Bacteria 2335
255 Ga0495687_067213 3300047443 Bacteria 1452
256 Ga0495673_0037968 3300047469 Bacteria 2195
257 Ga0495686_0005368 3300047472 Bacteria 10133
258 Ga0495686_0019392 3300047472 Bacteria 4544
259 Ga0495686_0029080 3300047472 Bacteria 3596
260 Ga0495686_0085836 3300047472 Bacteria 1916
261 Ga0496100_0006646 3300048903 Bacteria 6322
262 Ga0496101_0097459 3300048904 Bacteria 2196
263 Ga0496101_0177486 3300048904 Bacteria 1639
264 Ga0496102_0041392 3300048905 Bacteria 4171
265 Ga0496109_0387583 3300048912 Bacteria 1320
266 Ga0496116_0000263 3300048919 Bacteria 91997
267 Ga0496116_0004254 3300048919 Bacteria 13732
268 Ga0496116_0026740 3300048919 Bacteria 4209
269 Ga0496116_0043890 3300048919 Bacteria 3041
270 Ga0496117_0005347 3300048920 Bacteria 13534
271 Ga0496117_0011833 3300048920 Bacteria 7766
272 Ga0496117_0022854 3300048920 Bacteria 5007
273 Ga0496117_0084751 3300048920 Bacteria 2066
274 Ga0496117_0086732 3300048920 Bacteria 2032
275 Ga0496118_0013506 3300048921 Bacteria 7716
276 Ga0496118_0018393 3300048921 Bacteria 6308
277 Ga0496118_0053724 3300048921 Bacteria 3058
278 Ga0496118_0089732 3300048921 Bacteria 2121
279 Ga0496118_0100199 3300048921 Bacteria 1960
280 Ga0496118_0167774 3300048921 Bacteria 1346
281 Ga0496119_0086154 3300048922 Bacteria 1796
282 Ga0496120_0011566 3300048923 Bacteria 6060
283 Ga0496120_0072885 3300048923 Bacteria 1881
284 Ga0496121_0017407 3300048924 Bacteria 7344
285 Ga0496121_0028919 3300048924 Bacteria 5145
286 Ga0496121_0044056 3300048924 Bacteria 3855
287 Ga0496121_0049280 3300048924 Bacteria 3572
288 Ga0496121_0076380 3300048924 Bacteria 2670
289 Ga0496122_0000040 3300048925 Bacteria 285095
290 Ga0496122_0000984 3300048925 Bacteria 50862
291 Ga0496122_0009143 3300048925 Bacteria 10499
292 Ga0496122_0016932 3300048925 Bacteria 6849
293 Ga0496122_0022747 3300048925 Bacteria 5560
294 Ga0496122_0088971 3300048925 Bacteria 2113
295 Ga0496123_0000290 3300048926 Bacteria 98053
296 Ga0496123_0006271 3300048926 Bacteria 11581
297 Ga0496123_0008746 3300048926 Bacteria 9243
298 Ga0496123_0014523 3300048926 Bacteria 6520
299 Ga0496123_0037961 3300048926 Bacteria 3393
300 Ga0496123_0079447 3300048926 Bacteria 2004
301 Ga0496123_0081662 3300048926 Bacteria 1963
302 Ga0496124_0006102 3300048927 Bacteria 13250
303 Ga0496124_0007783 3300048927 Bacteria 11317
304 Ga0496124_0018862 3300048927 Bacteria 6442
305 Ga0496124_0021210 3300048927 Bacteria 5989
306 Ga0496124_0088136 3300048927 Bacteria 2537
307 Ga0496124_0108251 3300048927 Bacteria 2241
308 Ga0496124_0108661 3300048927 Bacteria 2236
309 Ga0496125_0007081 3300048928 Bacteria 11973
310 Ga0496125_0019592 3300048928 Bacteria 6375
311 Ga0496125_0027792 3300048928 Bacteria 5120
312 Ga0496125_0269721 3300048928 Bacteria 1061
313 Ga0496126_0000210 3300048929 Bacteria 131214
314 Ga0496126_0001347 3300048929 Bacteria 38995
315 Ga0496126_0076793 3300048929 Bacteria 2962
316 Ga0496126_0096502 3300048929 Bacteria 2591
317 Ga0496126_0149452 3300048929 Bacteria 2003
318 Ga0501032_0024582 3300049569 Bacteria 4157
319 Ga0501036_0065557 3300049572 Bacteria 3073
320 Ga0501037_0085373 3300049573 Bacteria 2285
321 Ga0501037_0202634 3300049573 Bacteria 1402
322 Ga0501038_0222668 3300049574 Bacteria 1504
323 Ga0501043_0201519 3300049579 Bacteria 1544
324 Ga0501046_0004650 3300049580 Bacteria 12405
325 Ga0501047_0098436 3300049581 Bacteria 2803
326 Ga0501048_0023827 3300049582 Bacteria 4470
327 Ga0501068_0122513 3300049584 Bacteria 1622
328 Ga0501070_0020154 3300049586 Bacteria 5593
329 Ga0501072_0403099 3300049588 Bacteria 1085
330 Ga0501080_0621214 3300049742 Bacteria 958
331 Ga0501083_0021315 3300049744 Bacteria 4502
332 Ga0501044_0100926 3300049823 Bacteria 2903
333 Ga0501044_0140517 3300049823 Bacteria 2404
334 Ga0501045_0021132 3300049824 Bacteria 4654
335 nmdc:mga0k408_221385_c1 3300050493 Bacteria 1130
336 nmdc:mga0k408_57183_c1 3300050493 Bacteria 2264
337 nmdc:mga07m45_33251_c1 3300050496 Bacteria 2863
338 nmdc:mga06r32_429297_c1 3300050510 Bacteria 1302
339 nmdc:mga08y16_33_c1 3300050511 Bacteria 172528
340 Ga0500578_0151384 3300053086 Bacteria 1445
341 Ga0500557_001560 3300053105 Bacteria 3809
342 Ga0500560_003279 3300053107 Bacteria 3249
343 Ga0500569_024260 3300053109 Bacteria 1639
344 Ga0500618_004037 3300053125 Bacteria 4827
345 Ga0500618_007882 3300053125 Bacteria 3007
346 Ga0500658_0000735 3300053134 Bacteria 13496
347 Ga0500568_0011336 3300053139 Bacteria 4143
348 Ga0500568_0023589 3300053139 Bacteria 2616
349 Ga0500604_0030931 3300053151 Bacteria 1569
350 Ga0500616_0000110 3300053153 Bacteria 152339
351 Ga0500616_0017147 3300053153 Bacteria 4112
352 Ga0500616_0080920 3300053153 Bacteria 1632
353 Ga0500622_0000239 3300053156 Bacteria 57040
354 Ga0500627_0068335 3300053158 Bacteria 1571
355 2509389402 2509276021 Bacteria 7634384
356 2509446197 2509276033 Bacteria 7180565
357 2510135250 2510065019 Bacteria 6903379
358 2510896705 2510461076 Bacteria 8618824
359 2511134217 2510917022 Bacteria 6504556
360 2511184004 2510917028 Bacteria 6185411
361 2511194605 2510917030 Bacteria 7460662
362 2513571633 2513237084 Bacteria 7231967
363 2513578668 2513237085 Bacteria 7695351
364 2513596834 2513237088 Bacteria 6927906
365 2513630148 2513237093 Bacteria 7545552
366 2513711354 2513237103 Bacteria 7647401
367 2513867486 2513237138 Bacteria 7368160
368 2513912383 2513237144 Bacteria 7530820
369 2513928430 2513237146 Bacteria 7166346
370 2514019406 2513237162 Bacteria 7468464
371 2515114408 2515075009 Bacteria 7288508
372 2515635412 2515154113 Bacteria 7807172
373 2515643180 2515154114 Bacteria 7848616
374 2515657644 2515154116 Bacteria 7552979
375 2515741593 2515154134 Bacteria 7220242
376 2517038060 2516653077 Bacteria 7555578
377 2517078323 2516653085 Bacteria 7346596
378 2517097082 2517093000 Bacteria 7412387
379 2517408533 2517287029 Bacteria 6905599
380 2524458483 2524023209 Bacteria 6679728
381 2530647346 2529292951 Bacteria 6916614
382 2535519030 2534681796 Bacteria 7146037
383 2561467116 2558860983 Bacteria 4133860
384 2585201732 2582581294 Bacteria 6626667
385 2585223927 2582581298 Bacteria 7315509
386 2585228732 2582581299 Bacteria 6518058
387 2585257354 2582581304 Bacteria 5831370
388 2585271684 2582581307 Bacteria 6597605
389 2585280737 2582581308 Bacteria 7413247
390 2585334126 2582581316 Bacteria 7774528
391 2585399755 2582581867 Bacteria 7184437
392 2585526039 2585427526 Bacteria 7258840
393 2585531670 2585427527 Bacteria 7273426
394 2585540784 2585427528 Bacteria 6842387
395 2585549150 2585427529 Bacteria 7395659
396 2585551383 2585427530 Bacteria 7383882
397 2585563076 2585427531 Bacteria 6992870
398 2585820842 2585427590 Bacteria 6824633
399 2585839054 2585427593 Bacteria 7141551
400 2585844864 2585427594 Bacteria 6180594
401 2585907293 2585427609 Bacteria 6667127
402 2587982713 2585428125 Bacteria 6662905
403 2599420139 2599185170 Bacteria 7295545
404 2616296311 2615840624 Bacteria 6557588
405 2616306718 2615840626 Bacteria 7921970
406 2644002478 2643221599 Bacteria 6292121
407 2644194815 2643221634 Bacteria 6705461
408 2644240497 2643221643 Bacteria 5749658
409 2644243005 2643221644 Bacteria 6865017
410 2671113459 2667528174 Bacteria 6435400
411 2719182967 2718217882 Bacteria 6556348
412 2719387682 2718217927 Bacteria 6972593
413 2719667312 2718217997 Bacteria 6740740
414 2719733684 2718218009 Bacteria 6478651
415 2720493732 2718218199 Bacteria 6740745
416 2720615186 2718218232 Bacteria 6720332
417 2720621981 2718218233 Bacteria 6662049
418 2720633331 2718218235 Bacteria 6630699
419 2720777029 2718218269 Bacteria 6906114
420 2721149079 2718218363 Bacteria 6524337
421 2721160477 2718218365 Bacteria 6274507
422 2721165892 2718218366 Bacteria 6425255
423 2721401316 2718218423 Bacteria 6438183
424 2722842062 2721755514 Bacteria 6424414
425 2723028627 2721755556 Bacteria 6745503
426 2723562231 2721755684 Bacteria 6859907
427 2723568934 2721755685 Bacteria 6704835
428 2724040130 2721755809 Bacteria 6438790
429 2724046440 2721755810 Bacteria 6479005
430 2724091636 2721755819 Bacteria 6906405
431 2724106199 2721755822 Bacteria 6726041
432 2724112004 2721755823 Bacteria 6752556
433 2725947542 2724679232 Bacteria 7646494
434 2730109563 2728369352 Bacteria 6745171
435 2730166202 2728369365 Bacteria 6555560
436 2730300109 2728369397 Bacteria 6274511
437 2738801182 2738541293 Bacteria 7065685
438 2738947031 2738541317 Bacteria 5340176
439 2739037280 2738541333 Bacteria 7106503
440 2766064263 2765235942 Bacteria 7445910
441 2793295624 2791355256 Bacteria 6798008
442 2793313373 2791355259 Bacteria 7254731
443 2793320724 2791355260 Bacteria 6598818
444 2793327288 2791355261 Bacteria 6661293
445 2793332241 2791355262 Bacteria 6774204
446 2793338818 2791355263 Bacteria 6872478
447 2793346604 2791355264 Bacteria 6429314
448 2793353857 2791355265 Bacteria 6539969
449 2793359391 2791355266 Bacteria 7116587
450 2793365909 2791355267 Bacteria 7222458
451 2805926219 2802429605 Bacteria 6875453
452 2805933945 2802429606 Bacteria 6346811
453 2806047372 2802429633 Bacteria 7341974
454 2806054227 2802429634 Bacteria 7083200
455 2806060189 2802429635 Bacteria 7650140
456 2806068800 2802429636 Bacteria 7597525
457 2806076406 2802429637 Bacteria 7067217
458 2819611256 2818991448 Bacteria 6772224
459 2819638813 2818991453 Bacteria 7181617
460 2829749621 2829745981 Bacteria 5406054
461 2838018328 2838016132 Bacteria 6577831
462 2838024010 2838022645 Bacteria 6494267
463 2838040347 2838035591 Bacteria 7166484
464 2838047845 2838042994 Bacteria 6046894
465 2838050810 2838048938 Bacteria 6044578
466 2838062578 2838061910 Bacteria 6794874
467 2838072128 2838068647 Bacteria 6208656
468 2838667762 2838661181 Bacteria 7385261
469 2838672168 2838668709 Bacteria 6671819
470 2838683874 2838680041 Bacteria 6545511
471 2838690287 2838686498 Bacteria 7807632
472 2838698402 2838694306 Bacteria 6853137
473 2838704962 2838701080 Bacteria 6669771
474 2838711517 2838707686 Bacteria 6619912
475 2838732062 2838729681 Bacteria 7400765
476 2838744958 2838742623 Bacteria 7396178
477 2841856016 2841851746 Bacteria 7532261
478 2841867754 2841864319 Bacteria 6742987
479 2842081318 2842077413 Bacteria 6508645
480 2842116850 2842110456 Bacteria 7656360
481 2842121905 2842118031 Bacteria 7033875
482 2842148802 2842146304 Bacteria 5957337
483 2842161185 2842156927 Bacteria 6894975
484 2842166697 2842163707 Bacteria 6916235
485 2842184802 2842180545 Bacteria 6888678
486 2842194878 2842192696 Bacteria 6147454
487 2842201603 2842198810 Bacteria 6608673
488 2842207423 2842205361 Bacteria 6340321
489 2842221785 2842217011 Bacteria 7497767
490 2842232384 2842229732 Bacteria 7475766
491 2842240919 2842237096 Bacteria 6620661
492 2842246800 2842243621 Bacteria 7421798
493 2842254643 2842250916 Bacteria 6579627
494 2842261099 2842257432 Bacteria 7401195
495 2842269642 2842264693 Bacteria 6472963
496 2842274307 2842271015 Bacteria 7807131
497 2842280866 2842278818 Bacteria 6340002
498 2842288522 2842285085 Bacteria 6011953
499 2842294975 2842291075 Bacteria 7076806
500 2842300260 2842298080 Bacteria 6123127
501 2842305851 2842304105 Bacteria 7023636
502 2842311416 2842311132 Bacteria 6616990
503 2842321115 2842317721 Bacteria 6793725
504 2842346577 2842341865 Bacteria 7003929
505 2842361222 2842357229 Bacteria 6485165
506 2842366267 2842363717 Bacteria 6844742
507 2842375007 2842370503 Bacteria 7038661
508 2842381374 2842377471 Bacteria 7140707
509 2842388444 2842384541 Bacteria 7057858
510 2842395939 2842395702 Bacteria 6780583
511 2842406132 2842402390 Bacteria 6681310
512 2842412717 2842409023 Bacteria 6687331
513 2842419404 2842415677 Bacteria 6596907
514 2842425760 2842422224 Bacteria 6239196
515 2842433596 2842428310 Bacteria 6767288
516 2842439924 2842434925 Bacteria 6502746
517 2842446553 2842441272 Bacteria 6769273
518 2842448775 2842447887 Bacteria 6754142
519 2842467938 2842462802 Bacteria 6588055
520 2842474533 2842469257 Bacteria 6752936
521 2842491168 2842489311 Bacteria 6620893
522 2842498505 2842495871 Bacteria 6820686
523 2844457014 2844454524 Bacteria 7952546
524 2852391710 2852387548 Bacteria 8025568
525 2852678834 2852677369 Bacteria 3768884
526 2854914954 2854911287 Bacteria 5582813
527 2857519578 2857516855 Bacteria 7787325
528 2887484787 2887478801 Bacteria 8972725
529 2889308302 2889306138 Bacteria 6358934
530 2891373898 2891373044 Bacteria 5202277
531 2899808032 2899803654 Bacteria 5577784
532 2902335785 2902330777 Bacteria 6395352
533 2902405724 2902405164 Bacteria 6784948
534 2913312142 2913308742 Bacteria 5350706
535 2915654374 2915650412 Bacteria 4288180
536 2919105391 2919100787 Bacteria 7710546
537 2919411084 2919408235 Bacteria 6149349
538 2923559484 2923556063 Bacteria 6793593
539 2933017663 2933016740 Bacteria 6355406
540 2933572356 2933570622 Bacteria 7023390
541 2933593145 2933586486 Bacteria 7667493
542 2933603019 2933599457 Bacteria 5858799
543 2935897947 2935894831 Bacteria 6620579
544 2935903631 2935901341 Bacteria 7341747
545 2936369892 2936367885 Bacteria 7324495
546 2936379077 2936375103 Bacteria 6652732
547 2936381946 2936381700 Bacteria 7006523
548 2989771556 2989771324 Bacteria 5605128
549 2996890247 2996887358 Bacteria 5795980
550 2996896998 2996893221 Bacteria 5823108
551 3005415803 3005409236 Bacteria 7188837
552 3005449663 3005445848 Bacteria 6906074
553 3005455954 3005452660 Bacteria 5889319
554 637322729 637000220 Bacteria 7074893
555 639650434 639633055 Bacteria 7751309
556 8005262430 8005258706 Bacteria 6184835
557 8005282437 8005275841 Bacteria 6929066
558 8005286745 8005282627 Bacteria 6675747
559 8005295086 8005289223 Bacteria 6634003
560 8005305965 8005301065 Bacteria 6614431
561 8005313702 8005307578 Bacteria 7395396
562 8005324774 8005321885 Bacteria 5795980
563 8005381565 8005376324 Bacteria 6590079
564 8005387769 8005382845 Bacteria 6732062
565 8005400805 8005395548 Bacteria 6806915
566 8005431108 8005430974 Bacteria 6689030
567 8005465100 8005460587 Bacteria 7157962
568 8005490315 8005484373 Bacteria 6297373
569 8005497677 8005497431 Bacteria 6477605
570 8005546679 8005542996 Bacteria 7077758
571 8005561176 8005556819 Bacteria 6908598
572 8005565800 8005563573 Bacteria 7153261
573 8005571848 8005570704 Bacteria 6957481
574 8005623410 8005619151 Bacteria 7030230
575 8005631009 8005626139 Bacteria 6534237
576 8005646966 8005645114 Bacteria 6950293
577 8005660823 8005658619 Bacteria 4500593
578 8005669082 8005668836 Bacteria 6953162
579 8005694336 8005688590 Bacteria 6610080
580 8005695739 8005695170 Bacteria 6912330
581 8018128913 8018127388 Bacteria 7351159
582 8018165085 8018163183 Bacteria 7277977
583 8018177155 8018176218 Bacteria 6896178
584 8023686542 8023680758 Bacteria 7729763
585 8024484373 8024479707 Bacteria 6954785
586 8024502013 8024501048 Bacteria 6427847
587 8055435541 8055431914 Bacteria 4551896
588 8056211070 8056207758 Bacteria 8639239
589 8056380419 8056375014 Bacteria 7006639
590 8056385248 8056382006 Bacteria 6408074
591 8057581630 8057575449 Bacteria 7367519
592 8057879292 8057874678 Bacteria 7494653
593 Ga0496106_0001539
594 JGI25162J39368_1000670
595 JGI25158J39367_1000257
596 JGI25152J39213_1003396
597 JGI25152J39213_1004524
598 JGI25152J39213_1008518
599 JGI25150J39212_1002930
600 JGI25150J39212_1002988
601 JGI25150J39212_1006071
602 JGI25151J46595_10002488
603 JGI25151J46595_10011217
604 JGI25151J46595_10033153
605 JGI25406J46586_10048057
606 JGI25165J46597_1001403
607 JGI25153J46596_10007213
608 JGI25153J46596_10007250
609 JGI25153J46596_10007437
610 JGI25153J46596_10030423
611 JGI25153J46596_10031428
612 rootH2_10005415
613 rootL2_10020736
614 rootL2_10045350
615 rootH1_10031878
616 JGI25160J50197_1001577
617 JGI25160J50197_1010078
618 JGI25161J50226_1000327
619 JGI25161J50226_1004058
620 Ga0055526_1005398
621 Ga0055526_1005433
622 Ga0055526_1005536
623 Ga0055526_1009342
624 Ga0055526_1030386
625 Ga0055524_1003673
626 Ga0055524_1026946
627 Ga0055528_1000099
628 Ga0055528_1003438
629 Ga0055528_1007781
630 Ga0055528_1007890
631 Ga0055528_1012692
632 Ga0055528_1028498
633 Ga0055528_1031576
634 Ga0055528_1034512
635 Ga0055540_1001518
636 Ga0055540_1017756
637 Ga0055543_1000062
638 Ga0055543_1000683
639 Ga0065165_1007723
640 Ga0065165_1020505
641 Ga0065165_1031106
642 Ga0070666_10083600
643 Ga0070668_100063647
644 Ga0070668_100433879
645 Ga0070671_100021768
646 Ga0070674_100002699
647 Ga0070709_10303958
648 Ga0070663_100098454
649 Ga0070662_100492831
650 Ga0070665_100058024
651 Ga0068856_100096678
652 Ga0068852_100075286
653 Ga0068862_100168567
654 Ga0081455_10110821
655 Ga0081538_10002544
656 Ga0081539_10016231
657 Ga0075365_10019268
658 Ga0075365_10042567
659 Ga0075363_100025730
660 Ga0075364_10211655
661 Ga0070716_100148882
662 Ga0070716_100225785
663 Ga0070712_100015168
664 Ga0075362_10170614
665 Ga0075367_10000317
666 Ga0075367_10006651
667 Ga0075369_10002260
668 Ga0075369_10002960
669 Ga0075369_10003953
670 Ga0075366_10099135
671 Ga0075434_100404521
672 Ga0105251_10012539
673 Ga0105251_10056272
674 Ga0105244_10092993
675 Ga0111539_10000050
676 Ga0111539_10111696
677 Ga0105248_10202850
678 Ga0105237_10005220
679 Ga0105249_10073845
680 Ga0123341_1000009
681 Ga0123342_1005742
682 Ga0123342_1021198
683 Ga0105239_10004443
684 Ga0157373_10030898
685 Ga0157370_10003433
686 Ga0157369_10105525
687 Ga0157380_10544878
688 Ga0182007_10002371
689 Ga0182005_1006203
690 Ga0213876_10078541
691 Ga0209436_100018
692 Ga0209437_100057
693 Ga0207425_1000553
694 Ga0207425_1002734
695 Ga0207425_1015780
696 Ga0207425_1016702
697 Ga0209677_100382
698 Ga0209129_1000118
699 Ga0209129_1000717
700 Ga0209129_1001394
701 Ga0209129_1002591
702 Ga0209129_1012169
703 Ga0209129_1012465
704 Ga0209233_1000130
705 Ga0209233_1000358
706 Ga0209673_1000033
707 Ga0209673_1000050
708 Ga0209673_1000052
709 Ga0209673_1001975
710 Ga0209673_1004592
711 Ga0209673_1006640
712 Ga0209673_1008371
713 Ga0209673_1011025
714 Ga0209673_1046506
715 Ga0209130_1000009
716 Ga0209130_1008804
717 Ga0209130_1009679
718 Ga0209675_1001014
719 Ga0209676_1012501
720 Ga0209676_1039049
721 Ga0209025_1000042
722 Ga0209025_1000335
723 Ga0209025_1002221
724 Ga0209025_1002567
725 Ga0209025_1006540
726 Ga0209025_1013261
727 Ga0209025_1032233
728 Ga0209025_1044600
729 Ga0209564_1001330
730 Ga0209564_1002296
731 Ga0209564_1005228
732 Ga0209564_1019480
733 Ga0209564_1020496
734 Ga0209564_1024084
735 Ga0209564_1034975
736 Ga0209758_1000896
737 Ga0209758_1001936
738 Ga0209758_1001953
739 Ga0209758_1002583
740 Ga0209758_1031542
741 Ga0209758_1034781
742 Ga0209758_1035851
743 Ga0209758_1073499
744 Ga0209050_1013046
745 Ga0209256_1001743
746 Ga0209256_1003224
747 Ga0209256_1003248
748 Ga0209256_1013088
749 Ga0209256_1015909
750 Ga0207426_1000041
751 Ga0207426_1000348
752 Ga0207426_1010734
753 Ga0209051_1000276
754 Ga0209051_1006472
755 Ga0209051_1006579
756 Ga0209051_1021814
757 Ga0209051_1036000
758 Ga0209257_1005271
759 Ga0207680_10368414
760 Ga0207699_10191649
761 Ga0207695_10000044
762 Ga0207671_10000400
763 Ga0207693_10009087
764 Ga0207644_10017410
765 Ga0207665_10195401
766 Ga0207711_10587785
767 Ga0207668_10022320
768 Ga0207678_10126952
769 Ga0207702_10030783
770 Ga0207698_10051709
771 Ga0207428_10000937
772 Ga0268266_10033752
773 Ga0307515_10079042
774 Ga0307512_10084681
775 Ga0265340_10027293
776 Ga0307513_10116359
777 Ga0307405_10003191
778 Ga0307518_10062632
779 Ga0307410_10072343
780 Ga0307406_10001146
781 Ga0307416_100252782
782 Ga0307411_10123750
783 Ga0373931_0003085
784 Ga0436365_1180274
785 Ga0436363_0797432
786 Ga0436363_0976609
787 Ga0439465_0004986
788 Ga0439465_0033210
789 Ga0439465_0041327
790 Ga0451802_1528366
791 Ga0451835_0763923
792 Ga0451841_0751336
793 Ga0451845_0282847
794 Ga0451845_0787831
795 Ga0451855_1070575
796 Ga0451853_0215652
797 Ga0452271_30813
798 Ga0439462_0044276
799 Ga0450918_000447
800 Ga0466968_0103542
801 Ga0495603_0007419
802 Ga0495638_0000257
803 Ga0495650_0039640
804 Ga0495605_0009564
805 Ga0495605_0009769
806 Ga0495585_0017866
807 Ga0495585_0036163
808 Ga0495585_0060484
809 Ga0495607_0000661
810 Ga0495607_0035882
811 Ga0495583_0008838
812 Ga0495583_0033107
813 Ga0495606_0000544
814 Ga0495606_0004841
815 Ga0495606_0014011
816 Ga0495610_0004675
817 Ga0495620_0010172
818 Ga0495620_0027026
819 Ga0495631_0007008
820 Ga0495632_0004107
821 Ga0495632_0024761
822 Ga0495632_0038439
823 Ga0495632_0041401
824 Ga0495643_0006495
825 Ga0495643_0036092
826 Ga0495609_0096752
827 Ga0495633_0047929
828 Ga0495633_0064323
829 Ga0495668_0016678
830 Ga0495668_0030459
831 Ga0495611_0016448
832 Ga0495625_0036519
833 Ga0495625_0053750
834 Ga0495625_0057637
835 Ga0495625_0090835
836 Ga0495588_0026192
837 Ga0495646_0083175
838 Ga0495670_0135368
839 Ga0495649_0002881
840 Ga0495660_0016245
841 Ga0495660_0044884
842 Ga0495636_0035500
843 Ga0495672_0111187
844 Ga0495676_0002451
845 Ga0495687_033391
846 Ga0495687_067213
847 Ga0495673_0037968
848 Ga0495686_0005368
849 Ga0495686_0019392
850 Ga0495686_0029080
851 Ga0495686_0085836
852 Ga0496100_0006646
853 Ga0496101_0097459
854 Ga0496101_0177486
855 Ga0496102_0041392
856 Ga0496109_0387583
857 Ga0496116_0000263
858 Ga0496116_0004254
859 Ga0496116_0026740
860 Ga0496116_0043890
861 Ga0496117_0005347
862 Ga0496117_0011833
863 Ga0496117_0022854
864 Ga0496117_0084751
865 Ga0496117_0086732
866 Ga0496118_0013506
867 Ga0496118_0018393
868 Ga0496118_0053724
869 Ga0496118_0089732
870 Ga0496118_0100199
871 Ga0496118_0167774
872 Ga0496119_0086154
873 Ga0496120_0011566
874 Ga0496120_0072885
875 Ga0496121_0017407
876 Ga0496121_0028919
877 Ga0496121_0044056
878 Ga0496121_0049280
879 Ga0496121_0076380
880 Ga0496122_0000040
881 Ga0496122_0000984
882 Ga0496122_0009143
883 Ga0496122_0016932
884 Ga0496122_0022747
885 Ga0496122_0088971
886 Ga0496123_0000290
887 Ga0496123_0006271
888 Ga0496123_0008746
889 Ga0496123_0014523
890 Ga0496123_0037961
891 Ga0496123_0079447
892 Ga0496123_0081662
893 Ga0496124_0006102
894 Ga0496124_0007783
895 Ga0496124_0018862
896 Ga0496124_0021210
897 Ga0496124_0088136
898 Ga0496124_0108251
899 Ga0496124_0108661
900 Ga0496125_0007081
901 Ga0496125_0019592
902 Ga0496125_0027792
903 Ga0496125_0269721
904 Ga0496126_0000210
905 Ga0496126_0001347
906 Ga0496126_0076793
907 Ga0496126_0096502
908 Ga0496126_0149452
909 Ga0501032_0024582
910 Ga0501036_0065557
911 Ga0501037_0085373
912 Ga0501037_0202634
913 Ga0501038_0222668
914 Ga0501043_0201519
915 Ga0501046_0004650
916 Ga0501047_0098436
917 Ga0501048_0023827
918 Ga0501068_0122513
919 Ga0501070_0020154
920 Ga0501072_0403099
921 Ga0501080_0621214
922 Ga0501083_0021315
923 Ga0501044_0100926
924 Ga0501044_0140517
925 Ga0501045_0021132
926 nmdc:mga0k408_221385_c1
927 nmdc:mga0k408_57183_c1
928 nmdc:mga07m45_33251_c1
929 nmdc:mga06r32_429297_c1
930 nmdc:mga08y16_33_c1
931 Ga0500578_0151384
932 Ga0500557_001560
933 Ga0500560_003279
934 Ga0500569_024260
935 Ga0500618_004037
936 Ga0500618_007882
937 Ga0500658_0000735
938 Ga0500568_0011336
939 Ga0500568_0023589
940 Ga0500604_0030931
941 Ga0500616_0000110
942 Ga0500616_0017147
943 Ga0500616_0080920
944 Ga0500622_0000239
945 Ga0500627_0068335
946 2509389402
947 2509446197
948 2510135250
949 2510896705
950 2511134217
951 2511184004
952 2511194605
953 2513571633
954 2513578668
955 2513596834
956 2513630148
957 2513711354
958 2513867486
959 2513912383
960 2513928430
961 2514019406
962 2515114408
963 2515635412
964 2515643180
965 2515657644
966 2515741593
967 2517038060
968 2517078323
969 2517097082
970 2517408533
971 2524458483
972 2530647346
973 2535519030
974 2561467116
975 2585201732
976 2585223927
977 2585228732
978 2585257354
979 2585271684
980 2585280737
981 2585334126
982 2585399755
983 2585526039
984 2585531670
985 2585540784
986 2585549150
987 2585551383
988 2585563076
989 2585820842
990 2585839054
991 2585844864
992 2585907293
993 2587982713
994 2599420139
995 2616296311
996 2616306718
997 2644002478
998 2644194815
999 2644240497
1000 2644243005
1001 2671113459
1002 2719182967
1003 2719387682
1004 2719667312
1005 2719733684
1006 2720493732
1007 2720615186
1008 2720621981
1009 2720633331
1010 2720777029
1011 2721149079
1012 2721160477
1013 2721165892
1014 2721401316
1015 2722842062
1016 2723028627
1017 2723562231
1018 2723568934
1019 2724040130
1020 2724046440
1021 2724091636
1022 2724106199
1023 2724112004
1024 2725947542
1025 2730109563
1026 2730166202
1027 2730300109
1028 2738801182
1029 2738947031
1030 2739037280
1031 2766064263
1032 2793295624
1033 2793313373
1034 2793320724
1035 2793327288
1036 2793332241
1037 2793338818
1038 2793346604
1039 2793353857
1040 2793359391
1041 2793365909
1042 2805926219
1043 2805933945
1044 2806047372
1045 2806054227
1046 2806060189
1047 2806068800
1048 2806076406
1049 2819611256
1050 2819638813
1051 2829749621
1052 2838018328
1053 2838024010
1054 2838040347
1055 2838047845
1056 2838050810
1057 2838062578
1058 2838072128
1059 2838667762
1060 2838672168
1061 2838683874
1062 2838690287
1063 2838698402
1064 2838704962
1065 2838711517
1066 2838732062
1067 2838744958
1068 2841856016
1069 2841867754
1070 2842081318
1071 2842116850
1072 2842121905
1073 2842148802
1074 2842161185
1075 2842166697
1076 2842184802
1077 2842194878
1078 2842201603
1079 2842207423
1080 2842221785
1081 2842232384
1082 2842240919
1083 2842246800
1084 2842254643
1085 2842261099
1086 2842269642
1087 2842274307
1088 2842280866
1089 2842288522
1090 2842294975
1091 2842300260
1092 2842305851
1093 2842311416
1094 2842321115
1095 2842346577
1096 2842361222
1097 2842366267
1098 2842375007
1099 2842381374
1100 2842388444
1101 2842395939
1102 2842406132
1103 2842412717
1104 2842419404
1105 2842425760
1106 2842433596
1107 2842439924
1108 2842446553
1109 2842448775
1110 2842467938
1111 2842474533
1112 2842491168
1113 2842498505
1114 2844457014
1115 2852391710
1116 2852678834
1117 2854914954
1118 2857519578
1119 2887484787
1120 2889308302
1121 2891373898
1122 2899808032
1123 2902335785
1124 2902405724
1125 2913312142
1126 2915654374
1127 2919105391
1128 2919411084
1129 2923559484
1130 2933017663
1131 2933572356
1132 2933593145
1133 2933603019
1134 2935897947
1135 2935903631
1136 2936369892
1137 2936379077
1138 2936381946
1139 2989771556
1140 2996890247
1141 2996896998
1142 3005415803
1143 3005449663
1144 3005455954
1145 637322729
1146 639650434
1147 8005262430
1148 8005282437
1149 8005286745
1150 8005295086
1151 8005305965
1152 8005313702
1153 8005324774
1154 8005381565
1155 8005387769
1156 8005400805
1157 8005431108
1158 8005465100
1159 8005490315
1160 8005497677
1161 8005546679
1162 8005561176
1163 8005565800
1164 8005571848
1165 8005623410
1166 8005631009
1167 8005646966
1168 8005660823
1169 8005669082
1170 8005694336
1171 8005695739
1172 8018128913
1173 8018165085
1174 8018177155
1175 8023686542
1176 8024484373
1177 8024502013
1178 8055435541
1179 8056211070
1180 8056380419
1181 8056385248
1182 8057581630
1183 8057879292

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00248

Aldo_ket_red

Aldo/keto reductase family

60

306

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
3wby-assembly2.cif.gz_B crystal structure of gox0644 d53a mutant in complex with nadph 0.9832 3 276
3wbx-assembly2.cif.gz_B crystal structure of gox0644 at apoform 0.98 3 276
3o0k-assembly4.cif.gz_D crystal structure of aldo/keto reductase from brucella melitensis 0.98 3 261
4fzi-assembly2.cif.gz_B crystal structure of prostaglandin f synthase from trypanosoma cruzi 0.9795 6 271
2wzt-assembly1.cif.gz_B crystal structure of a mycobacterium aldo-keto reductase in its apo and liganded form 0.9795 5 261
ID Description Score Start End Superfamily
3wbyA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9795 3 276 3.20.20.100
2wzmB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9781 3 275 3.20.20.100
af_Q2G2T8_4_275_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9752 5 276 3.20.20.100
af_Q4DJ07_1_282_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9747 4 271 3.20.20.100
af_Q2FXE2_1_275_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9726 5 271 3.20.20.100
ID Description Score Start End GO Terms
AF-W4QY65-F1-model_v4 Oxidoreductase 0.9963 5 189 GO:0004033
GO:0044281
AF-A0A529ZG74-F1-model_v4 Aldo/keto reductase 0.9956 38 183 GO:0004033
AF-A0A529IL94-F1-model_v4 deleted 0.9943 3 184
AF-A0A7G3D7D0-F1-model_v4 deleted 0.9943 1 133
AF-A0A4V3KTY5-F1-model_v4 Aldo/keto reductase 0.9931 19 155 GO:0004033
GO:0044281

Map