F467052

General Info

Members Datasets Scaffolds Average Seq Length
591 272 548 103

Family's Representative Sequence

Representative Sequence 3300014325|Ga0163163_10034063|Ga0163163_100340633
Length 121
Sequence LPKKGSFASARQWEEYWTVPTKLMLAAVVAGLCGAIAAPAGLASAEETAQETISRLQSEGYTVNIDRVGTGPLDQCVVTSVRNPQRVTQWVPYTGPGRDGDRVLVQVVTSQTISVTLNCSR

Samples

Sample ID Description Type Environment
1 2643221687 Mycobacterium sp. Root135 Isolate Unclassified
2 2738541274 Mycobacterium sp. YR708 Isolate Unclassified
3 2738543028 Mycobacterium sp. YR782 Isolate Unclassified
4 2902792274 Mycolicibacterium sp. P9-64 Isolate Unclassified
5 2902799365 Mycolicibacterium sp. P1-5 Isolate Unclassified
6 2902837492 Mycolicibacterium sp. P1-18 Isolate Unclassified
7 2929212328 Mycolicibacterium sp. R-73050 Hybrid assembly Isolate Unclassified
8 2939582691 Mycolicibacterium sp. 624 Isolate Rhizosphere
9 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
10 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
11 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
12 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
13 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
14 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
15 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
16 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
17 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
18 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
19 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
20 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
21 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
22 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
23 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
24 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
25 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
26 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
27 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
28 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
29 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
30 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
31 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
32 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
33 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
34 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
35 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
36 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
37 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
38 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
39 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
40 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
41 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
42 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
43 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
44 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
45 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
46 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
47 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
48 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
49 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
50 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
51 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
52 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
53 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
54 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
55 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
56 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
57 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
58 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
59 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
60 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
61 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
62 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
63 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
64 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
65 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
66 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
67 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
68 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
69 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
70 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
71 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
72 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
73 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
74 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
75 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
76 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
77 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
78 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
79 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
80 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
81 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
82 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
83 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
84 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
85 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
86 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
87 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
88 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
89 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
90 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
91 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
92 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
93 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
94 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
95 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
96 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
97 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
98 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
99 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
100 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
101 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
102 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
103 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
104 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
105 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
106 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
107 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
108 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
109 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
110 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
111 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
112 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
113 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
114 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
115 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
116 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
117 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
118 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
119 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
120 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
121 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
175 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
179 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
180 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
181 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
182 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
183 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
184 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
185 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
186 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
187 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
188 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
189 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
190 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
191 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
192 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
193 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
194 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
195 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
196 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
197 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
198 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
199 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
200 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
201 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
202 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
203 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
204 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
205 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
206 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
207 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
208 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
209 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
210 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
211 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
212 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
213 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
214 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
215 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
216 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
217 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
218 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
219 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
220 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
221 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
222 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
223 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
224 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
225 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
226 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
227 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
228 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
229 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
230 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
231 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
232 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
233 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
234 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
235 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
236 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
237 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
238 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
239 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
240 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
241 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
242 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
243 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
244 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
245 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
246 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
247 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
248 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
249 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
250 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
251 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
252 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
253 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
254 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
255 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
256 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
257 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
258 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
259 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
260 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
261 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
262 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
263 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
264 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
265 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
266 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
267 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
268 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
269 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
270 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
271 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
272 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.65
Metatranscriptomes 0
Isolates 1.35

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.8
Nodule 0
Rhizoplane 9.31
Rhizosphere 76.48
Stem 0
Stem Tuber 0
Unclassified 5.41

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24750J21931_1003013 3300002070 Bacteria 2018
2 JGI24745J21846_1006556 3300002073 Bacteria 1294
3 JGI24745J21846_1018160 3300002073 Bacteria 819
4 JGI24738J21930_10020817 3300002075 Bacteria 1363
5 JGI24744J21845_10000526 3300002077 Bacteria 6835
6 JGI24034J26672_10041453 3300002239 Bacteria 774
7 JGI24034J26672_10075788 3300002239 Bacteria 608
8 JGI24034J26672_10077968 3300002239 Bacteria 601
9 JGI24751J29686_10025804 3300002459 Bacteria 1219
10 Ga0070676_10000765 3300005328 Bacteria 15811
11 Ga0070676_10358230 3300005328 Bacteria 1005
12 Ga0070690_100001057 3300005330 Bacteria 14123
13 Ga0070690_100851048 3300005330 Bacteria 710
14 Ga0068869_100058035 3300005334 Bacteria 2828
15 Ga0068869_100173299 3300005334 Bacteria 1687
16 Ga0070666_10058634 3300005335 Bacteria 2604
17 Ga0070666_10102512 3300005335 Bacteria 1973
18 Ga0070682_100071839 3300005337 Bacteria 2216
19 Ga0070682_100117589 3300005337 Bacteria 1780
20 Ga0070682_100367759 3300005337 Bacteria 1077
21 Ga0068868_100002797 3300005338 Bacteria 12088
22 Ga0068868_100297776 3300005338 Bacteria 1369
23 Ga0068868_100478048 3300005338 Bacteria 1088
24 Ga0070660_100302713 3300005339 Bacteria 1311
25 Ga0070689_100011907 3300005340 Bacteria 6245
26 Ga0070689_100588546 3300005340 Bacteria 963
27 Ga0070691_10008985 3300005341 Bacteria 4572
28 Ga0070691_10415478 3300005341 Bacteria 761
29 Ga0070687_100237034 3300005343 Bacteria 1126
30 Ga0070692_10225578 3300005345 Bacteria 1109
31 Ga0070692_10533761 3300005345 Bacteria 766
32 Ga0070668_100001074 3300005347 Bacteria 19234
33 Ga0070668_100049167 3300005347 Bacteria 3245
34 Ga0070668_100381475 3300005347 Bacteria 1199
35 Ga0070668_100432714 3300005347 Bacteria 1128
36 Ga0070668_100601714 3300005347 Bacteria 962
37 Ga0070668_100785338 3300005347 Bacteria 845
38 Ga0070669_100003224 3300005353 Bacteria 11718
39 Ga0070669_100015223 3300005353 Bacteria 5478
40 Ga0070675_101485832 3300005354 Bacteria 625
41 Ga0070671_100003956 3300005355 Bacteria 11666
42 Ga0070671_100075988 3300005355 Bacteria 2806
43 Ga0070671_100270719 3300005355 Bacteria 1444
44 Ga0070671_100499755 3300005355 Bacteria 1046
45 Ga0070674_100007340 3300005356 Bacteria 6499
46 Ga0070673_100123947 3300005364 Bacteria 2160
47 Ga0070688_100044249 3300005365 Bacteria 2746
48 Ga0070688_100070028 3300005365 Bacteria 2242
49 Ga0070688_100281382 3300005365 Bacteria 1195
50 Ga0070659_100165307 3300005366 Bacteria 1810
51 Ga0070667_100000190 3300005367 Bacteria 73682
52 Ga0070667_100002951 3300005367 Bacteria 14616
53 Ga0070667_100005052 3300005367 Bacteria 11040
54 Ga0070667_101581688 3300005367 Bacteria 616
55 Ga0070709_10018435 3300005434 Bacteria 4019
56 Ga0070714_101645903 3300005435 Bacteria 627
57 Ga0070713_101560167 3300005436 Bacteria 641
58 Ga0070710_10006861 3300005437 Bacteria 5495
59 Ga0070710_10079349 3300005437 Bacteria 1912
60 Ga0070701_10003769 3300005438 Bacteria 6051
61 Ga0070701_10010283 3300005438 Bacteria 4131
62 Ga0070711_100009495 3300005439 Bacteria 5998
63 Ga0070711_100010820 3300005439 Bacteria 5656
64 Ga0070711_100780630 3300005439 Bacteria 809
65 Ga0070711_101254511 3300005439 Bacteria 642
66 Ga0070705_100009639 3300005440 Bacteria 4807
67 Ga0070700_100315338 3300005441 Bacteria 1147
68 Ga0070694_100048486 3300005444 Bacteria 2857
69 Ga0070663_100005933 3300005455 Bacteria 7309
70 Ga0070663_100418148 3300005455 Bacteria 1099
71 Ga0070663_100857633 3300005455 Bacteria 782
72 Ga0070663_101051008 3300005455 Unclassified 710
73 Ga0070678_100000395 3300005456 Bacteria 20536
74 Ga0070678_100090400 3300005456 Bacteria 2346
75 Ga0070678_100410739 3300005456 Bacteria 1178
76 Ga0070662_100001560 3300005457 Bacteria 14157
77 Ga0070662_100089314 3300005457 Bacteria 2311
78 Ga0070662_101024319 3300005457 Bacteria 707
79 Ga0068867_100004211 3300005459 Bacteria 10126
80 Ga0070685_10066316 3300005466 Bacteria 2127
81 Ga0070685_10880165 3300005466 Bacteria 665
82 Ga0068853_100048884 3300005539 Bacteria 3633
83 Ga0068853_100060937 3300005539 Bacteria 3262
84 Ga0070672_100219281 3300005543 Bacteria 1595
85 Ga0070672_101640461 3300005543 Bacteria 577
86 Ga0070686_101218799 3300005544 Bacteria 626
87 Ga0070695_100001869 3300005545 Bacteria 11891
88 Ga0070695_100268110 3300005545 Bacteria 1250
89 Ga0070695_101410182 3300005545 Bacteria 578
90 Ga0070696_100012678 3300005546 Bacteria 5660
91 Ga0070696_100216459 3300005546 Bacteria 1435
92 Ga0070693_100022684 3300005547 Bacteria 3342
93 Ga0070693_100066224 3300005547 Bacteria 2114
94 Ga0070665_100008287 3300005548 Bacteria 10512
95 Ga0070665_100050218 3300005548 Bacteria 4186
96 Ga0070665_100058164 3300005548 Bacteria 3876
97 Ga0070665_100858899 3300005548 Bacteria 920
98 Ga0070665_100859756 3300005548 Bacteria 920
99 Ga0070704_100000774 3300005549 Bacteria 15771
100 Ga0070704_100394468 3300005549 Bacteria 1179
101 Ga0070704_101252927 3300005549 Bacteria 677
102 Ga0068855_100059475 3300005563 Bacteria 4471
103 Ga0068855_100425582 3300005563 Bacteria 1452
104 Ga0068854_100011795 3300005578 Bacteria 5706
105 Ga0068854_100302463 3300005578 Bacteria 1294
106 Ga0068856_100360816 3300005614 Bacteria 1472
107 Ga0070702_100000892 3300005615 Bacteria 11613
108 Ga0070702_100441725 3300005615 Bacteria 941
109 Ga0070702_101016271 3300005615 Bacteria 657
110 Ga0068852_100732784 3300005616 Bacteria 1000
111 Ga0068859_100001075 3300005617 Bacteria 27961
112 Ga0068859_100001408 3300005617 Bacteria 24414
113 Ga0068864_100112908 3300005618 Bacteria 2422
114 Ga0068864_101762267 3300005618 Bacteria 624
115 Ga0068864_102131812 3300005618 Bacteria 567
116 Ga0068866_10002224 3300005718 Bacteria 8048
117 Ga0068861_100005526 3300005719 Bacteria 8561
118 Ga0068861_100070384 3300005719 Bacteria 2709
119 Ga0068861_100183953 3300005719 Bacteria 1741
120 Ga0068861_100275405 3300005719 Bacteria 1447
121 Ga0068861_100903187 3300005719 Bacteria 837
122 Ga0068851_10057490 3300005834 Bacteria 1986
123 Ga0068870_10266666 3300005840 Bacteria 1068
124 Ga0068863_100000733 3300005841 Bacteria 32858
125 Ga0068863_100001346 3300005841 Bacteria 24433
126 Ga0068863_100618555 3300005841 Bacteria 1073
127 Ga0068863_101088495 3300005841 Bacteria 803
128 Ga0068858_100010273 3300005842 Bacteria 8878
129 Ga0068858_100041018 3300005842 Bacteria 4293
130 Ga0068858_100160530 3300005842 Bacteria 2116
131 Ga0068858_100703914 3300005842 Bacteria 983
132 Ga0068858_101126566 3300005842 Bacteria 771
133 Ga0068858_102474813 3300005842 Unclassified 513
134 Ga0068860_100000099 3300005843 Bacteria 145436
135 Ga0068860_100019337 3300005843 Bacteria 6607
136 Ga0068860_100128147 3300005843 Bacteria 2433
137 Ga0068860_100268175 3300005843 Bacteria 1666
138 Ga0068860_100417228 3300005843 Bacteria 1330
139 Ga0068860_100469523 3300005843 Bacteria 1253
140 Ga0068862_100000086 3300005844 Bacteria 110489
141 Ga0068862_100002174 3300005844 Bacteria 17621
142 Ga0068862_100133917 3300005844 Bacteria 2194
143 Ga0081455_10046827 3300005937 Bacteria 3748
144 Ga0081455_10047173 3300005937 Bacteria 3733
145 Ga0081540_1120994 3300005983 Bacteria 1086
146 Ga0075365_11046277 3300006038 Bacteria 575
147 Ga0075368_10061159 3300006042 Bacteria 1508
148 Ga0075368_10539006 3300006042 Bacteria 524
149 Ga0075364_10013715 3300006051 Bacteria 4992
150 Ga0075364_10408327 3300006051 Bacteria 927
151 Ga0075364_10553116 3300006051 Bacteria 787
152 Ga0075364_11188531 3300006051 Bacteria 517
153 Ga0070715_10006927 3300006163 Bacteria 3877
154 Ga0070715_10283081 3300006163 Bacteria 880
155 Ga0070716_100025278 3300006173 Bacteria 3167
156 Ga0070716_100090182 3300006173 Bacteria 1854
157 Ga0070716_100459947 3300006173 Bacteria 930
158 Ga0070716_100596717 3300006173 Bacteria 830
159 Ga0070716_100816345 3300006173 Bacteria 723
160 Ga0070712_100005590 3300006175 Bacteria 7777
161 Ga0070712_100120437 3300006175 Bacteria 1974
162 Ga0070712_100318013 3300006175 Unclassified 1265
163 Ga0070712_100983303 3300006175 Bacteria 730
164 Ga0070712_101828698 3300006175 Bacteria 532
165 Ga0075362_10041303 3300006177 Bacteria 2034
166 Ga0075362_10235101 3300006177 Bacteria 898
167 Ga0075369_10003674 3300006186 Bacteria 5605
168 Ga0075369_10010001 3300006186 Bacteria 3704
169 Ga0075369_10035208 3300006186 Bacteria 2128
170 Ga0075369_10084923 3300006186 Bacteria 1407
171 Ga0075369_10091654 3300006186 Bacteria 1357
172 Ga0075369_10180064 3300006186 Bacteria 972
173 Ga0075366_10635448 3300006195 Bacteria 662
174 Ga0097621_100032958 3300006237 Bacteria 4121
175 Ga0097621_100500690 3300006237 Bacteria 1100
176 Ga0075370_10875698 3300006353 Bacteria 548
177 Ga0075370_11032558 3300006353 Bacteria 504
178 Ga0068871_100083806 3300006358 Bacteria 2645
179 Ga0068871_100125755 3300006358 Bacteria 2170
180 Ga0075428_100010510 3300006844 Bacteria 10285
181 Ga0075430_100141317 3300006846 Bacteria 2005
182 Ga0075431_100015870 3300006847 Bacteria 7638
183 Ga0075433_10776113 3300006852 Bacteria 838
184 Ga0068865_100000458 3300006881 Bacteria 22760
185 Ga0068865_100308779 3300006881 Bacteria 1268
186 Ga0097620_100001075 3300006931 Bacteria 27961
187 Ga0097620_100001408 3300006931 Bacteria 24414
188 Ga0105244_10129580 3300009036 Bacteria 1218
189 Ga0105250_10030702 3300009092 Bacteria 2160
190 Ga0105245_10022230 3300009098 Bacteria 5567
191 Ga0105245_13086145 3300009098 Bacteria 516
192 Ga0105247_10000051 3300009101 Bacteria 145981
193 Ga0105247_10000698 3300009101 Bacteria 26249
194 Ga0105247_10098965 3300009101 Bacteria 1862
195 Ga0105247_10141624 3300009101 Bacteria 1576
196 Ga0114129_10018925 3300009147 Bacteria 9812
197 Ga0105243_10004338 3300009148 Bacteria 11232
198 Ga0105241_10065455 3300009174 Bacteria 2808
199 Ga0105242_10031300 3300009176 Bacteria 4248
200 Ga0105248_10000281 3300009177 Bacteria 60208
201 Ga0105248_10005799 3300009177 Bacteria 13575
202 Ga0105248_10007577 3300009177 Bacteria 11924
203 Ga0105248_10848750 3300009177 Bacteria 1031
204 Ga0105237_10035391 3300009545 Bacteria 5053
205 Ga0105237_10121629 3300009545 Bacteria 2605
206 Ga0105238_10372110 3300009551 Bacteria 1419
207 Ga0105249_10000020 3300009553 Bacteria 260634
208 Ga0105249_10002502 3300009553 Bacteria 15909
209 Ga0105249_10012519 3300009553 Bacteria 7479
210 Ga0105249_10420695 3300009553 Bacteria 1370
211 Ga0105249_10799063 3300009553 Bacteria 1007
212 Ga0105239_10003845 3300010375 Bacteria 18233
213 Ga0105239_11882104 3300010375 Bacteria 694
214 Ga0105239_12853905 3300010375 Bacteria 564
215 Ga0105246_10243030 3300011119 Bacteria 1424
216 Ga0105246_10782461 3300011119 Unclassified 845
217 Ga0157373_10250879 3300013100 Bacteria 1252
218 Ga0157370_10603670 3300013104 Bacteria 1005
219 Ga0157369_10222522 3300013105 Bacteria 1975
220 Ga0157374_10554193 3300013296 Bacteria 1157
221 Ga0157378_10002421 3300013297 Bacteria 16593
222 Ga0157378_10217994 3300013297 Bacteria 1813
223 Ga0157378_10774323 3300013297 Bacteria 984
224 Ga0163162_10013181 3300013306 Bacteria 8074
225 Ga0163162_10459355 3300013306 Bacteria 1405
226 Ga0163162_10514305 3300013306 Unclassified 1327
227 Ga0157372_10007108 3300013307 Bacteria 11932
228 Ga0157375_10000478 3300013308 Bacteria 36449
229 Ga0157375_10547995 3300013308 Bacteria 1318
230 Ga0157375_10812317 3300013308 Unclassified 1083
231 Ga0157375_11241746 3300013308 Bacteria 875
232 Ga0163163_10034063 3300014325 Bacteria 4930
233 Ga0163163_10036630 3300014325 Bacteria 4767
234 Ga0163163_10487212 3300014325 Bacteria 1294
235 Ga0157380_10000372 3300014326 Bacteria 26981
236 Ga0157380_11436736 3300014326 Bacteria 741
237 Ga0157380_12932428 3300014326 Bacteria 543
238 Ga0157377_10059457 3300014745 Bacteria 2179
239 Ga0157377_10096250 3300014745 Bacteria 1756
240 Ga0157377_10977598 3300014745 Bacteria 639
241 Ga0157379_10018849 3300014968 Bacteria 6088
242 Ga0163161_10000595 3300017792 Bacteria 28928
243 Ga0163161_10218613 3300017792 Bacteria 1475
244 Ga0163161_10999198 3300017792 Bacteria 714
245 Ga0163161_11019367 3300017792 Bacteria 707
246 Ga0163161_11208811 3300017792 Bacteria 654
247 Ga0209673_1082741 3300025273 Bacteria 731
248 Ga0209051_1000337 3300025303 Bacteria 70482
249 Ga0209051_1001757 3300025303 Bacteria 17214
250 Ga0209051_1043313 3300025303 Bacteria 1581
251 Ga0209051_1085151 3300025303 Bacteria 898
252 Ga0207656_10626442 3300025321 Bacteria 550
253 Ga0207653_10112252 3300025885 Bacteria 974
254 Ga0207682_10160817 3300025893 Bacteria 1017
255 Ga0207692_10012504 3300025898 Bacteria 3648
256 Ga0207692_10014333 3300025898 Bacteria 3462
257 Ga0207642_10000408 3300025899 Bacteria 12934
258 Ga0207710_10000010 3300025900 Bacteria 482087
259 Ga0207710_10008903 3300025900 Bacteria 4222
260 Ga0207710_10029044 3300025900 Bacteria 2403
261 Ga0207710_10041843 3300025900 Bacteria 2033
262 Ga0207710_10103361 3300025900 Bacteria 1346
263 Ga0207688_10004583 3300025901 Bacteria 7523
264 Ga0207688_10005507 3300025901 Bacteria 6885
265 Ga0207680_10057517 3300025903 Bacteria 2353
266 Ga0207680_10084852 3300025903 Bacteria 1999
267 Ga0207680_10712826 3300025903 Bacteria 719
268 Ga0207647_10044672 3300025904 Bacteria 2767
269 Ga0207647_10427706 3300025904 Bacteria 744
270 Ga0207685_10122336 3300025905 Bacteria 1144
271 Ga0207685_10220671 3300025905 Bacteria 901
272 Ga0207699_10015221 3300025906 Bacteria 3991
273 Ga0207699_10071715 3300025906 Bacteria 2119
274 Ga0207645_10011590 3300025907 Bacteria 6012
275 Ga0207645_10140028 3300025907 Bacteria 1576
276 Ga0207643_11040776 3300025908 Bacteria 529
277 Ga0207654_10036263 3300025911 Bacteria 2753
278 Ga0207695_10592065 3300025913 Bacteria 990
279 Ga0207671_10526340 3300025914 Bacteria 943
280 Ga0207671_10747668 3300025914 Bacteria 777
281 Ga0207693_10000430 3300025915 Bacteria 38189
282 Ga0207693_10021746 3300025915 Bacteria 5099
283 Ga0207693_10322598 3300025915 Unclassified 1209
284 Ga0207693_11162841 3300025915 Bacteria 583
285 Ga0207663_10008638 3300025916 Bacteria 5342
286 Ga0207663_10261024 3300025916 Bacteria 1279
287 Ga0207662_10205645 3300025918 Bacteria 1276
288 Ga0207657_10079858 3300025919 Bacteria 2751
289 Ga0207657_10142276 3300025919 Bacteria 1959
290 Ga0207681_10007094 3300025923 Bacteria 6871
291 Ga0207681_10057116 3300025923 Bacteria 2665
292 Ga0207681_10596212 3300025923 Bacteria 913
293 Ga0207694_10989179 3300025924 Bacteria 712
294 Ga0207687_10005729 3300025927 Bacteria 8220
295 Ga0207687_10116209 3300025927 Bacteria 1994
296 Ga0207664_10489351 3300025929 Bacteria 1101
297 Ga0207664_11976514 3300025929 Bacteria 506
298 Ga0207644_10117600 3300025931 Bacteria 2019
299 Ga0207644_10475690 3300025931 Bacteria 1028
300 Ga0207644_10953489 3300025931 Bacteria 719
301 Ga0207690_10317225 3300025932 Bacteria 1224
302 Ga0207690_10446865 3300025932 Bacteria 1038
303 Ga0207706_10005158 3300025933 Bacteria 12192
304 Ga0207706_10019851 3300025933 Bacteria 6040
305 Ga0207686_10006430 3300025934 Bacteria 6323
306 Ga0207686_10488380 3300025934 Bacteria 953
307 Ga0207686_10850549 3300025934 Bacteria 734
308 Ga0207709_10220416 3300025935 Bacteria 1368
309 Ga0207709_10227970 3300025935 Bacteria 1348
310 Ga0207670_10103278 3300025936 Bacteria 2039
311 Ga0207670_10709421 3300025936 Bacteria 833
312 Ga0207669_10000296 3300025937 Bacteria 22903
313 Ga0207704_10002460 3300025938 Bacteria 8340
314 Ga0207665_10002077 3300025939 Bacteria 13519
315 Ga0207665_10027975 3300025939 Bacteria 3724
316 Ga0207665_10506982 3300025939 Bacteria 933
317 Ga0207691_10534340 3300025940 Bacteria 995
318 Ga0207711_10004238 3300025941 Bacteria 12269
319 Ga0207711_10015175 3300025941 Bacteria 6397
320 Ga0207711_10022398 3300025941 Bacteria 5283
321 Ga0207711_10205394 3300025941 Bacteria 1799
322 Ga0207711_11169852 3300025941 Bacteria 710
323 Ga0207689_10050090 3300025942 Bacteria 3444
324 Ga0207689_10132638 3300025942 Bacteria 2050
325 Ga0207667_10047710 3300025949 Bacteria 4532
326 Ga0207667_11150955 3300025949 Bacteria 757
327 Ga0207712_10000010 3300025961 Bacteria 455972
328 Ga0207712_10019182 3300025961 Bacteria 4463
329 Ga0207712_10105891 3300025961 Bacteria 2100
330 Ga0207712_10379021 3300025961 Bacteria 1183
331 Ga0207712_11251936 3300025961 Bacteria 663
332 Ga0207668_10004007 3300025972 Bacteria 8674
333 Ga0207668_10124408 3300025972 Bacteria 1958
334 Ga0207668_10264061 3300025972 Bacteria 1404
335 Ga0207668_10275274 3300025972 Bacteria 1378
336 Ga0207668_11304817 3300025972 Bacteria 653
337 Ga0207668_11542632 3300025972 Bacteria 599
338 Ga0207640_10015394 3300025981 Bacteria 4427
339 Ga0207640_10679705 3300025981 Bacteria 880
340 Ga0207658_10000138 3300025986 Bacteria 77096
341 Ga0207658_10051957 3300025986 Bacteria 3022
342 Ga0207658_10087637 3300025986 Bacteria 2404
343 Ga0207658_10536639 3300025986 Bacteria 1045
344 Ga0207658_10905030 3300025986 Bacteria 803
345 Ga0207658_10993887 3300025986 Bacteria 765
346 Ga0207677_10003414 3300026023 Bacteria 8416
347 Ga0207677_10181710 3300026023 Bacteria 1655
348 Ga0207703_10004928 3300026035 Bacteria 10834
349 Ga0207703_10005445 3300026035 Bacteria 10247
350 Ga0207703_10288690 3300026035 Bacteria 1492
351 Ga0207639_10020251 3300026041 Bacteria 4758
352 Ga0207639_10086289 3300026041 Bacteria 2499
353 Ga0207678_10023539 3300026067 Bacteria 5387
354 Ga0207678_10035430 3300026067 Bacteria 4345
355 Ga0207678_10242195 3300026067 Bacteria 1545
356 Ga0207678_10610973 3300026067 Bacteria 956
357 Ga0207708_10015821 3300026075 Bacteria 5661
358 Ga0207708_10016087 3300026075 Bacteria 5618
359 Ga0207702_10432124 3300026078 Bacteria 1275
360 Ga0207641_10001050 3300026088 Bacteria 27871
361 Ga0207641_10001782 3300026088 Bacteria 20723
362 Ga0207641_10297085 3300026088 Bacteria 1524
363 Ga0207641_10338605 3300026088 Bacteria 1431
364 Ga0207648_10147051 3300026089 Bacteria 2079
365 Ga0207676_10120283 3300026095 Bacteria 2213
366 Ga0207676_10172509 3300026095 Bacteria 1886
367 Ga0207676_11726660 3300026095 Bacteria 624
368 Ga0207675_100000192 3300026118 Bacteria 55745
369 Ga0207675_100255343 3300026118 Bacteria 1698
370 Ga0207675_100269282 3300026118 Bacteria 1653
371 Ga0207675_100294953 3300026118 Bacteria 1578
372 Ga0207675_100942331 3300026118 Bacteria 881
373 Ga0207683_10038090 3300026121 Bacteria 4188
374 Ga0207683_10038873 3300026121 Bacteria 4150
375 Ga0207683_10103817 3300026121 Bacteria 2539
376 Ga0209179_1017514 3300027512 Bacteria 1358
377 Ga0207428_10462909 3300027907 Bacteria 924
378 Ga0268266_10003241 3300028379 Bacteria 16423
379 Ga0268266_10015126 3300028379 Bacteria 6626
380 Ga0268266_10045909 3300028379 Bacteria 3739
381 Ga0268266_10204177 3300028379 Bacteria 1810
382 Ga0268266_10335877 3300028379 Bacteria 1417
383 Ga0268266_12155606 3300028379 Bacteria 530
384 Ga0268265_10000014 3300028380 Bacteria 330186
385 Ga0268265_10003449 3300028380 Bacteria 11369
386 Ga0268264_10000137 3300028381 Bacteria 176081
387 Ga0268264_10012916 3300028381 Bacteria 6866
388 Ga0268264_10083051 3300028381 Bacteria 2743
389 Ga0268264_10098581 3300028381 Bacteria 2535
390 Ga0268264_10661646 3300028381 Bacteria 1034
391 Ga0307413_10893393 3300031824 Bacteria 754
392 Ga0307410_10373809 3300031852 Bacteria 1145
393 Ga0307409_100185565 3300031995 Bacteria 1846
394 Ga0307409_100273843 3300031995 Bacteria 1556
395 Ga0307416_102303186 3300032002 Bacteria 639
396 Ga0307415_100632782 3300032126 Bacteria 957
397 Ga0373940_0113956 3300035088 Bacteria 833
398 Ga0373941_0050030 3300035115 Bacteria 1325
399 Ga0373941_0491709 3300035115 Bacteria 520
400 Ga0373942_0021221 3300035207 Bacteria 1637
401 Ga0373931_0042154 3300035691 Bacteria 2399
402 Ga0373947_0113937 3300035725 Bacteria 1712
403 Ga0395900_0536107 3300037418 Bacteria 1117
404 Ga0439461_0009338 3300041410 Bacteria 1777
405 Ga0439466_0006569 3300041411 Bacteria 4417
406 Ga0439465_0004922 3300041413 Bacteria 4293
407 Ga0439465_0046457 3300041413 Bacteria 1413
408 Ga0439465_0267873 3300041413 Bacteria 634
409 Ga0451833_1444449 3300041491 Unclassified 580
410 Ga0451839_0328336 3300041496 Bacteria 1032
411 Ga0439445_0143758 3300042004 Bacteria 692
412 Ga0439434_0228705 3300042435 Bacteria 632
413 Ga0466972_0157181 3300044658 Bacteria 1068
414 Ga0466972_0227238 3300044658 Bacteria 873
415 Ga0466972_0350956 3300044658 Bacteria 690
416 Ga0466966_0101953 3300044684 Bacteria 1775
417 Ga0466963_0621077 3300044694 Bacteria 763
418 Ga0466968_0122522 3300044735 Bacteria 1177
419 Ga0466968_0639719 3300044735 Unclassified 539
420 Ga0466959_0591249 3300045049 Bacteria 747
421 Ga0466958_0437903 3300045836 Bacteria 846
422 Ga0466967_0112250 3300045976 Bacteria 2506
423 Ga0466967_0392001 3300045976 Bacteria 1350
424 Ga0466967_1966474 3300045976 Bacteria 581
425 Ga0495629_0034283 3300046459 Bacteria 3589
426 Ga0495638_0473589 3300046460 Bacteria 635
427 Ga0495641_0008560 3300046461 Bacteria 6209
428 Ga0495640_0087164 3300046533 Bacteria 2065
429 Ga0495635_0110833 3300046663 Bacteria 1875
430 Ga0495658_0079011 3300046683 Bacteria 1927
431 Ga0495649_0040266 3300046694 Bacteria 2560
432 Ga0495604_0679874 3300047317 Unclassified 655
433 Ga0495674_0135968 3300047319 Bacteria 2068
434 Ga0495672_0196747 3300047320 Bacteria 1010
435 Ga0495676_0066535 3300047321 Bacteria 2792
436 Ga0495686_0028920 3300047472 Bacteria 3607
437 Ga0496100_0011216 3300048903 Bacteria 5096
438 Ga0496100_0014963 3300048903 Bacteria 4521
439 Ga0496100_0275886 3300048903 Bacteria 1252
440 Ga0496100_0369431 3300048903 Bacteria 1087
441 Ga0496101_0063476 3300048904 Bacteria 2689
442 Ga0496101_0100175 3300048904 Bacteria 2167
443 Ga0496101_0445572 3300048904 Bacteria 1021
444 Ga0496101_1570210 3300048904 Bacteria 511
445 Ga0496102_0000118 3300048905 Bacteria 113499
446 Ga0496102_0004619 3300048905 Bacteria 11652
447 Ga0496102_0053345 3300048905 Bacteria 3686
448 Ga0496102_0400553 3300048905 Bacteria 1290
449 Ga0496103_0000129 3300048906 Bacteria 81081
450 Ga0496103_0006659 3300048906 Bacteria 6896
451 Ga0496103_0253943 3300048906 Bacteria 1131
452 Ga0496103_0441193 3300048906 Bacteria 835
453 Ga0496104_0004253 3300048907 Bacteria 12431
454 Ga0496104_0372158 3300048907 Bacteria 1341
455 Ga0496105_0159142 3300048908 Bacteria 1854
456 Ga0496106_0008760 3300048909 Bacteria 7478
457 Ga0496106_0021650 3300048909 Bacteria 4773
458 Ga0496106_0035450 3300048909 Bacteria 3731
459 Ga0496106_0044396 3300048909 Bacteria 3336
460 Ga0496106_0460102 3300048909 Bacteria 1022
461 Ga0496107_0000264 3300048910 Bacteria 27701
462 Ga0496107_0203206 3300048910 Bacteria 1473
463 Ga0496107_0266761 3300048910 Bacteria 1274
464 Ga0496107_0303079 3300048910 Bacteria 1189
465 Ga0496107_0773780 3300048910 Unclassified 704
466 Ga0496107_1073427 3300048910 Bacteria 582
467 Ga0496108_0000727 3300048911 Bacteria 25597
468 Ga0496108_0142682 3300048911 Bacteria 2064
469 Ga0496109_0003787 3300048912 Bacteria 12624
470 Ga0496109_0202232 3300048912 Bacteria 1868
471 Ga0496109_0356843 3300048912 Bacteria 1381
472 Ga0496110_0009492 3300048913 Bacteria 7876
473 Ga0496110_0012445 3300048913 Bacteria 6997
474 Ga0496110_0055240 3300048913 Bacteria 3494
475 Ga0496111_0207405 3300048914 Bacteria 1456
476 Ga0496111_0629678 3300048914 Bacteria 784
477 Ga0496112_0009194 3300048915 Bacteria 8879
478 Ga0496112_0073908 3300048915 Bacteria 3370
479 Ga0496112_0251032 3300048915 Bacteria 1720
480 Ga0496113_0201466 3300048916 Bacteria 1582
481 Ga0496113_0219247 3300048916 Bacteria 1516
482 Ga0496114_0012963 3300048917 Bacteria 6680
483 Ga0496114_0499150 3300048917 Bacteria 1076
484 Ga0496114_0604372 3300048917 Unclassified 967
485 Ga0496114_1651667 3300048917 Bacteria 529
486 Ga0496115_0001293 3300048918 Bacteria 17870
487 Ga0496115_1316855 3300048918 Bacteria 537
488 Ga0496116_0034563 3300048919 Bacteria 3564
489 Ga0496117_0001082 3300048920 Bacteria 41248
490 Ga0496118_0001559 3300048921 Bacteria 34060
491 Ga0496118_0361721 3300048921 Bacteria 769
492 Ga0496119_0004722 3300048922 Bacteria 13387
493 Ga0496119_0249836 3300048922 Bacteria 895
494 Ga0496120_0042634 3300048923 Bacteria 2649
495 Ga0496121_0010275 3300048924 Bacteria 10589
496 Ga0496122_0155025 3300048925 Bacteria 1407
497 Ga0496124_0144736 3300048927 Bacteria 1871
498 Ga0496125_0030123 3300048928 Bacteria 4860
499 Ga0496125_0054375 3300048928 Bacteria 3272
500 Ga0496125_0279294 3300048928 Unclassified 1035
501 Ga0496126_0003099 3300048929 Bacteria 21487
502 Ga0496126_0391819 3300048929 Bacteria 1128
503 Ga0496126_0772975 3300048929 Bacteria 739
504 Ga0495682_0368152 3300049460 Bacteria 506
505 Ga0501034_0008271 3300049571 Bacteria 11008
506 Ga0501034_0223643 3300049571 Bacteria 1834
507 Ga0501036_0063582 3300049572 Bacteria 3124
508 Ga0501037_0001235 3300049573 Bacteria 18849
509 Ga0501038_0014358 3300049574 Bacteria 7217
510 Ga0501039_0007724 3300049575 Bacteria 8206
511 Ga0501040_0092682 3300049576 Bacteria 2101
512 Ga0501043_0008003 3300049579 Bacteria 8343
513 Ga0501070_0006036 3300049586 Bacteria 10317
514 Ga0501044_0153878 3300049823 Bacteria 2280
515 nmdc:mga03683_18219_c1 3300050489 Bacteria 2177
516 nmdc:mga03683_25715_c1 3300050489 Bacteria 2315
517 nmdc:mga00v17_163956_c1 3300050491 Bacteria 1432
518 nmdc:mga00v17_316557_c1 3300050491 Bacteria 1014
519 nmdc:mga0yw44_1063186_c1 3300050492 Bacteria 547
520 nmdc:mga0yw44_109248_c1 3300050492 Bacteria 1770
521 nmdc:mga0yw44_974455_c1 3300050492 Bacteria 574
522 nmdc:mga0k408_800879_c1 3300050493 Bacteria 549
523 nmdc:mga04h51_231810_c1 3300050495 Bacteria 735
524 nmdc:mga07m45_523985_c1 3300050496 Bacteria 686
525 nmdc:mga05p37_62609_c1 3300050507 Bacteria 4578
526 nmdc:mga0qj67_30676_c1 3300050509 Bacteria 4186
527 nmdc:mga06r32_178462_c1 3300050510 Bacteria 2109
528 nmdc:mga08y16_1276352_c1 3300050511 Bacteria 702
529 nmdc:mga0sz30_104811_c1 3300050516 Bacteria 1236
530 nmdc:mga0sz30_158226_c1 3300050516 Bacteria 1003
531 nmdc:mga0sz30_475536_c1 3300050516 Bacteria 561
532 nmdc:mga0sz30_4948_c1 3300050516 Bacteria 4857
533 Ga0500635_0165800 3300053080 Bacteria 849
534 Ga0495655_0273056 3300053083 Bacteria 574
535 Ga0500643_011665 3300053087 Bacteria 3191
536 Ga0500643_060627 3300053087 Bacteria 1063
537 Ga0500643_073538 3300053087 Bacteria 946
538 Ga0500557_154643 3300053105 Bacteria 754
539 Ga0500595_041652 3300053119 Bacteria 1475
540 Ga0500652_000157 3300053131 Bacteria 26172
541 Ga0500652_010812 3300053131 Bacteria 3144
542 Ga0500559_0402279 3300053136 Bacteria 637
543 Ga0500568_0135322 3300053139 Bacteria 915
544 Ga0500568_0221846 3300053139 Bacteria 691
545 Ga0500627_0027092 3300053158 Bacteria 2370
546 Ga0500633_0391755 3300053160 Bacteria 502
547 Ga0500645_000046 3300053730 Bacteria 106127
548 Ga0500645_012356 3300053730 Bacteria 2761

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049572 Ga0501036_0063582 Ga0501036_0063582_1734_2033 83
2 3300006175 Ga0070712_100318013 Ga0070712_1003180132 89
3 3300025915 Ga0207693_10322598 Ga0207693_103225982 89
4 3300005455 Ga0070663_101051008 Ga0070663_1010510081 90
5 3300009101 Ga0105247_10000051 Ga0105247_1000005180 90
6 3300009177 Ga0105248_10000281 Ga0105248_1000028153 90
7 3300009553 Ga0105249_10000020 Ga0105249_1000002057 90
8 3300013306 Ga0163162_10514305 Ga0163162_105143052 90
9 3300014325 Ga0163163_10036630 Ga0163163_100366303 90
10 3300026067 Ga0207678_10610973 Ga0207678_106109732 90
11 3300035725 Ga0373947_0113937 Ga0373947_0113937_491_811 90
12 3300041491 Ga0451833_1444449 Ga0451833_1444449_183_473 90
13 3300046459 Ga0495629_0034283 Ga0495629_0034283_3259_3579 90
14 3300046461 Ga0495641_0008560 Ga0495641_0008560_3889_4209 90
15 3300046533 Ga0495640_0087164 Ga0495640_0087164_1546_1866 90
16 3300046683 Ga0495658_0079011 Ga0495658_0079011_976_1296 90
17 3300047317 Ga0495604_0679874 Ga0495604_0679874_85_405 90
18 3300047319 Ga0495674_0135968 Ga0495674_0135968_1693_2013 90
19 3300048905 Ga0496102_0000118 Ga0496102_0000118_32238_32528 90
20 3300048906 Ga0496103_0000129 Ga0496103_0000129_56057_56347 90
21 3300048909 Ga0496106_0044396 Ga0496106_0044396_381_671 90
22 3300048917 Ga0496114_0604372 Ga0496114_0604372_552_842 90
23 3300048919 Ga0496116_0034563 Ga0496116_0034563_1457_1747 90
24 3300048920 Ga0496117_0001082 Ga0496117_0001082_4544_4834 90
25 3300048921 Ga0496118_0001559 Ga0496118_0001559_15309_15599 90
26 3300048922 Ga0496119_0004722 Ga0496119_0004722_2172_2462 90
27 3300048923 Ga0496120_0042634 Ga0496120_0042634_2230_2520 90
28 3300048924 Ga0496121_0010275 Ga0496121_0010275_1295_1585 90
29 3300048927 Ga0496124_0144736 Ga0496124_0144736_751_1041 90
30 3300048928 Ga0496125_0030123 Ga0496125_0030123_4460_4750 90
31 3300048929 Ga0496126_0003099 Ga0496126_0003099_13065_13355 90
32 3300053087 Ga0500643_073538 Ga0500643_073538_204_485 91
33 3300050489 nmdc:mga03683_25715_c1 nmdc:mga03683_25715_c1_1713_1997 92
34 3300053087 Ga0500643_060627 Ga0500643_060627_706_1005 92
35 3300006051 Ga0075364_11188531 Ga0075364_111885311 93
36 3300006177 Ga0075362_10041303 Ga0075362_100413033 93
37 3300050491 nmdc:mga00v17_316557_c1 nmdc:mga00v17_316557_c1_517_843 93
38 3300005337 Ga0070682_100071839 Ga0070682_1000718393 96
39 3300005353 Ga0070669_100003224 Ga0070669_10000322410 96
40 3300005367 Ga0070667_100000190 Ga0070667_10000019021 96
41 3300005455 Ga0070663_100857633 Ga0070663_1008576332 96
42 3300005456 Ga0070678_100410739 Ga0070678_1004107392 96
43 3300005548 Ga0070665_100050218 Ga0070665_1000502182 96
44 3300005549 Ga0070704_100394468 Ga0070704_1003944681 96
45 3300005616 Ga0068852_100732784 Ga0068852_1007327842 96
46 3300005617 Ga0068859_100001408 Ga0068859_1000014088 96
47 3300005841 Ga0068863_100001346 Ga0068863_1000013464 96
48 3300005842 Ga0068858_100010273 Ga0068858_1000102735 96
49 3300005843 Ga0068860_100000099 Ga0068860_10000009984 96
50 3300005844 Ga0068862_100000086 Ga0068862_10000008685 96
51 3300006173 Ga0070716_100816345 Ga0070716_1008163452 96
52 3300006931 Ga0097620_100001408 Ga0097620_1000014088 96
53 3300009101 Ga0105247_10000051 Ga0105247_1000005181 96
54 3300009177 Ga0105248_10000281 Ga0105248_1000028154 96
55 3300009553 Ga0105249_10000020 Ga0105249_1000002056 96
56 3300013306 Ga0163162_10514305 Ga0163162_105143053 96
57 3300013308 Ga0157375_11241746 Ga0157375_112417462 96
58 3300014325 Ga0163163_10036630 Ga0163163_100366304 96
59 3300014326 Ga0157380_12932428 Ga0157380_129324282 96
60 3300025303 Ga0209051_1043313 Ga0209051_10433133 96
61 3300025900 Ga0207710_10000010 Ga0207710_10000010186 96
62 3300025923 Ga0207681_10007094 Ga0207681_100070946 96
63 3300025941 Ga0207711_10004238 Ga0207711_100042388 96
64 3300025961 Ga0207712_10000010 Ga0207712_10000010208 96
65 3300025986 Ga0207658_10000138 Ga0207658_1000013851 96
66 3300026035 Ga0207703_10288690 Ga0207703_102886903 96
67 3300026067 Ga0207678_10242195 Ga0207678_102421952 96
68 3300026088 Ga0207641_10001050 Ga0207641_1000105021 96
69 3300028379 Ga0268266_10045909 Ga0268266_100459092 96
70 3300028380 Ga0268265_10000014 Ga0268265_10000014234 96
71 3300028381 Ga0268264_10000137 Ga0268264_1000013782 96
72 3300048903 Ga0496100_0011216 Ga0496100_0011216_188_508 96
73 3300048904 Ga0496101_0100175 Ga0496101_0100175_159_479 96
74 3300048905 Ga0496102_0000118 Ga0496102_0000118_31845_32165 96
75 3300048905 Ga0496102_0053345 Ga0496102_0053345_2645_2962 96
76 3300048906 Ga0496103_0000129 Ga0496103_0000129_55664_55984 96
77 3300048909 Ga0496106_0044396 Ga0496106_0044396_744_1064 96
78 3300048909 Ga0496106_0460102 Ga0496106_0460102_296_613 96
79 3300048910 Ga0496107_0203206 Ga0496107_0203206_1084_1401 96
80 3300048910 Ga0496107_0773780 Ga0496107_0773780_69_389 96
81 3300048917 Ga0496114_0604372 Ga0496114_0604372_159_479 96
82 3300048917 Ga0496114_1651667 Ga0496114_1651667_18_335 96
83 3300048919 Ga0496116_0034563 Ga0496116_0034563_1064_1384 96
84 3300048920 Ga0496117_0001082 Ga0496117_0001082_4151_4471 96
85 3300048921 Ga0496118_0001559 Ga0496118_0001559_15672_15992 96
86 3300048922 Ga0496119_0004722 Ga0496119_0004722_2535_2855 96
87 3300048924 Ga0496121_0010275 Ga0496121_0010275_1658_1978 96
88 3300048927 Ga0496124_0144736 Ga0496124_0144736_1114_1434 96
89 3300048928 Ga0496125_0279294 Ga0496125_0279294_90_410 96
90 3300048929 Ga0496126_0003099 Ga0496126_0003099_12672_12992 96
91 3300053080 Ga0500635_0165800 Ga0500635_0165800_88_399 96
92 3300005539 Ga0068853_100060937 Ga0068853_1000609374 97
93 3300005937 Ga0081455_10047173 Ga0081455_100471734 97
94 3300006038 Ga0075365_11046277 Ga0075365_110462772 97
95 3300006042 Ga0075368_10539006 Ga0075368_105390061 97
96 3300006186 Ga0075369_10010001 Ga0075369_100100012 97
97 3300006186 Ga0075369_10035208 Ga0075369_100352082 97
98 3300006353 Ga0075370_11032558 Ga0075370_110325582 97
99 3300025273 Ga0209673_1082741 Ga0209673_10827412 97
100 3300025303 Ga0209051_1000337 Ga0209051_100033727 97
101 3300025303 Ga0209051_1001757 Ga0209051_100175718 97
102 3300025303 Ga0209051_1085151 Ga0209051_10851512 97
103 3300028379 Ga0268266_10204177 Ga0268266_102041772 97
104 3300044694 Ga0466963_0621077 Ga0466963_0621077_208_561 97
105 3300045976 Ga0466967_0392001 Ga0466967_0392001_763_1116 97
106 3300046460 Ga0495638_0473589 Ga0495638_0473589_246_560 97
107 3300046663 Ga0495635_0110833 Ga0495635_0110833_84_395 97
108 3300047320 Ga0495672_0196747 Ga0495672_0196747_545_859 97
109 3300047472 Ga0495686_0028920 Ga0495686_0028920_1001_1312 97
110 3300048903 Ga0496100_0369431 Ga0496100_0369431_478_792 97
111 3300048904 Ga0496101_0063476 Ga0496101_0063476_1740_2054 97
112 3300048925 Ga0496122_0155025 Ga0496122_0155025_432_746 97
113 3300048928 Ga0496125_0054375 Ga0496125_0054375_2198_2512 97
114 3300048929 Ga0496126_0391819 Ga0496126_0391819_755_1069 97
115 3300048929 Ga0496126_0772975 Ga0496126_0772975_290_604 97
116 3300049460 Ga0495682_0368152 Ga0495682_0368152_151_459 97
117 3300050492 nmdc:mga0yw44_109248_c1 nmdc:mga0yw44_109248_c1_469_783 97
118 3300050492 nmdc:mga0yw44_974455_c1 nmdc:mga0yw44_974455_c1_35_349 97
119 3300050496 nmdc:mga07m45_523985_c1 nmdc:mga07m45_523985_c1_136_456 97
120 3300050516 nmdc:mga0sz30_158226_c1 nmdc:mga0sz30_158226_c1_88_402 97
121 3300050516 nmdc:mga0sz30_475536_c1 nmdc:mga0sz30_475536_c1_150_470 97
122 3300053087 Ga0500643_011665 Ga0500643_011665_506_820 97
123 3300053105 Ga0500557_154643 Ga0500557_154643_248_562 97
124 3300053119 Ga0500595_041652 Ga0500595_041652_899_1213 97
125 3300053131 Ga0500652_000157 Ga0500652_000157_19686_19988 97
126 3300053131 Ga0500652_010812 Ga0500652_010812_39_353 97
127 3300053136 Ga0500559_0402279 Ga0500559_0402279_269_583 97
128 3300053139 Ga0500568_0135322 Ga0500568_0135322_233_547 97
129 3300053139 Ga0500568_0221846 Ga0500568_0221846_359_673 97
130 3300053158 Ga0500627_0027092 Ga0500627_0027092_577_891 97
131 3300053160 Ga0500633_0391755 Ga0500633_0391755_105_419 97
132 3300053730 Ga0500645_000046 Ga0500645_000046_31675_31989 97
133 3300053730 Ga0500645_012356 Ga0500645_012356_1444_1758 97
134 iso_pu_bacteria 2643221687 2644490810 97
135 iso_pu_bacteria 2738541274 2738704872 97
136 iso_pu_bacteria 2738543028 2739330042 97
137 iso_pu_bacteria 2902792274 2902798820 97
138 iso_pu_bacteria 2902799365 2902803431 97
139 iso_pu_bacteria 2902837492 2902844036 97
140 3300002070 JGI24750J21931_1003013 JGI24750J21931_10030132 98
141 3300002073 JGI24745J21846_1006556 JGI24745J21846_10065562 98
142 3300002073 JGI24745J21846_1018160 JGI24745J21846_10181601 98
143 3300002075 JGI24738J21930_10020817 JGI24738J21930_100208172 98
144 3300002077 JGI24744J21845_10000526 JGI24744J21845_100005267 98
145 3300002239 JGI24034J26672_10041453 JGI24034J26672_100414531 98
146 3300002239 JGI24034J26672_10075788 JGI24034J26672_100757881 98
147 3300002239 JGI24034J26672_10077968 JGI24034J26672_100779682 98
148 3300002459 JGI24751J29686_10025804 JGI24751J29686_100258042 98
149 3300005328 Ga0070676_10000765 Ga0070676_1000076514 98
150 3300005328 Ga0070676_10358230 Ga0070676_103582302 98
151 3300005330 Ga0070690_100001057 Ga0070690_10000105712 98
152 3300005330 Ga0070690_100851048 Ga0070690_1008510481 98
153 3300005334 Ga0068869_100058035 Ga0068869_1000580353 98
154 3300005334 Ga0068869_100173299 Ga0068869_1001732993 98
155 3300005335 Ga0070666_10058634 Ga0070666_100586342 98
156 3300005335 Ga0070666_10102512 Ga0070666_101025122 98
157 3300005337 Ga0070682_100117589 Ga0070682_1001175892 98
158 3300005337 Ga0070682_100367759 Ga0070682_1003677592 98
159 3300005338 Ga0068868_100002797 Ga0068868_1000027977 98
160 3300005338 Ga0068868_100297776 Ga0068868_1002977762 98
161 3300005338 Ga0068868_100478048 Ga0068868_1004780482 98
162 3300005339 Ga0070660_100302713 Ga0070660_1003027132 98
163 3300005340 Ga0070689_100011907 Ga0070689_1000119073 98
164 3300005340 Ga0070689_100588546 Ga0070689_1005885462 98
165 3300005341 Ga0070691_10008985 Ga0070691_100089854 98
166 3300005341 Ga0070691_10415478 Ga0070691_104154781 98
167 3300005343 Ga0070687_100237034 Ga0070687_1002370342 98
168 3300005345 Ga0070692_10225578 Ga0070692_102255781 98
169 3300005345 Ga0070692_10533761 Ga0070692_105337611 98
170 3300005347 Ga0070668_100001074 Ga0070668_10000107417 98
171 3300005347 Ga0070668_100049167 Ga0070668_1000491672 98
172 3300005347 Ga0070668_100381475 Ga0070668_1003814752 98
173 3300005347 Ga0070668_100432714 Ga0070668_1004327142 98
174 3300005347 Ga0070668_100601714 Ga0070668_1006017141 98
175 3300005347 Ga0070668_100785338 Ga0070668_1007853382 98
176 3300005353 Ga0070669_100003224 Ga0070669_1000032249 98
177 3300005353 Ga0070669_100015223 Ga0070669_1000152232 98
178 3300005354 Ga0070675_101485832 Ga0070675_1014858321 98
179 3300005355 Ga0070671_100003956 Ga0070671_1000039569 98
180 3300005355 Ga0070671_100075988 Ga0070671_1000759883 98
181 3300005355 Ga0070671_100270719 Ga0070671_1002707192 98
182 3300005355 Ga0070671_100499755 Ga0070671_1004997551 98
183 3300005356 Ga0070674_100007340 Ga0070674_1000073402 98
184 3300005364 Ga0070673_100123947 Ga0070673_1001239472 98
185 3300005365 Ga0070688_100044249 Ga0070688_1000442492 98
186 3300005365 Ga0070688_100070028 Ga0070688_1000700282 98
187 3300005365 Ga0070688_100281382 Ga0070688_1002813821 98
188 3300005366 Ga0070659_100165307 Ga0070659_1001653072 98
189 3300005367 Ga0070667_100000190 Ga0070667_10000019022 98
190 3300005367 Ga0070667_100002951 Ga0070667_1000029516 98
191 3300005367 Ga0070667_100005052 Ga0070667_10000505210 98
192 3300005367 Ga0070667_101581688 Ga0070667_1015816882 98
193 3300005434 Ga0070709_10018435 Ga0070709_100184356 98
194 3300005435 Ga0070714_101645903 Ga0070714_1016459031 98
195 3300005436 Ga0070713_101560167 Ga0070713_1015601671 98
196 3300005437 Ga0070710_10006861 Ga0070710_100068612 98
197 3300005437 Ga0070710_10079349 Ga0070710_100793492 98
198 3300005438 Ga0070701_10003769 Ga0070701_100037696 98
199 3300005438 Ga0070701_10010283 Ga0070701_100102834 98
200 3300005439 Ga0070711_100009495 Ga0070711_1000094957 98
201 3300005439 Ga0070711_100010820 Ga0070711_1000108206 98
202 3300005439 Ga0070711_100780630 Ga0070711_1007806302 98
203 3300005439 Ga0070711_101254511 Ga0070711_1012545111 98
204 3300005440 Ga0070705_100009639 Ga0070705_1000096396 98
205 3300005441 Ga0070700_100315338 Ga0070700_1003153381 98
206 3300005444 Ga0070694_100048486 Ga0070694_1000484864 98
207 3300005455 Ga0070663_100005933 Ga0070663_1000059332 98
208 3300005455 Ga0070663_100418148 Ga0070663_1004181482 98
209 3300005456 Ga0070678_100000395 Ga0070678_1000003952 98
210 3300005456 Ga0070678_100090400 Ga0070678_1000904002 98
211 3300005457 Ga0070662_100001560 Ga0070662_10000156010 98
212 3300005457 Ga0070662_100089314 Ga0070662_1000893143 98
213 3300005457 Ga0070662_101024319 Ga0070662_1010243191 98
214 3300005459 Ga0068867_100004211 Ga0068867_10000421112 98
215 3300005466 Ga0070685_10066316 Ga0070685_100663162 98
216 3300005466 Ga0070685_10880165 Ga0070685_108801652 98
217 3300005539 Ga0068853_100048884 Ga0068853_1000488842 98
218 3300005543 Ga0070672_100219281 Ga0070672_1002192813 98
219 3300005543 Ga0070672_101640461 Ga0070672_1016404612 98
220 3300005544 Ga0070686_101218799 Ga0070686_1012187991 98
221 3300005545 Ga0070695_100001869 Ga0070695_1000018694 98
222 3300005545 Ga0070695_100268110 Ga0070695_1002681102 98
223 3300005545 Ga0070695_101410182 Ga0070695_1014101821 98
224 3300005546 Ga0070696_100012678 Ga0070696_1000126784 98
225 3300005546 Ga0070696_100216459 Ga0070696_1002164592 98
226 3300005547 Ga0070693_100022684 Ga0070693_1000226843 98
227 3300005547 Ga0070693_100066224 Ga0070693_1000662242 98
228 3300005548 Ga0070665_100008287 Ga0070665_1000082879 98
229 3300005548 Ga0070665_100050218 Ga0070665_1000502181 98
230 3300005548 Ga0070665_100058164 Ga0070665_1000581645 98
231 3300005548 Ga0070665_100858899 Ga0070665_1008588992 98
232 3300005548 Ga0070665_100859756 Ga0070665_1008597563 98
233 3300005549 Ga0070704_100000774 Ga0070704_10000077414 98
234 3300005549 Ga0070704_101252927 Ga0070704_1012529272 98
235 3300005563 Ga0068855_100059475 Ga0068855_1000594753 98
236 3300005563 Ga0068855_100425582 Ga0068855_1004255822 98
237 3300005578 Ga0068854_100011795 Ga0068854_1000117953 98
238 3300005578 Ga0068854_100302463 Ga0068854_1003024632 98
239 3300005614 Ga0068856_100360816 Ga0068856_1003608162 98
240 3300005615 Ga0070702_100000892 Ga0070702_1000008923 98
241 3300005615 Ga0070702_100441725 Ga0070702_1004417252 98
242 3300005615 Ga0070702_101016271 Ga0070702_1010162712 98
243 3300005617 Ga0068859_100001075 Ga0068859_10000107526 98
244 3300005617 Ga0068859_100001408 Ga0068859_1000014089 98
245 3300005618 Ga0068864_100112908 Ga0068864_1001129082 98
246 3300005618 Ga0068864_101762267 Ga0068864_1017622671 98
247 3300005618 Ga0068864_102131812 Ga0068864_1021318121 98
248 3300005718 Ga0068866_10002224 Ga0068866_100022245 98
249 3300005719 Ga0068861_100005526 Ga0068861_1000055267 98
250 3300005719 Ga0068861_100070384 Ga0068861_1000703844 98
251 3300005719 Ga0068861_100183953 Ga0068861_1001839533 98
252 3300005719 Ga0068861_100275405 Ga0068861_1002754052 98
253 3300005719 Ga0068861_100903187 Ga0068861_1009031872 98
254 3300005834 Ga0068851_10057490 Ga0068851_100574902 98
255 3300005840 Ga0068870_10266666 Ga0068870_102666662 98
256 3300005841 Ga0068863_100000733 Ga0068863_10000073327 98
257 3300005841 Ga0068863_100001346 Ga0068863_1000013463 98
258 3300005841 Ga0068863_100618555 Ga0068863_1006185553 98
259 3300005841 Ga0068863_101088495 Ga0068863_1010884952 98
260 3300005842 Ga0068858_100010273 Ga0068858_1000102734 98
261 3300005842 Ga0068858_100041018 Ga0068858_1000410186 98
262 3300005842 Ga0068858_100160530 Ga0068858_1001605303 98
263 3300005842 Ga0068858_100703914 Ga0068858_1007039142 98
264 3300005842 Ga0068858_101126566 Ga0068858_1011265661 98
265 3300005842 Ga0068858_102474813 Ga0068858_1024748132 98
266 3300005843 Ga0068860_100000099 Ga0068860_10000009983 98
267 3300005843 Ga0068860_100019337 Ga0068860_1000193372 98
268 3300005843 Ga0068860_100128147 Ga0068860_1001281472 98
269 3300005843 Ga0068860_100268175 Ga0068860_1002681752 98
270 3300005843 Ga0068860_100417228 Ga0068860_1004172282 98
271 3300005843 Ga0068860_100469523 Ga0068860_1004695232 98
272 3300005844 Ga0068862_100000086 Ga0068862_10000008684 98
273 3300005844 Ga0068862_100002174 Ga0068862_1000021743 98
274 3300005844 Ga0068862_100133917 Ga0068862_1001339173 98
275 3300005937 Ga0081455_10046827 Ga0081455_100468276 98
276 3300005983 Ga0081540_1120994 Ga0081540_11209942 98
277 3300006042 Ga0075368_10061159 Ga0075368_100611593 98
278 3300006051 Ga0075364_10013715 Ga0075364_100137154 98
279 3300006051 Ga0075364_10408327 Ga0075364_104083271 98
280 3300006051 Ga0075364_10553116 Ga0075364_105531162 98
281 3300006163 Ga0070715_10006927 Ga0070715_100069273 98
282 3300006163 Ga0070715_10283081 Ga0070715_102830812 98
283 3300006173 Ga0070716_100025278 Ga0070716_1000252784 98
284 3300006173 Ga0070716_100090182 Ga0070716_1000901823 98
285 3300006173 Ga0070716_100459947 Ga0070716_1004599472 98
286 3300006173 Ga0070716_100596717 Ga0070716_1005967171 98
287 3300006175 Ga0070712_100005590 Ga0070712_1000055902 98
288 3300006175 Ga0070712_100120437 Ga0070712_1001204373 98
289 3300006175 Ga0070712_100983303 Ga0070712_1009833031 98
290 3300006175 Ga0070712_101828698 Ga0070712_1018286982 98
291 3300006177 Ga0075362_10235101 Ga0075362_102351011 98
292 3300006186 Ga0075369_10003674 Ga0075369_100036743 98
293 3300006186 Ga0075369_10084923 Ga0075369_100849231 98
294 3300006186 Ga0075369_10091654 Ga0075369_100916542 98
295 3300006186 Ga0075369_10180064 Ga0075369_101800643 98
296 3300006195 Ga0075366_10635448 Ga0075366_106354482 98
297 3300006237 Ga0097621_100032958 Ga0097621_1000329582 98
298 3300006237 Ga0097621_100500690 Ga0097621_1005006901 98
299 3300006353 Ga0075370_10875698 Ga0075370_108756981 98
300 3300006358 Ga0068871_100083806 Ga0068871_1000838062 98
301 3300006358 Ga0068871_100125755 Ga0068871_1001257552 98
302 3300006844 Ga0075428_100010510 Ga0075428_1000105102 98
303 3300006846 Ga0075430_100141317 Ga0075430_1001413172 98
304 3300006847 Ga0075431_100015870 Ga0075431_1000158706 98
305 3300006852 Ga0075433_10776113 Ga0075433_107761132 98
306 3300006881 Ga0068865_100000458 Ga0068865_1000004588 98
307 3300006881 Ga0068865_100308779 Ga0068865_1003087792 98
308 3300006931 Ga0097620_100001075 Ga0097620_1000010757 98
309 3300006931 Ga0097620_100001408 Ga0097620_1000014089 98
310 3300009036 Ga0105244_10129580 Ga0105244_101295802 98
311 3300009092 Ga0105250_10030702 Ga0105250_100307022 98
312 3300009098 Ga0105245_10022230 Ga0105245_100222307 98
313 3300009098 Ga0105245_13086145 Ga0105245_130861451 98
314 3300009101 Ga0105247_10000698 Ga0105247_1000069827 98
315 3300009101 Ga0105247_10098965 Ga0105247_100989652 98
316 3300009101 Ga0105247_10141624 Ga0105247_101416242 98
317 3300009147 Ga0114129_10018925 Ga0114129_100189253 98
318 3300009148 Ga0105243_10004338 Ga0105243_100043382 98
319 3300009174 Ga0105241_10065455 Ga0105241_100654552 98
320 3300009176 Ga0105242_10031300 Ga0105242_100313002 98
321 3300009177 Ga0105248_10005799 Ga0105248_1000579916 98
322 3300009177 Ga0105248_10007577 Ga0105248_100075775 98
323 3300009177 Ga0105248_10848750 Ga0105248_108487501 98
324 3300009545 Ga0105237_10035391 Ga0105237_100353913 98
325 3300009545 Ga0105237_10121629 Ga0105237_101216294 98
326 3300009551 Ga0105238_10372110 Ga0105238_103721102 98
327 3300009553 Ga0105249_10002502 Ga0105249_1000250213 98
328 3300009553 Ga0105249_10012519 Ga0105249_100125192 98
329 3300009553 Ga0105249_10420695 Ga0105249_104206951 98
330 3300009553 Ga0105249_10799063 Ga0105249_107990632 98
331 3300010375 Ga0105239_10003845 Ga0105239_1000384521 98
332 3300010375 Ga0105239_11882104 Ga0105239_118821041 98
333 3300010375 Ga0105239_12853905 Ga0105239_128539051 98
334 3300011119 Ga0105246_10243030 Ga0105246_102430302 98
335 3300011119 Ga0105246_10782461 Ga0105246_107824612 98
336 3300013100 Ga0157373_10250879 Ga0157373_102508792 98
337 3300013104 Ga0157370_10603670 Ga0157370_106036701 98
338 3300013105 Ga0157369_10222522 Ga0157369_102225222 98
339 3300013296 Ga0157374_10554193 Ga0157374_105541932 98
340 3300013297 Ga0157378_10002421 Ga0157378_1000242112 98
341 3300013297 Ga0157378_10217994 Ga0157378_102179942 98
342 3300013297 Ga0157378_10774323 Ga0157378_107743232 98
343 3300013306 Ga0163162_10013181 Ga0163162_100131816 98
344 3300013306 Ga0163162_10459355 Ga0163162_104593552 98
345 3300013307 Ga0157372_10007108 Ga0157372_100071086 98
346 3300013308 Ga0157375_10000478 Ga0157375_100004789 98
347 3300013308 Ga0157375_10547995 Ga0157375_105479953 98
348 3300013308 Ga0157375_10812317 Ga0157375_108123172 98
349 3300014325 Ga0163163_10034063 Ga0163163_100340633 98
350 3300014325 Ga0163163_10487212 Ga0163163_104872122 98
351 3300014326 Ga0157380_10000372 Ga0157380_1000037226 98
352 3300014326 Ga0157380_11436736 Ga0157380_114367362 98
353 3300014745 Ga0157377_10059457 Ga0157377_100594571 98
354 3300014745 Ga0157377_10096250 Ga0157377_100962502 98
355 3300014745 Ga0157377_10977598 Ga0157377_109775982 98
356 3300014968 Ga0157379_10018849 Ga0157379_100188494 98
357 3300017792 Ga0163161_10000595 Ga0163161_100005957 98
358 3300017792 Ga0163161_10218613 Ga0163161_102186132 98
359 3300017792 Ga0163161_10999198 Ga0163161_109991981 98
360 3300017792 Ga0163161_11019367 Ga0163161_110193672 98
361 3300017792 Ga0163161_11208811 Ga0163161_112088112 98
362 3300025321 Ga0207656_10626442 Ga0207656_106264421 98
363 3300025885 Ga0207653_10112252 Ga0207653_101122522 98
364 3300025893 Ga0207682_10160817 Ga0207682_101608171 98
365 3300025898 Ga0207692_10012504 Ga0207692_100125043 98
366 3300025898 Ga0207692_10014333 Ga0207692_100143333 98
367 3300025899 Ga0207642_10000408 Ga0207642_100004086 98
368 3300025900 Ga0207710_10000010 Ga0207710_10000010187 98
369 3300025900 Ga0207710_10008903 Ga0207710_100089034 98
370 3300025900 Ga0207710_10029044 Ga0207710_100290442 98
371 3300025900 Ga0207710_10041843 Ga0207710_100418433 98
372 3300025900 Ga0207710_10103361 Ga0207710_101033613 98
373 3300025901 Ga0207688_10004583 Ga0207688_100045835 98
374 3300025901 Ga0207688_10005507 Ga0207688_100055074 98
375 3300025903 Ga0207680_10057517 Ga0207680_100575172 98
376 3300025903 Ga0207680_10084852 Ga0207680_100848522 98
377 3300025903 Ga0207680_10712826 Ga0207680_107128262 98
378 3300025904 Ga0207647_10044672 Ga0207647_100446722 98
379 3300025904 Ga0207647_10427706 Ga0207647_104277061 98
380 3300025905 Ga0207685_10122336 Ga0207685_101223362 98
381 3300025905 Ga0207685_10220671 Ga0207685_102206712 98
382 3300025906 Ga0207699_10015221 Ga0207699_100152211 98
383 3300025906 Ga0207699_10071715 Ga0207699_100717152 98
384 3300025907 Ga0207645_10011590 Ga0207645_100115904 98
385 3300025907 Ga0207645_10140028 Ga0207645_101400282 98
386 3300025908 Ga0207643_11040776 Ga0207643_110407761 98
387 3300025911 Ga0207654_10036263 Ga0207654_100362633 98
388 3300025913 Ga0207695_10592065 Ga0207695_105920651 98
389 3300025914 Ga0207671_10526340 Ga0207671_105263402 98
390 3300025914 Ga0207671_10747668 Ga0207671_107476682 98
391 3300025915 Ga0207693_10000430 Ga0207693_100004306 98
392 3300025915 Ga0207693_10021746 Ga0207693_100217462 98
393 3300025915 Ga0207693_11162841 Ga0207693_111628412 98
394 3300025916 Ga0207663_10008638 Ga0207663_100086386 98
395 3300025916 Ga0207663_10261024 Ga0207663_102610241 98
396 3300025918 Ga0207662_10205645 Ga0207662_102056452 98
397 3300025919 Ga0207657_10079858 Ga0207657_100798582 98
398 3300025919 Ga0207657_10142276 Ga0207657_101422763 98
399 3300025923 Ga0207681_10007094 Ga0207681_100070945 98
400 3300025923 Ga0207681_10057116 Ga0207681_100571162 98
401 3300025923 Ga0207681_10596212 Ga0207681_105962122 98
402 3300025924 Ga0207694_10989179 Ga0207694_109891792 98
403 3300025927 Ga0207687_10005729 Ga0207687_100057292 98
404 3300025927 Ga0207687_10116209 Ga0207687_101162092 98
405 3300025929 Ga0207664_10489351 Ga0207664_104893512 98
406 3300025929 Ga0207664_11976514 Ga0207664_119765141 98
407 3300025931 Ga0207644_10117600 Ga0207644_101176002 98
408 3300025931 Ga0207644_10475690 Ga0207644_104756902 98
409 3300025931 Ga0207644_10953489 Ga0207644_109534892 98
410 3300025932 Ga0207690_10317225 Ga0207690_103172252 98
411 3300025932 Ga0207690_10446865 Ga0207690_104468652 98
412 3300025933 Ga0207706_10005158 Ga0207706_100051589 98
413 3300025933 Ga0207706_10019851 Ga0207706_100198515 98
414 3300025934 Ga0207686_10006430 Ga0207686_100064307 98
415 3300025934 Ga0207686_10488380 Ga0207686_104883801 98
416 3300025934 Ga0207686_10850549 Ga0207686_108505492 98
417 3300025935 Ga0207709_10220416 Ga0207709_102204163 98
418 3300025935 Ga0207709_10227970 Ga0207709_102279702 98
419 3300025936 Ga0207670_10103278 Ga0207670_101032783 98
420 3300025936 Ga0207670_10709421 Ga0207670_107094212 98
421 3300025937 Ga0207669_10000296 Ga0207669_1000029614 98
422 3300025938 Ga0207704_10002460 Ga0207704_100024607 98
423 3300025939 Ga0207665_10002077 Ga0207665_1000207711 98
424 3300025939 Ga0207665_10027975 Ga0207665_100279756 98
425 3300025939 Ga0207665_10506982 Ga0207665_105069822 98
426 3300025940 Ga0207691_10534340 Ga0207691_105343402 98
427 3300025941 Ga0207711_10004238 Ga0207711_100042389 98
428 3300025941 Ga0207711_10015175 Ga0207711_100151756 98
429 3300025941 Ga0207711_10022398 Ga0207711_100223982 98
430 3300025941 Ga0207711_10205394 Ga0207711_102053942 98
431 3300025941 Ga0207711_11169852 Ga0207711_111698522 98
432 3300025942 Ga0207689_10050090 Ga0207689_100500902 98
433 3300025942 Ga0207689_10132638 Ga0207689_101326381 98
434 3300025949 Ga0207667_10047710 Ga0207667_100477102 98
435 3300025949 Ga0207667_11150955 Ga0207667_111509551 98
436 3300025961 Ga0207712_10000010 Ga0207712_10000010207 98
437 3300025961 Ga0207712_10019182 Ga0207712_100191824 98
438 3300025961 Ga0207712_10105891 Ga0207712_101058913 98
439 3300025961 Ga0207712_10379021 Ga0207712_103790212 98
440 3300025961 Ga0207712_11251936 Ga0207712_112519361 98
441 3300025972 Ga0207668_10004007 Ga0207668_100040073 98
442 3300025972 Ga0207668_10124408 Ga0207668_101244082 98
443 3300025972 Ga0207668_10264061 Ga0207668_102640613 98
444 3300025972 Ga0207668_10275274 Ga0207668_102752742 98
445 3300025972 Ga0207668_11304817 Ga0207668_113048172 98
446 3300025972 Ga0207668_11542632 Ga0207668_115426322 98
447 3300025981 Ga0207640_10015394 Ga0207640_100153944 98
448 3300025981 Ga0207640_10679705 Ga0207640_106797052 98
449 3300025986 Ga0207658_10000138 Ga0207658_1000013852 98
450 3300025986 Ga0207658_10051957 Ga0207658_100519573 98
451 3300025986 Ga0207658_10087637 Ga0207658_100876372 98
452 3300025986 Ga0207658_10536639 Ga0207658_105366392 98
453 3300025986 Ga0207658_10905030 Ga0207658_109050302 98
454 3300025986 Ga0207658_10993887 Ga0207658_109938872 98
455 3300026023 Ga0207677_10003414 Ga0207677_100034144 98
456 3300026023 Ga0207677_10181710 Ga0207677_101817102 98
457 3300026035 Ga0207703_10004928 Ga0207703_100049285 98
458 3300026035 Ga0207703_10005445 Ga0207703_1000544510 98
459 3300026035 Ga0207703_10288690 Ga0207703_102886902 98
460 3300026041 Ga0207639_10020251 Ga0207639_100202516 98
461 3300026041 Ga0207639_10086289 Ga0207639_100862893 98
462 3300026067 Ga0207678_10023539 Ga0207678_100235396 98
463 3300026067 Ga0207678_10035430 Ga0207678_100354304 98
464 3300026075 Ga0207708_10015821 Ga0207708_100158213 98
465 3300026075 Ga0207708_10016087 Ga0207708_100160874 98
466 3300026078 Ga0207702_10432124 Ga0207702_104321242 98
467 3300026088 Ga0207641_10001050 Ga0207641_1000105022 98
468 3300026088 Ga0207641_10001782 Ga0207641_1000178216 98
469 3300026088 Ga0207641_10297085 Ga0207641_102970852 98
470 3300026088 Ga0207641_10338605 Ga0207641_103386051 98
471 3300026089 Ga0207648_10147051 Ga0207648_101470512 98
472 3300026095 Ga0207676_10120283 Ga0207676_101202832 98
473 3300026095 Ga0207676_10172509 Ga0207676_101725092 98
474 3300026095 Ga0207676_11726660 Ga0207676_117266602 98
475 3300026118 Ga0207675_100000192 Ga0207675_10000019240 98
476 3300026118 Ga0207675_100255343 Ga0207675_1002553431 98
477 3300026118 Ga0207675_100269282 Ga0207675_1002692822 98
478 3300026118 Ga0207675_100294953 Ga0207675_1002949531 98
479 3300026118 Ga0207675_100942331 Ga0207675_1009423312 98
480 3300026121 Ga0207683_10038090 Ga0207683_100380906 98
481 3300026121 Ga0207683_10038873 Ga0207683_100388734 98
482 3300026121 Ga0207683_10103817 Ga0207683_101038172 98
483 3300027512 Ga0209179_1017514 Ga0209179_10175142 98
484 3300027907 Ga0207428_10462909 Ga0207428_104629092 98
485 3300028379 Ga0268266_10003241 Ga0268266_1000324110 98
486 3300028379 Ga0268266_10015126 Ga0268266_100151262 98
487 3300028379 Ga0268266_10045909 Ga0268266_100459091 98
488 3300028379 Ga0268266_10335877 Ga0268266_103358772 98
489 3300028379 Ga0268266_12155606 Ga0268266_121556061 98
490 3300028380 Ga0268265_10000014 Ga0268265_10000014235 98
491 3300028380 Ga0268265_10003449 Ga0268265_100034493 98
492 3300028381 Ga0268264_10000137 Ga0268264_1000013783 98
493 3300028381 Ga0268264_10012916 Ga0268264_100129162 98
494 3300028381 Ga0268264_10083051 Ga0268264_100830512 98
495 3300028381 Ga0268264_10098581 Ga0268264_100985812 98
496 3300028381 Ga0268264_10661646 Ga0268264_106616462 98
497 3300031824 Ga0307413_10893393 Ga0307413_108933931 98
498 3300031852 Ga0307410_10373809 Ga0307410_103738092 98
499 3300031995 Ga0307409_100185565 Ga0307409_1001855652 98
500 3300031995 Ga0307409_100273843 Ga0307409_1002738432 98
501 3300032002 Ga0307416_102303186 Ga0307416_1023031861 98
502 3300032126 Ga0307415_100632782 Ga0307415_1006327822 98
503 3300035088 Ga0373940_0113956 Ga0373940_0113956_423_719 98
504 3300035115 Ga0373941_0050030 Ga0373941_0050030_896_1207 98
505 3300035115 Ga0373941_0491709 Ga0373941_0491709_121_417 98
506 3300035207 Ga0373942_0021221 Ga0373942_0021221_1160_1471 98
507 3300035691 Ga0373931_0042154 Ga0373931_0042154_1939_2235 98
508 3300037418 Ga0395900_0536107 Ga0395900_0536107_153_449 98
509 3300041410 Ga0439461_0009338 Ga0439461_0009338_561_872 98
510 3300041411 Ga0439466_0006569 Ga0439466_0006569_2669_2980 98
511 3300041413 Ga0439465_0004922 Ga0439465_0004922_1513_1824 98
512 3300041413 Ga0439465_0046457 Ga0439465_0046457_802_1113 98
513 3300041413 Ga0439465_0267873 Ga0439465_0267873_42_353 98
514 3300041496 Ga0451839_0328336 Ga0451839_0328336_222_545 98
515 3300042004 Ga0439445_0143758 Ga0439445_0143758_137_448 98
516 3300042435 Ga0439434_0228705 Ga0439434_0228705_187_483 98
517 3300044658 Ga0466972_0157181 Ga0466972_0157181_398_751 98
518 3300044658 Ga0466972_0227238 Ga0466972_0227238_118_414 98
519 3300044658 Ga0466972_0350956 Ga0466972_0350956_374_670 98
520 3300044684 Ga0466966_0101953 Ga0466966_0101953_228_581 98
521 3300044735 Ga0466968_0122522 Ga0466968_0122522_695_1048 98
522 3300044735 Ga0466968_0639719 Ga0466968_0639719_149_445 98
523 3300045049 Ga0466959_0591249 Ga0466959_0591249_13_324 98
524 3300045836 Ga0466958_0437903 Ga0466958_0437903_422_775 98
525 3300045976 Ga0466967_0112250 Ga0466967_0112250_1701_2012 98
526 3300045976 Ga0466967_1966474 Ga0466967_1966474_228_524 98
527 3300046694 Ga0495649_0040266 Ga0495649_0040266_1232_1528 98
528 3300047321 Ga0495676_0066535 Ga0495676_0066535_306_629 98
529 3300048903 Ga0496100_0014963 Ga0496100_0014963_1257_1553 98
530 3300048903 Ga0496100_0275886 Ga0496100_0275886_280_645 98
531 3300048904 Ga0496101_0445572 Ga0496101_0445572_583_879 98
532 3300048904 Ga0496101_1570210 Ga0496101_1570210_183_494 98
533 3300048905 Ga0496102_0004619 Ga0496102_0004619_5351_5647 98
534 3300048905 Ga0496102_0400553 Ga0496102_0400553_470_835 98
535 3300048906 Ga0496103_0006659 Ga0496103_0006659_2197_2493 98
536 3300048906 Ga0496103_0253943 Ga0496103_0253943_211_576 98
537 3300048906 Ga0496103_0441193 Ga0496103_0441193_279_575 98
538 3300048907 Ga0496104_0004253 Ga0496104_0004253_9883_10248 98
539 3300048907 Ga0496104_0372158 Ga0496104_0372158_656_952 98
540 3300048908 Ga0496105_0159142 Ga0496105_0159142_619_915 98
541 3300048909 Ga0496106_0008760 Ga0496106_0008760_2014_2310 98
542 3300048909 Ga0496106_0021650 Ga0496106_0021650_4276_4587 98
543 3300048909 Ga0496106_0035450 Ga0496106_0035450_1582_1899 98
544 3300048910 Ga0496107_0000264 Ga0496107_0000264_22610_22906 98
545 3300048910 Ga0496107_0266761 Ga0496107_0266761_575_940 98
546 3300048910 Ga0496107_0303079 Ga0496107_0303079_713_1030 98
547 3300048910 Ga0496107_1073427 Ga0496107_1073427_162_458 98
548 3300048911 Ga0496108_0000727 Ga0496108_0000727_14308_14604 98
549 3300048911 Ga0496108_0142682 Ga0496108_0142682_471_794 98
550 3300048912 Ga0496109_0003787 Ga0496109_0003787_11691_11987 98
551 3300048912 Ga0496109_0202232 Ga0496109_0202232_1428_1793 98
552 3300048912 Ga0496109_0356843 Ga0496109_0356843_849_1145 98
553 3300048913 Ga0496110_0009492 Ga0496110_0009492_6766_7062 98
554 3300048913 Ga0496110_0012445 Ga0496110_0012445_3579_3875 98
555 3300048913 Ga0496110_0055240 Ga0496110_0055240_40_405 98
556 3300048914 Ga0496111_0207405 Ga0496111_0207405_781_1077 98
557 3300048914 Ga0496111_0629678 Ga0496111_0629678_111_476 98
558 3300048915 Ga0496112_0009194 Ga0496112_0009194_7156_7452 98
559 3300048915 Ga0496112_0073908 Ga0496112_0073908_1231_1554 98
560 3300048915 Ga0496112_0251032 Ga0496112_0251032_1362_1682 98
561 3300048916 Ga0496113_0201466 Ga0496113_0201466_229_525 98
562 3300048916 Ga0496113_0219247 Ga0496113_0219247_595_891 98
563 3300048917 Ga0496114_0012963 Ga0496114_0012963_2293_2589 98
564 3300048917 Ga0496114_0499150 Ga0496114_0499150_249_560 98
565 3300048918 Ga0496115_0001293 Ga0496115_0001293_11912_12208 98
566 3300048918 Ga0496115_1316855 Ga0496115_1316855_24_320 98
567 3300048921 Ga0496118_0361721 Ga0496118_0361721_372_668 98
568 3300048922 Ga0496119_0249836 Ga0496119_0249836_81_446 98
569 3300049571 Ga0501034_0008271 Ga0501034_0008271_7625_7942 98
570 3300049571 Ga0501034_0223643 Ga0501034_0223643_82_393 98
571 3300049573 Ga0501037_0001235 Ga0501037_0001235_15139_15456 98
572 3300049574 Ga0501038_0014358 Ga0501038_0014358_3479_3796 98
573 3300049575 Ga0501039_0007724 Ga0501039_0007724_3395_3712 98
574 3300049576 Ga0501040_0092682 Ga0501040_0092682_1719_2036 98
575 3300049579 Ga0501043_0008003 Ga0501043_0008003_3404_3721 98
576 3300049586 Ga0501070_0006036 Ga0501070_0006036_7463_7780 98
577 3300049823 Ga0501044_0153878 Ga0501044_0153878_526_843 98
578 3300050489 nmdc:mga03683_18219_c1 nmdc:mga03683_18219_c1_813_1124 98
579 3300050491 nmdc:mga00v17_163956_c1 nmdc:mga00v17_163956_c1_624_935 98
580 3300050492 nmdc:mga0yw44_1063186_c1 nmdc:mga0yw44_1063186_c1_143_454 98
581 3300050493 nmdc:mga0k408_800879_c1 nmdc:mga0k408_800879_c1_83_394 98
582 3300050495 nmdc:mga04h51_231810_c1 nmdc:mga04h51_231810_c1_103_399 98
583 3300050507 nmdc:mga05p37_62609_c1 nmdc:mga05p37_62609_c1_2560_2856 98
584 3300050509 nmdc:mga0qj67_30676_c1 nmdc:mga0qj67_30676_c1_2533_2829 98
585 3300050510 nmdc:mga06r32_178462_c1 nmdc:mga06r32_178462_c1_83_379 98
586 3300050511 nmdc:mga08y16_1276352_c1 nmdc:mga08y16_1276352_c1_90_404 98
587 3300050516 nmdc:mga0sz30_104811_c1 nmdc:mga0sz30_104811_c1_687_983 98
588 3300050516 nmdc:mga0sz30_4948_c1 nmdc:mga0sz30_4948_c1_1133_1444 98
589 3300053083 Ga0495655_0273056 Ga0495655_0273056_161_457 98
590 iso_pu_bacteria 2929212328 2929217300 98
591 iso_pu_bacteria 2939582691 2939584563 98

Feature Viewer

pLDDT pTM Quality
56.91 0.31 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map